5ADTB

Crystal structure of human tankyrase 2 in complex with od73
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
46
structure length
46
Chain Sequence
b'AHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TANKYRASE-2
publication title Development and Structural Analysis of Adenosine Site Binding Tankyrase Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 1
structure length 46
sequence length 46
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1620.50 Alpha Beta 3-Layer(aba) Sandwich YefM-like fold YefM-like fold 5adtB00
5FPFC 5C5RC 4HKNC 4HLFC 4HLGC 4L31C 4L32C 4L0BC 4L0SC 4L09C 4UI8C 4HMHC 4L10C 4HLMC 4KZUC 4UI6C 4UI5C 4UI7C 4UVPB 5C5QC 5ADTB 4L34C 4L0VC 4L0IC 4L0TC 4L33C 4HKIC 4UI3C 5ADSB 5ADQB 5ADRB 4HL5C 5C5PC 4KZQC 4HKKB 4KZLC 4HLHC 4L2KC 4HLKC 4UI4C 4L2FC 4L2GC
chains in the Genus database with same CATH superfamily
5FPFC 3KH2E 2ODKA 3K33B 3D55A 5C5RC 3OEIA 4HKNC 4HLFC 4HLGC 4L31C 4L32C 4ZLXA 4ZM0A 4L0BC 4L0SC 4ZM2A 3HS2A 4L09C 4UI8C 4HMHC 3HJ6A 4L10C 4HLMC 4KZUC 4UI6C 4UI5C 3CTOA 3G5OA 4UI7C 4UVPB 5C5QC 5ADTB 4L34C 4L0VC 4L0IC 4L0TC 4L33C 3K6QA 4HKIC 4UI3C 3OEIE 5ADSB 5ADQB 5ADRB 4HL5C 2ZIXB 5C5PC 4KZQC 2A6QA 4HKKB 3HRYA 4KZLC 4HLHC 4L2KC 4HLKC 4UI4C 4L2FC 4L2GC
chains in the Genus database with same CATH topology
5FPFC 5C5RC 4HKNC 4HLFC 4HLGC 4L31C 4L32C 4L0BC 4L0SC 4L09C 4UI8C 4HMHC 3HJ6A 4L10C 4HLMC 4KZUC 4UI6C 4UI5C 4UI7C 4UVPB 5C5QC 5ADTB 4L34C 4L0VC 4L0IC 4L0TC 4L33C 4HKIC 4UI3C 5ADSB 5ADQB 5ADRB 4HL5C 2ZIXB 5C5PC 4KZQC 4HKKB 4KZLC 4HLHC 4L2KC 4HLKC 4UI4C 4L2FC 4L2GC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FPF C;  5C5R C;  4HKN C;  4HLF C;  4HLG C;  4L31 C;  4L32 C;  4L0B C;  4L0S C;  4L09 C;  4UI8 C;  4HMH C;  4L10 C;  4HLM C;  4KZU C;  4UI6 C;  4UI5 C;  4UI7 C;  4UVP B;  5C5Q C;  5ADT B;  4L34 C;  4L0V C;  4L0I C;  4L0T C;  4L33 C;  4HKI C;  4UI3 C;  5ADS B;  5ADQ B;  5ADR B;  4HL5 C;  5C5P C;  4KZQ C;  4HKK B;  4KZL C;  4HLH C;  4L2K C;  4HLK C;  4UI4 C;  4L2F C;  4L2G C; 
#chains in the Genus database with same CATH topology
 5FPF C;  3KH2 E;  2ODK A;  3K33 B;  3D55 A;  5C5R C;  3OEI A;  4HKN C;  4HLF C;  4HLG C;  4L31 C;  4L32 C;  4ZLX A;  4ZM0 A;  4L0B C;  4L0S C;  4ZM2 A;  3HS2 A;  4L09 C;  4UI8 C;  4HMH C;  3HJ6 A;  4L10 C;  4HLM C;  4KZU C;  4UI6 C;  4UI5 C;  3CTO A;  3G5O A;  4UI7 C;  4UVP B;  5C5Q C;  5ADT B;  4L34 C;  4L0V C;  4L0I C;  4L0T C;  4L33 C;  3K6Q A;  4HKI C;  4UI3 C;  3OEI E;  5ADS B;  5ADQ B;  5ADR B;  4HL5 C;  2ZIX B;  5C5P C;  4KZQ C;  2A6Q A;  4HKK B;  3HRY A;  4KZL C;  4HLH C;  4L2K C;  4HLK C;  4UI4 C;  4L2F C;  4L2G C; 
#chains in the Genus database with same CATH homology
 5FPF C;  5C5R C;  4HKN C;  4HLF C;  4HLG C;  4L31 C;  4L32 C;  4L0B C;  4L0S C;  4L09 C;  4UI8 C;  4HMH C;  3HJ6 A;  4L10 C;  4HLM C;  4KZU C;  4UI6 C;  4UI5 C;  4UI7 C;  4UVP B;  5C5Q C;  5ADT B;  4L34 C;  4L0V C;  4L0I C;  4L0T C;  4L33 C;  4HKI C;  4UI3 C;  5ADS B;  5ADQ B;  5ADR B;  4HL5 C;  2ZIX B;  5C5P C;  4KZQ C;  4HKK B;  4KZL C;  4HLH C;  4L2K C;  4HLK C;  4UI4 C;  4L2F C;  4L2G C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...