5ADQB

Crystal structure of human tankyrase 2 in complex with jw55
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
46
structure length
46
Chain Sequence
b'AHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Development and Structural Analysis of Adenosine Site Binding Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 1
structure length 46
sequence length 46
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1620.50 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like fold 5adqB00
4HKKB 4KZLC 4UI3C 4UI4C 4HLKC 5C5RC 4L2FC 4L09C 4UI8C 4L0BC 4HKIC 4HMHC 4KZQC 4HLMC 4L31C 4KZUC 4L32C 5ADTB 4UI6C 5ADSB 4UVPB 4L34C 4L33C 4L0TC 4L0IC 4L0SC 4UI7C 5C5PC 4L0VC 4L2GC 4HLFC 4HKNC 4HLHC 4UI5C 5ADRB 4HLGC 4L2KC 5FPFC 4HL5C 4L10C 5C5QC 5ADQB
chains in the Genus database with same CATH superfamily
4HKKB 4KZLC 4UI3C 4UI4C 4HLKC 5C5RC 3K33B 4L2FC 4L09C 4UI8C 4L0BC 4HKIC 3G5OA 4HMHC 4KZQC 3K6QA 4HLMC 2ZIXB 3OEIA 4L31C 4ZM0A 4KZUC 3HRYA 3HS2A 4L32C 2A6QA 5ADTB 4UI6C 5ADSB 3OEIE 4UVPB 4L34C 4L10C 4L33C 4L0TC 2ODKA 4L0SC 4UI7C 5C5PC 3KH2E 4L0VC 4L2GC 4ZLXA 4HLFC 4HKNC 4HLHC 4UI5C 3D55A 4ZM2A 5ADRB 3HJ6A 4HLGC 4L2KC 5FPFC 4HL5C 3CTOA 4L0IC 5C5QC 5ADQB
chains in the Genus database with same CATH topology
4HKKB 4KZLC 4UI3C 4UI4C 4HLKC 5C5RC 4L2FC 4L09C 4UI8C 4L0BC 4HKIC 4HMHC 4KZQC 4HLMC 2ZIXB 4L31C 4KZUC 4L32C 5ADTB 4UI6C 5ADSB 4UVPB 4L34C 4L33C 4L0IC 4L0TC 4L0SC 4UI7C 5C5PC 4L0VC 4L2GC 4HLFC 4HKNC 4HLHC 4UI5C 5ADRB 3HJ6A 4HLGC 4L2KC 5FPFC 4HL5C 4L10C 5C5QC 5ADQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HKK B;  4KZL C;  4UI3 C;  4UI4 C;  4HLK C;  5C5R C;  4L2F C;  4L09 C;  4UI8 C;  4L0B C;  4HKI C;  4HMH C;  4KZQ C;  4HLM C;  4L31 C;  4KZU C;  4L32 C;  5ADT B;  4UI6 C;  5ADS B;  4UVP B;  4L34 C;  4L33 C;  4L0T C;  4L0I C;  4L0S C;  4UI7 C;  5C5P C;  4L0V C;  4L2G C;  4HLF C;  4HKN C;  4HLH C;  4UI5 C;  5ADR B;  4HLG C;  4L2K C;  5FPF C;  4HL5 C;  4L10 C;  5C5Q C;  5ADQ B; 
#chains in the Genus database with same CATH topology
 4HKK B;  4KZL C;  4UI3 C;  4UI4 C;  4HLK C;  5C5R C;  3K33 B;  4L2F C;  4L09 C;  4UI8 C;  4L0B C;  4HKI C;  3G5O A;  4HMH C;  4KZQ C;  3K6Q A;  4HLM C;  2ZIX B;  3OEI A;  4L31 C;  4ZM0 A;  4KZU C;  3HRY A;  3HS2 A;  4L32 C;  2A6Q A;  5ADT B;  4UI6 C;  5ADS B;  3OEI E;  4UVP B;  4L34 C;  4L10 C;  4L33 C;  4L0T C;  2ODK A;  4L0S C;  4UI7 C;  5C5P C;  3KH2 E;  4L0V C;  4L2G C;  4ZLX A;  4HLF C;  4HKN C;  4HLH C;  4UI5 C;  3D55 A;  4ZM2 A;  5ADR B;  3HJ6 A;  4HLG C;  4L2K C;  5FPF C;  4HL5 C;  3CTO A;  4L0I C;  5C5Q C;  5ADQ B; 
#chains in the Genus database with same CATH homology
 4HKK B;  4KZL C;  4UI3 C;  4UI4 C;  4HLK C;  5C5R C;  4L2F C;  4L09 C;  4UI8 C;  4L0B C;  4HKI C;  4HMH C;  4KZQ C;  4HLM C;  2ZIX B;  4L31 C;  4KZU C;  4L32 C;  5ADT B;  4UI6 C;  5ADS B;  4UVP B;  4L34 C;  4L33 C;  4L0I C;  4L0T C;  4L0S C;  4UI7 C;  5C5P C;  4L0V C;  4L2G C;  4HLF C;  4HKN C;  4HLH C;  4UI5 C;  5ADR B;  3HJ6 A;  4HLG C;  4L2K C;  5FPF C;  4HL5 C;  4L10 C;  5C5Q C;  5ADQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...