5ADXU

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
173
structure length
169
Chain Sequence
PGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAHPDNITPDAEKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule keywords ACTIN RELATED PROTEIN 1
molecule tags Structural protein
total genus 31
structure length 169
sequence length 173
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5adxU00
5AFUU 1KRUA 2WLFA 2WLDA 4IHGA 3VBNA 4E6TA 3KWEA 4FCEA 1HM0A 5L6VA 5ADXU 3TWDA 1HM9A 1KK5A 5DEMA 1SSMA 3FSCA 1THJA 3TV0A 1QRGA 3VBJA 2AQ9A 3R3RA 2IU9A 3I3AA 1YP4A 4HZDA 2JF3A 4M98A 3R5BA 4HZCA 3DHOA 2VHEA 5F42A 3BFPA 1TDTA 4IHHA 5DEPA 3F1XA 3FSYA 3FOQA 4KPZA 4E75A 1XATA 3FTTA 2OI7A 5DG3A 3R0SA 1QQ0A 1FWYA 1KHRA 4J18A 3DK5A 2FKOA 3TK8A 3KWDA 3BSYA 3ST8A 3I3XA 1KQAA 3MC4A 2WLCA 3OU9A 3R3IA 3VBPA 3HJJA 4E1KA 5E3QA 3FWWA 3D8VA 2XATA 4M99A 4AA7A 3VBLA 3R5DA 3GOSA 4K6RA 4M2BA 2OEGA 3NZ2A 3TISA 1FXJA 2P2OA 2V0JA 1KRVA 4IHFA 2IU8A 1OCXA 2V0HA 2VD4A 3BSSA 3EG4A 2JF2A 2ICYA 3P1BA 1KRRA 3EEVA 3VBMA 4EQYA 3TDTA 1QREA 4HUSA 3HSQA 1YP3A 4G3QA 4ISXA 2I5KA 2V0KA 2QIVX 1J2ZA 3FSBA 3BXYA 1QRFA 2OI5A 1QRMA 4N27A 1KK4A 3KWCA 5U2KA 5L6SA 1MRLA 2IUAA 4R7PA 1KGTA 4HCQA 4KPXA 3PMOA 3R2WA 3V4EA 1SSTA 1XHDA 2QIAA 3MQGA 4H7OA 1V3WA 3R5CA 4J09A 5E3PA 2GGOA 4MYOA 3TIOA 2ICXA 4R36A 1MR9A 1S80A 2V0LA 3IGJA 2V0IA 2TDTA 3OUPA 2RIJA 4MZUA 4N69A 3SPTA 2GGQA 1G97A 4E6UA 4KNXA 3OTZA 3Q1XA 1HV9A 4EGGA 1QRLA 1KK6A 4G3SA 1G95A 1T3DA 2QKXA 1LXAA 2W0VA 2WLEA 2Q4JA 3R1WA 4N6BA 4R37A 4M9CA 3SRTA 4AAWA 5AFUV 4EABA 3GUEA 3VBKA 3P47A 1V67A 3JQYA 3BSWA 3MQHA 2IC7A 2NPOA 1KGQA 3D98A 4G87A 4AC3A 3R8YA 4EA7A 4N6AA 5ADXV 3FS8A 3BRKX 3CJ8A 4G3PA 5E3RA 4EAAA 4KNRA 3R5AA 1HM8A 4EA8A 3IXCA 3OTMA 2OEFA 3VBIA 3GVDA 2OI6A 4HURA 3DJ4A 4KQLA 4M2AA 3EH0A 3FSXA 4M28A 1MR7A 4MFGA 4EA9A 1Z90A 3C8VA 1SSQA 4DCLA 3ECTA 1YP2A 3VNPA 4E79A 3OW5A 2WLGA 3T57A 2W0WA
chains in the Genus database with same CATH superfamily
5AFUU 1KRUA 2WLFA 2WLDA 4IHGA 3VBNA 4E6TA 3KWEA 4FCEA 1HM0A 5L6VA 5ADXU 3TWDA 1HM9A 1KK5A 5DEMA 1SSMA 3FSCA 1THJA 3GQ8A 3TV0A 1QRGA 3VBJA 2AQ9A 3OGZA 2IU9A 3I3AA 3R3RA 1YP4A 4HZDA 2JF3A 4M98A 3R5BA 4HZCA 3DHOA 2VHEA 5F42A 3BFPA 1TDTA 4IHHA 5DEPA 3F1XA 3FSYA 3FOQA 4KPZA 4E75A 1XATA 3FTTA 2OI7A 5DG3A 3R0SA 1QQ0A 1FWYA 1KHRA 4J18A 3DK5A 2FKOA 3TK8A 3KWDA 3BSYA 3ST8A 3I3XA 1KQAA 1EWWA 3MC4A 3OH2A 2WLCA 3OU9A 3R3IA 3VBPA 3HJJA 1M8NA 4E1KA 5E3QA 3FWWA 3D8VA 2XATA 3GQAA 4M99A 4AA7A 3VBLA 3R5DA 3GOSA 4K6RA 4M2BA 2OEGA 3NZ2A 3TISA 1FXJA 2P2OA 2V0JA 1KRVA 4IHFA 2IU8A 1OCXA 2V0HA 2VD4A 3BSSA 3EG4A 2JF2A 2ICYA 3OH3A 1KRRA 3EEVA 3P1BA 3VBMA 4EQYA 1Z2FA 3TDTA 1QREA 4HUSA 3HSQA 1YP3A 4G3QA 4ISXA 3OH4A 2I5KA 2V0KA 2QIVX 1J2ZA 3FSBA 3BXYA 1QRFA 2OI5A 3GQ9A 1QRMA 4N27A 1N4IA 1KK4A 3KWCA 5U2KA 5L6SA 1MRLA 2IUAA 3GQ7A 1KGTA 4R7PA 4HCQA 3OH1A 3PMOA 3R2WA 4KPXA 1SSTA 1XHDA 3V4EA 3OH0A 2QIAA 3MQGA 4H7OA 1V3WA 3R5CA 4J09A 5E3PA 2GGOA 4MYOA 3TIOA 2ICXA 4R36A 1MR9A 1S80A 2V0LA 3IGJA 2V0IA 2TDTA 3OUPA 1L0SA 2RIJA 4MZUA 4N69A 3SPTA 2GGQA 1G97A 4E6UA 4KNXA 3OTZA 3Q1XA 1HV9A 4EGGA 1QRLA 1KK6A 4G3SA 1LXAA 1T3DA 2QKXA 1G95A 2W0VA 2WLEA 2Q4JA 3R1WA 4N6BA 4R37A 4M9CA 3SRTA 4AAWA 5AFUV 4EABA 3GUEA 3VBKA 3P47A 1V67A 3JQYA 3BSWA 3MQHA 2IC7A 2NPOA 1KGQA 3D98A 4G87A 4AC3A 3SUCA 3R8YA 4EA7A 4N6AA 5ADXV 3FS8A 3BRKX 3CJ8A 4G3PA 5E3RA 4EAAA 4KNRA 3R5AA 1HM8A 4EA8A 3IXCA 3OTMA 2OEFA 3VBIA 3GVDA 2OI6A 4HURA 3DJ4A 4KQLA 4M2AA 3EH0A 3FSXA 4M28A 1MR7A 4MFGA 4EA9A 1Z90A 3C8VA 1SSQA 4DCLA 3ECTA 1YP2A 3VNPA 4E79A 3OW5A 2WLGA 3T57A 2W0WA
chains in the Genus database with same CATH topology
5AFUU 1KRUA 2WLFA 2WLDA 4IHGA 3VBNA 4E6TA 3KWEA 4FCEA 1HM0A 5L6VA 5ADXU 3TWDA 1HM9A 1KK5A 5DEMA 1SSMA 3FSCA 1THJA 3TV0A 1QRGA 3VBJA 2AQ9A 3R3RA 2IU9A 3I3AA 1YP4A 4HZDA 2JF3A 4M98A 3R5BA 4HZCA 3DHOA 2VHEA 5F42A 3BFPA 1TDTA 4IHHA 5DEPA 3F1XA 3FSYA 3FOQA 4KPZA 4E75A 1XATA 3FTTA 2OI7A 5DG3A 3R0SA 1QQ0A 1FWYA 1KHRA 4J18A 3DK5A 2FKOA 3TK8A 3KWDA 3BSYA 3ST8A 3I3XA 1KQAA 3MC4A 2WLCA 3OU9A 3R3IA 3VBPA 3HJJA 4E1KA 5E3QA 3FWWA 3D8VA 2XATA 4M99A 4AA7A 3VBLA 3R5DA 3GOSA 4K6RA 4M2BA 2OEGA 3NZ2A 3TISA 1FXJA 2P2OA 2V0JA 1KRVA 4IHFA 2IU8A 1OCXA 2V0HA 2VD4A 3BSSA 3EG4A 2JF2A 2ICYA 3P1BA 1KRRA 3EEVA 3VBMA 4EQYA 3TDTA 1QREA 4HUSA 3HSQA 1YP3A 4G3QA 4ISXA 2I5KA 2V0KA 2QIVX 1J2ZA 3FSBA 3BXYA 1QRFA 2OI5A 1QRMA 4N27A 1KK4A 3KWCA 5U2KA 5L6SA 1MRLA 2IUAA 4R7PA 1KGTA 4HCQA 4KPXA 3PMOA 3R2WA 3V4EA 1SSTA 1XHDA 2QIAA 3MQGA 4H7OA 1V3WA 3R5CA 4J09A 5E3PA 2GGOA 4MYOA 3TIOA 2ICXA 4R36A 1MR9A 1S80A 2V0LA 3IGJA 2V0IA 2TDTA 3OUPA 2RIJA 4MZUA 4N69A 3SPTA 2GGQA 1G97A 4E6UA 4KNXA 3OTZA 3Q1XA 1HV9A 4EGGA 1QRLA 1KK6A 4G3SA 1G95A 1T3DA 2QKXA 1LXAA 2W0VA 2WLEA 2Q4JA 3R1WA 4N6BA 4R37A 4M9CA 3SRTA 4AAWA 5AFUV 4EABA 3GUEA 3VBKA 3P47A 1V67A 3JQYA 3BSWA 3MQHA 2IC7A 2NPOA 1KGQA 3D98A 4G87A 4AC3A 3R8YA 4EA7A 4N6AA 5ADXV 3FS8A 3BRKX 3CJ8A 4G3PA 5E3RA 4EAAA 4KNRA 3R5AA 1HM8A 4EA8A 3IXCA 3OTMA 2OEFA 3VBIA 3GVDA 2OI6A 4HURA 3DJ4A 4KQLA 4M2AA 3EH0A 3FSXA 4M28A 1MR7A 4MFGA 4EA9A 1Z90A 3C8VA 1SSQA 4DCLA 3ECTA 1YP2A 3VNPA 4E79A 3OW5A 2WLGA 3T57A 2W0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFU U;  1KRU A;  2WLF A;  2WLD A;  4IHG A;  3VBN A;  4E6T A;  3KWE A;  4FCE A;  1HM0 A;  5L6V A;  5ADX U;  3TWD A;  1HM9 A;  1KK5 A;  5DEM A;  1SSM A;  3FSC A;  1THJ A;  3TV0 A;  1QRG A;  3VBJ A;  2AQ9 A;  3R3R A;  2IU9 A;  3I3A A;  1YP4 A;  4HZD A;  2JF3 A;  4M98 A;  3R5B A;  4HZC A;  3DHO A;  2VHE A;  5F42 A;  3BFP A;  1TDT A;  4IHH A;  5DEP A;  3F1X A;  3FSY A;  3FOQ A;  4KPZ A;  4E75 A;  1XAT A;  3FTT A;  2OI7 A;  5DG3 A;  3R0S A;  1QQ0 A;  1FWY A;  1KHR A;  4J18 A;  3DK5 A;  2FKO A;  3TK8 A;  3KWD A;  3BSY A;  3ST8 A;  3I3X A;  1KQA A;  3MC4 A;  2WLC A;  3OU9 A;  3R3I A;  3VBP A;  3HJJ A;  4E1K A;  5E3Q A;  3FWW A;  3D8V A;  2XAT A;  4M99 A;  4AA7 A;  3VBL A;  3R5D A;  3GOS A;  4K6R A;  4M2B A;  2OEG A;  3NZ2 A;  3TIS A;  1FXJ A;  2P2O A;  2V0J A;  1KRV A;  4IHF A;  2IU8 A;  1OCX A;  2V0H A;  2VD4 A;  3BSS A;  3EG4 A;  2JF2 A;  2ICY A;  3P1B A;  1KRR A;  3EEV A;  3VBM A;  4EQY A;  3TDT A;  1QRE A;  4HUS A;  3HSQ A;  1YP3 A;  4G3Q A;  4ISX A;  2I5K A;  2V0K A;  2QIV X;  1J2Z A;  3FSB A;  3BXY A;  1QRF A;  2OI5 A;  1QRM A;  4N27 A;  1KK4 A;  3KWC A;  5U2K A;  5L6S A;  1MRL A;  2IUA A;  4R7P A;  1KGT A;  4HCQ A;  4KPX A;  3PMO A;  3R2W A;  3V4E A;  1SST A;  1XHD A;  2QIA A;  3MQG A;  4H7O A;  1V3W A;  3R5C A;  4J09 A;  5E3P A;  2GGO A;  4MYO A;  3TIO A;  2ICX A;  4R36 A;  1MR9 A;  1S80 A;  2V0L A;  3IGJ A;  2V0I A;  2TDT A;  3OUP A;  2RIJ A;  4MZU A;  4N69 A;  3SPT A;  2GGQ A;  1G97 A;  4E6U A;  4KNX A;  3OTZ A;  3Q1X A;  1HV9 A;  4EGG A;  1QRL A;  1KK6 A;  4G3S A;  1G95 A;  1T3D A;  2QKX A;  1LXA A;  2W0V A;  2WLE A;  2Q4J A;  3R1W A;  4N6B A;  4R37 A;  4M9C A;  3SRT A;  4AAW A;  5AFU V;  4EAB A;  3GUE A;  3VBK A;  3P47 A;  1V67 A;  3JQY A;  3BSW A;  3MQH A;  2IC7 A;  2NPO A;  1KGQ A;  3D98 A;  4G87 A;  4AC3 A;  3R8Y A;  4EA7 A;  4N6A A;  5ADX V;  3FS8 A;  3BRK X;  3CJ8 A;  4G3P A;  5E3R A;  4EAA A;  4KNR A;  3R5A A;  1HM8 A;  4EA8 A;  3IXC A;  3OTM A;  2OEF A;  3VBI A;  3GVD A;  2OI6 A;  4HUR A;  3DJ4 A;  4KQL A;  4M2A A;  3EH0 A;  3FSX A;  4M28 A;  1MR7 A;  4MFG A;  4EA9 A;  1Z90 A;  3C8V A;  1SSQ A;  4DCL A;  3ECT A;  1YP2 A;  3VNP A;  4E79 A;  3OW5 A;  2WLG A;  3T57 A;  2W0W A; 
#chains in the Genus database with same CATH topology
 5AFU U;  1KRU A;  2WLF A;  2WLD A;  4IHG A;  3VBN A;  4E6T A;  3KWE A;  4FCE A;  1HM0 A;  5L6V A;  5ADX U;  3TWD A;  1HM9 A;  1KK5 A;  5DEM A;  1SSM A;  3FSC A;  1THJ A;  3GQ8 A;  3TV0 A;  1QRG A;  3VBJ A;  2AQ9 A;  3OGZ A;  2IU9 A;  3I3A A;  3R3R A;  1YP4 A;  4HZD A;  2JF3 A;  4M98 A;  3R5B A;  4HZC A;  3DHO A;  2VHE A;  5F42 A;  3BFP A;  1TDT A;  4IHH A;  5DEP A;  3F1X A;  3FSY A;  3FOQ A;  4KPZ A;  4E75 A;  1XAT A;  3FTT A;  2OI7 A;  5DG3 A;  3R0S A;  1QQ0 A;  1FWY A;  1KHR A;  4J18 A;  3DK5 A;  2FKO A;  3TK8 A;  3KWD A;  3BSY A;  3ST8 A;  3I3X A;  1KQA A;  1EWW A;  3MC4 A;  3OH2 A;  2WLC A;  3OU9 A;  3R3I A;  3VBP A;  3HJJ A;  1M8N A;  4E1K A;  5E3Q A;  3FWW A;  3D8V A;  2XAT A;  3GQA A;  4M99 A;  4AA7 A;  3VBL A;  3R5D A;  3GOS A;  4K6R A;  4M2B A;  2OEG A;  3NZ2 A;  3TIS A;  1FXJ A;  2P2O A;  2V0J A;  1KRV A;  4IHF A;  2IU8 A;  1OCX A;  2V0H A;  2VD4 A;  3BSS A;  3EG4 A;  2JF2 A;  2ICY A;  3OH3 A;  1KRR A;  3EEV A;  3P1B A;  3VBM A;  4EQY A;  1Z2F A;  3TDT A;  1QRE A;  4HUS A;  3HSQ A;  1YP3 A;  4G3Q A;  4ISX A;  3OH4 A;  2I5K A;  2V0K A;  2QIV X;  1J2Z A;  3FSB A;  3BXY A;  1QRF A;  2OI5 A;  3GQ9 A;  1QRM A;  4N27 A;  1N4I A;  1KK4 A;  3KWC A;  5U2K A;  5L6S A;  1MRL A;  2IUA A;  3GQ7 A;  1KGT A;  4R7P A;  4HCQ A;  3OH1 A;  3PMO A;  3R2W A;  4KPX A;  1SST A;  1XHD A;  3V4E A;  3OH0 A;  2QIA A;  3MQG A;  4H7O A;  1V3W A;  3R5C A;  4J09 A;  5E3P A;  2GGO A;  4MYO A;  3TIO A;  2ICX A;  4R36 A;  1MR9 A;  1S80 A;  2V0L A;  3IGJ A;  2V0I A;  2TDT A;  3OUP A;  1L0S A;  2RIJ A;  4MZU A;  4N69 A;  3SPT A;  2GGQ A;  1G97 A;  4E6U A;  4KNX A;  3OTZ A;  3Q1X A;  1HV9 A;  4EGG A;  1QRL A;  1KK6 A;  4G3S A;  1LXA A;  1T3D A;  2QKX A;  1G95 A;  2W0V A;  2WLE A;  2Q4J A;  3R1W A;  4N6B A;  4R37 A;  4M9C A;  3SRT A;  4AAW A;  5AFU V;  4EAB A;  3GUE A;  3VBK A;  3P47 A;  1V67 A;  3JQY A;  3BSW A;  3MQH A;  2IC7 A;  2NPO A;  1KGQ A;  3D98 A;  4G87 A;  4AC3 A;  3SUC A;  3R8Y A;  4EA7 A;  4N6A A;  5ADX V;  3FS8 A;  3BRK X;  3CJ8 A;  4G3P A;  5E3R A;  4EAA A;  4KNR A;  3R5A A;  1HM8 A;  4EA8 A;  3IXC A;  3OTM A;  2OEF A;  3VBI A;  3GVD A;  2OI6 A;  4HUR A;  3DJ4 A;  4KQL A;  4M2A A;  3EH0 A;  3FSX A;  4M28 A;  1MR7 A;  4MFG A;  4EA9 A;  1Z90 A;  3C8V A;  1SSQ A;  4DCL A;  3ECT A;  1YP2 A;  3VNP A;  4E79 A;  3OW5 A;  2WLG A;  3T57 A;  2W0W A; 
#chains in the Genus database with same CATH homology
 5AFU U;  1KRU A;  2WLF A;  2WLD A;  4IHG A;  3VBN A;  4E6T A;  3KWE A;  4FCE A;  1HM0 A;  5L6V A;  5ADX U;  3TWD A;  1HM9 A;  1KK5 A;  5DEM A;  1SSM A;  3FSC A;  1THJ A;  3TV0 A;  1QRG A;  3VBJ A;  2AQ9 A;  3R3R A;  2IU9 A;  3I3A A;  1YP4 A;  4HZD A;  2JF3 A;  4M98 A;  3R5B A;  4HZC A;  3DHO A;  2VHE A;  5F42 A;  3BFP A;  1TDT A;  4IHH A;  5DEP A;  3F1X A;  3FSY A;  3FOQ A;  4KPZ A;  4E75 A;  1XAT A;  3FTT A;  2OI7 A;  5DG3 A;  3R0S A;  1QQ0 A;  1FWY A;  1KHR A;  4J18 A;  3DK5 A;  2FKO A;  3TK8 A;  3KWD A;  3BSY A;  3ST8 A;  3I3X A;  1KQA A;  3MC4 A;  2WLC A;  3OU9 A;  3R3I A;  3VBP A;  3HJJ A;  4E1K A;  5E3Q A;  3FWW A;  3D8V A;  2XAT A;  4M99 A;  4AA7 A;  3VBL A;  3R5D A;  3GOS A;  4K6R A;  4M2B A;  2OEG A;  3NZ2 A;  3TIS A;  1FXJ A;  2P2O A;  2V0J A;  1KRV A;  4IHF A;  2IU8 A;  1OCX A;  2V0H A;  2VD4 A;  3BSS A;  3EG4 A;  2JF2 A;  2ICY A;  3P1B A;  1KRR A;  3EEV A;  3VBM A;  4EQY A;  3TDT A;  1QRE A;  4HUS A;  3HSQ A;  1YP3 A;  4G3Q A;  4ISX A;  2I5K A;  2V0K A;  2QIV X;  1J2Z A;  3FSB A;  3BXY A;  1QRF A;  2OI5 A;  1QRM A;  4N27 A;  1KK4 A;  3KWC A;  5U2K A;  5L6S A;  1MRL A;  2IUA A;  4R7P A;  1KGT A;  4HCQ A;  4KPX A;  3PMO A;  3R2W A;  3V4E A;  1SST A;  1XHD A;  2QIA A;  3MQG A;  4H7O A;  1V3W A;  3R5C A;  4J09 A;  5E3P A;  2GGO A;  4MYO A;  3TIO A;  2ICX A;  4R36 A;  1MR9 A;  1S80 A;  2V0L A;  3IGJ A;  2V0I A;  2TDT A;  3OUP A;  2RIJ A;  4MZU A;  4N69 A;  3SPT A;  2GGQ A;  1G97 A;  4E6U A;  4KNX A;  3OTZ A;  3Q1X A;  1HV9 A;  4EGG A;  1QRL A;  1KK6 A;  4G3S A;  1G95 A;  1T3D A;  2QKX A;  1LXA A;  2W0V A;  2WLE A;  2Q4J A;  3R1W A;  4N6B A;  4R37 A;  4M9C A;  3SRT A;  4AAW A;  5AFU V;  4EAB A;  3GUE A;  3VBK A;  3P47 A;  1V67 A;  3JQY A;  3BSW A;  3MQH A;  2IC7 A;  2NPO A;  1KGQ A;  3D98 A;  4G87 A;  4AC3 A;  3R8Y A;  4EA7 A;  4N6A A;  5ADX V;  3FS8 A;  3BRK X;  3CJ8 A;  4G3P A;  5E3R A;  4EAA A;  4KNR A;  3R5A A;  1HM8 A;  4EA8 A;  3IXC A;  3OTM A;  2OEF A;  3VBI A;  3GVD A;  2OI6 A;  4HUR A;  3DJ4 A;  4KQL A;  4M2A A;  3EH0 A;  3FSX A;  4M28 A;  1MR7 A;  4MFG A;  4EA9 A;  1Z90 A;  3C8V A;  1SSQ A;  4DCL A;  3ECT A;  1YP2 A;  3VNP A;  4E79 A;  3OW5 A;  2WLG A;  3T57 A;  2W0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...