5ADRB

Crystal structure of human tankyrase 2 in complex with od38
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
46
structure length
46
Chain Sequence
b'AHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Development and Structural Analysis of Adenosine Site Binding Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 1
structure length 46
sequence length 46
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1620.50 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like fold 5adrB00
4KZUC 4UI5C 4HLKC 4L0TC 4HLGC 4L32C 4HLMC 4HLFC 4L2GC 4L0BC 4L33C 4UI4C 5C5PC 4L10C 5ADQB 4HLHC 4L2KC 4HKNC 5ADSB 5FPFC 4HL5C 4UI8C 4UI3C 4HKIC 5ADTB 4L31C 4L0VC 4L34C 4HMHC 4UVPB 4KZQC 5ADRB 4HKKB 5C5RC 5C5QC 4UI7C 4UI6C 4L2FC 4L09C 4KZLC 4L0SC 4L0IC
chains in the Genus database with same CATH superfamily
4KZUC 4UI5C 4HLKC 4L0TC 4HLGC 4L32C 4HLMC 4HLFC 4L2GC 4L0BC 4L33C 3K6QA 4UI4C 4ZLXA 3CTOA 4L10C 5C5PC 4ZM0A 5ADQB 4HLHC 3KH2E 4L2KC 3G5OA 3K33B 4HKNC 4L0SC 5ADSB 3HJ6A 2ODKA 2ZIXB 5FPFC 4HL5C 4UI8C 4UI3C 4HKIC 5ADTB 4L31C 4L0VC 3HS2A 3OEIE 4L34C 4HMHC 4UVPB 4KZQC 5ADRB 4HKKB 4ZM2A 4L0IC 5C5RC 2A6QA 5C5QC 3D55A 4UI7C 4UI6C 4L2FC 4L09C 4KZLC 3HRYA 3OEIA
chains in the Genus database with same CATH topology
4KZUC 4UI5C 4HLKC 4L0TC 4HLGC 4L32C 4HLMC 4HLFC 4L2GC 4L0BC 4L33C 4UI4C 5C5PC 4L10C 5ADQB 4HLHC 4L2KC 4HKNC 5ADSB 3HJ6A 2ZIXB 5FPFC 4HL5C 4UI8C 4UI3C 4HKIC 5ADTB 4L31C 4L0VC 4L34C 4HMHC 4UVPB 4KZQC 5ADRB 4HKKB 5C5RC 5C5QC 4UI7C 4UI6C 4L2FC 4L09C 4KZLC 4L0SC 4L0IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KZU C;  4UI5 C;  4HLK C;  4L0T C;  4HLG C;  4L32 C;  4HLM C;  4HLF C;  4L2G C;  4L0B C;  4L33 C;  4UI4 C;  5C5P C;  4L10 C;  5ADQ B;  4HLH C;  4L2K C;  4HKN C;  5ADS B;  5FPF C;  4HL5 C;  4UI8 C;  4UI3 C;  4HKI C;  5ADT B;  4L31 C;  4L0V C;  4L34 C;  4HMH C;  4UVP B;  4KZQ C;  5ADR B;  4HKK B;  5C5R C;  5C5Q C;  4UI7 C;  4UI6 C;  4L2F C;  4L09 C;  4KZL C;  4L0S C;  4L0I C; 
#chains in the Genus database with same CATH topology
 4KZU C;  4UI5 C;  4HLK C;  4L0T C;  4HLG C;  4L32 C;  4HLM C;  4HLF C;  4L2G C;  4L0B C;  4L33 C;  3K6Q A;  4UI4 C;  4ZLX A;  3CTO A;  4L10 C;  5C5P C;  4ZM0 A;  5ADQ B;  4HLH C;  3KH2 E;  4L2K C;  3G5O A;  3K33 B;  4HKN C;  4L0S C;  5ADS B;  3HJ6 A;  2ODK A;  2ZIX B;  5FPF C;  4HL5 C;  4UI8 C;  4UI3 C;  4HKI C;  5ADT B;  4L31 C;  4L0V C;  3HS2 A;  3OEI E;  4L34 C;  4HMH C;  4UVP B;  4KZQ C;  5ADR B;  4HKK B;  4ZM2 A;  4L0I C;  5C5R C;  2A6Q A;  5C5Q C;  3D55 A;  4UI7 C;  4UI6 C;  4L2F C;  4L09 C;  4KZL C;  3HRY A;  3OEI A; 
#chains in the Genus database with same CATH homology
 4KZU C;  4UI5 C;  4HLK C;  4L0T C;  4HLG C;  4L32 C;  4HLM C;  4HLF C;  4L2G C;  4L0B C;  4L33 C;  4UI4 C;  5C5P C;  4L10 C;  5ADQ B;  4HLH C;  4L2K C;  4HKN C;  5ADS B;  3HJ6 A;  2ZIX B;  5FPF C;  4HL5 C;  4UI8 C;  4UI3 C;  4HKI C;  5ADT B;  4L31 C;  4L0V C;  4L34 C;  4HMH C;  4UVP B;  4KZQ C;  5ADR B;  4HKK B;  5C5R C;  5C5Q C;  4UI7 C;  4UI6 C;  4L2F C;  4L09 C;  4KZL C;  4L0S C;  4L0I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...