5ADXV

Cryoem structure of dynactin complex at 4.0 angstrom resolution
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
165
structure length
165
Chain Sequence
SGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule keywords ACTIN RELATED PROTEIN 1
molecule tags Structural protein
total genus 28
structure length 165
sequence length 165
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
V PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5adxV00
2RIJA 3BSWA 3FSBA 5DG3A 1MRLA 4AC3A 2XATA 4EA8A 3Q1XA 4AA7A 4M28A 1Z90A 3R8YA 3KWCA 4HZDA 3BXYA 1HM8A 1QRFA 4HUSA 4M2BA 5AFUU 1THJA 1HM9A 1TDTA 3FSXA 3TIOA 1QRGA 4HZCA 3IGJA 3ST8A 5L6VA 3DK5A 2OEFA 3SRTA 4M2AA 5DEPA 3R0SA 2V0KA 1FWYA 3TWDA 4M99A 2JF3A 3OUPA 4G3PA 3FS8A 3I3AA 2NPOA 2WLCA 2WLEA 4IHHA 1MR7A 3IXCA 4KQLA 3OW5A 3R2WA 1G95A 2IU8A 3OTZA 2IUAA 3VBIA 1KRRA 3FOQA 2JF2A 1HM0A 2AQ9A 2WLGA 1XHDA 2I5KA 2IU9A 3MQGA 3KWDA 2GGQA 2V0HA 4J18A 3VBMA 3TV0A 1KQAA 3DHOA 2VHEA 3JQYA 4E75A 3BSYA 2QIVX 4MFGA 3R5AA 3FWWA 2V0JA 4KNXA 2ICXA 4EA7A 3P47A 3GOSA 1KRVA 3GUEA 4R36A 1XATA 3EG4A 3TISA 2IC7A 2VD4A 3GVDA 5AFUV 3VBNA 4EAAA 3NZ2A 3VBPA 5E3RA 5ADXU 1QQ0A 1QRMA 1SSTA 4R7PA 4E6UA 4G87A 1FXJA 2TDTA 4IHGA 4EABA 3F1XA 1YP4A 3HJJA 4AAWA 1MR9A 1S80A 5E3QA 2WLDA 3ECTA 2OI6A 4N6AA 2OI7A 3OU9A 4E1KA 1KK6A 2ICYA 1SSMA 3P1BA 3FSYA 1J2ZA 3I3XA 1KK5A 4FCEA 2P2OA 4ISXA 1QREA 3T57A 4MYOA 3R5BA 4KPZA 2W0WA 4G3QA 1KGQA 4E79A 2QKXA 4R37A 1OCXA 3FTTA 3DJ4A 3HSQA 4M98A 3EEVA 2V0IA 3BFPA 3TDTA 4EQYA 2GGOA 5E3PA 1LXAA 3R3RA 4HURA 4J09A 4DCLA 5U2KA 3R5CA 2Q4JA 1QRLA 3PMOA 3R3IA 1T3DA 3MC4A 5L6SA 1G97A 5DEMA 3MQHA 4K6RA 3D8VA 1HV9A 2W0VA 4IHFA 2WLFA 3OTMA 3R5DA 4KPXA 1V3WA 2QIAA 3FSCA 4EA9A 4G3SA 4N69A 3SPTA 4E6TA 1KHRA 3VBLA 3VBJA 2OEGA 4H7OA 4EGGA 3V4EA 3CJ8A 1V67A 1KGTA 3KWEA 3R1WA 5ADXV 2FKOA 3BRKX 3EH0A 1SSQA 3C8VA 4N6BA 4MZUA 1YP2A 4HCQA 3VNPA 1KK4A 4KNRA 3VBKA 2OI5A 3BSSA 1KRUA 4M9CA 4N27A 2V0LA 1YP3A 5F42A 3D98A 3TK8A
chains in the Genus database with same CATH superfamily
2RIJA 3BSWA 3FSBA 5DG3A 1MRLA 4AC3A 2XATA 1Z2FA 4EA8A 3Q1XA 1EWWA 4AA7A 3OGZA 4M28A 1Z90A 3R8YA 3KWCA 4HZDA 3BXYA 1HM8A 1QRFA 4HUSA 4M2BA 5AFUU 1THJA 1HM9A 1TDTA 3FSXA 3TIOA 1QRGA 4HZCA 3IGJA 3ST8A 5L6VA 3OH4A 3DK5A 2OEFA 3SRTA 4M2AA 3OH0A 1L0SA 5DEPA 3R0SA 2V0KA 1FWYA 3TWDA 3OH1A 2JF3A 3OUPA 4G3PA 4M99A 3FS8A 3I3AA 2NPOA 2WLCA 2WLEA 4IHHA 1MR7A 3IXCA 4KQLA 3OW5A 3R2WA 1G95A 2IU8A 3OTZA 2IUAA 3VBIA 1KRRA 3FOQA 2JF2A 1HM0A 2AQ9A 2WLGA 1XHDA 2I5KA 2IU9A 3MQGA 3KWDA 2GGQA 2V0HA 4J18A 3VBMA 3TV0A 1KQAA 3DHOA 2VHEA 3JQYA 4E75A 3BSYA 2QIVX 4MFGA 3R5AA 3FWWA 2V0JA 4KNXA 2ICXA 4EA7A 3OH3A 3GOSA 3P47A 1KRVA 3GUEA 4R36A 1XATA 3EG4A 3TISA 2IC7A 2VD4A 3GVDA 5AFUV 3VBNA 4EAAA 3NZ2A 3VBPA 5E3RA 1N4IA 5ADXU 1QQ0A 1QRMA 1SSTA 4R7PA 4E6UA 4G87A 1FXJA 2TDTA 4IHGA 4EABA 3F1XA 1YP4A 3HJJA 4AAWA 1MR9A 1S80A 5E3QA 2WLDA 3ECTA 2OI6A 4N6AA 2OI7A 3GQ7A 3OU9A 4E1KA 1KK6A 2ICYA 1SSMA 3P1BA 3FSYA 1J2ZA 3I3XA 1KK5A 4FCEA 2P2OA 4ISXA 1QREA 3T57A 4MYOA 3GQAA 3R5BA 4KPZA 2W0WA 4G3QA 1KGQA 4E79A 2QKXA 4R37A 1OCXA 3FTTA 3DJ4A 3HSQA 4M98A 3EEVA 2V0IA 3BFPA 3TDTA 4EQYA 3GQ9A 2GGOA 5E3PA 1LXAA 3R3RA 4HURA 4J09A 4DCLA 5U2KA 3R5CA 2Q4JA 1QRLA 3PMOA 3R3IA 1T3DA 3MC4A 5L6SA 1G97A 5DEMA 3MQHA 4K6RA 3D8VA 1HV9A 3OH2A 2W0VA 4IHFA 2WLFA 3OTMA 3R5DA 4KPXA 1V3WA 2QIAA 3FSCA 4EA9A 4G3SA 4N69A 3SPTA 4E6TA 1KHRA 3VBLA 3VBJA 2OEGA 4H7OA 3SUCA 4EGGA 3V4EA 3CJ8A 1V67A 1KGTA 3KWEA 3R1WA 5ADXV 2FKOA 1M8NA 3BRKX 3EH0A 1SSQA 3C8VA 4N6BA 4MZUA 1YP2A 4HCQA 3VNPA 1KK4A 4KNRA 3VBKA 2OI5A 3BSSA 3GQ8A 1KRUA 4M9CA 4N27A 2V0LA 1YP3A 5F42A 3D98A 3TK8A
chains in the Genus database with same CATH topology
2RIJA 3BSWA 3FSBA 5DG3A 1MRLA 4AC3A 2XATA 4EA8A 3Q1XA 4AA7A 4M28A 1Z90A 3R8YA 3KWCA 4HZDA 3BXYA 1HM8A 1QRFA 4HUSA 4M2BA 5AFUU 1THJA 1HM9A 1TDTA 3FSXA 3TIOA 1QRGA 4HZCA 3IGJA 3ST8A 5L6VA 3DK5A 2OEFA 3SRTA 4M2AA 5DEPA 3R0SA 2V0KA 1FWYA 3TWDA 4M99A 2JF3A 3OUPA 4G3PA 3FS8A 3I3AA 2NPOA 2WLCA 2WLEA 4IHHA 1MR7A 3IXCA 4KQLA 3OW5A 3R2WA 1G95A 2IU8A 3OTZA 2IUAA 3VBIA 1KRRA 3FOQA 2JF2A 1HM0A 2AQ9A 2WLGA 1XHDA 2I5KA 2IU9A 3MQGA 3KWDA 2GGQA 2V0HA 4J18A 3VBMA 3TV0A 1KQAA 3DHOA 2VHEA 3JQYA 4E75A 3BSYA 2QIVX 4MFGA 3R5AA 3FWWA 2V0JA 4KNXA 2ICXA 4EA7A 3P47A 3GOSA 1KRVA 3GUEA 4R36A 1XATA 3EG4A 3TISA 2IC7A 2VD4A 3GVDA 5AFUV 3VBNA 4EAAA 3NZ2A 3VBPA 5E3RA 5ADXU 1QQ0A 1QRMA 1SSTA 4R7PA 4E6UA 4G87A 1FXJA 2TDTA 4IHGA 4EABA 3F1XA 1YP4A 3HJJA 4AAWA 1MR9A 1S80A 5E3QA 2WLDA 3ECTA 2OI6A 4N6AA 2OI7A 3OU9A 4E1KA 1KK6A 2ICYA 1SSMA 3P1BA 3FSYA 1J2ZA 3I3XA 1KK5A 4FCEA 2P2OA 4ISXA 1QREA 3T57A 4MYOA 3R5BA 4KPZA 2W0WA 4G3QA 1KGQA 4E79A 2QKXA 4R37A 1OCXA 3FTTA 3DJ4A 3HSQA 4M98A 3EEVA 2V0IA 3BFPA 3TDTA 4EQYA 2GGOA 5E3PA 1LXAA 3R3RA 4HURA 4J09A 4DCLA 5U2KA 3R5CA 2Q4JA 1QRLA 3PMOA 3R3IA 1T3DA 3MC4A 5L6SA 1G97A 5DEMA 3MQHA 4K6RA 3D8VA 1HV9A 2W0VA 4IHFA 2WLFA 3OTMA 3R5DA 4KPXA 1V3WA 2QIAA 3FSCA 4EA9A 4G3SA 4N69A 3SPTA 4E6TA 1KHRA 3VBLA 3VBJA 2OEGA 4H7OA 4EGGA 3V4EA 3CJ8A 1V67A 1KGTA 3KWEA 3R1WA 5ADXV 2FKOA 3BRKX 3EH0A 1SSQA 3C8VA 4N6BA 4MZUA 1YP2A 4HCQA 3VNPA 1KK4A 4KNRA 3VBKA 2OI5A 3BSSA 1KRUA 4M9CA 4N27A 2V0LA 1YP3A 5F42A 3D98A 3TK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RIJ A;  3BSW A;  3FSB A;  5DG3 A;  1MRL A;  4AC3 A;  2XAT A;  4EA8 A;  3Q1X A;  4AA7 A;  4M28 A;  1Z90 A;  3R8Y A;  3KWC A;  4HZD A;  3BXY A;  1HM8 A;  1QRF A;  4HUS A;  4M2B A;  5AFU U;  1THJ A;  1HM9 A;  1TDT A;  3FSX A;  3TIO A;  1QRG A;  4HZC A;  3IGJ A;  3ST8 A;  5L6V A;  3DK5 A;  2OEF A;  3SRT A;  4M2A A;  5DEP A;  3R0S A;  2V0K A;  1FWY A;  3TWD A;  4M99 A;  2JF3 A;  3OUP A;  4G3P A;  3FS8 A;  3I3A A;  2NPO A;  2WLC A;  2WLE A;  4IHH A;  1MR7 A;  3IXC A;  4KQL A;  3OW5 A;  3R2W A;  1G95 A;  2IU8 A;  3OTZ A;  2IUA A;  3VBI A;  1KRR A;  3FOQ A;  2JF2 A;  1HM0 A;  2AQ9 A;  2WLG A;  1XHD A;  2I5K A;  2IU9 A;  3MQG A;  3KWD A;  2GGQ A;  2V0H A;  4J18 A;  3VBM A;  3TV0 A;  1KQA A;  3DHO A;  2VHE A;  3JQY A;  4E75 A;  3BSY A;  2QIV X;  4MFG A;  3R5A A;  3FWW A;  2V0J A;  4KNX A;  2ICX A;  4EA7 A;  3P47 A;  3GOS A;  1KRV A;  3GUE A;  4R36 A;  1XAT A;  3EG4 A;  3TIS A;  2IC7 A;  2VD4 A;  3GVD A;  5AFU V;  3VBN A;  4EAA A;  3NZ2 A;  3VBP A;  5E3R A;  5ADX U;  1QQ0 A;  1QRM A;  1SST A;  4R7P A;  4E6U A;  4G87 A;  1FXJ A;  2TDT A;  4IHG A;  4EAB A;  3F1X A;  1YP4 A;  3HJJ A;  4AAW A;  1MR9 A;  1S80 A;  5E3Q A;  2WLD A;  3ECT A;  2OI6 A;  4N6A A;  2OI7 A;  3OU9 A;  4E1K A;  1KK6 A;  2ICY A;  1SSM A;  3P1B A;  3FSY A;  1J2Z A;  3I3X A;  1KK5 A;  4FCE A;  2P2O A;  4ISX A;  1QRE A;  3T57 A;  4MYO A;  3R5B A;  4KPZ A;  2W0W A;  4G3Q A;  1KGQ A;  4E79 A;  2QKX A;  4R37 A;  1OCX A;  3FTT A;  3DJ4 A;  3HSQ A;  4M98 A;  3EEV A;  2V0I A;  3BFP A;  3TDT A;  4EQY A;  2GGO A;  5E3P A;  1LXA A;  3R3R A;  4HUR A;  4J09 A;  4DCL A;  5U2K A;  3R5C A;  2Q4J A;  1QRL A;  3PMO A;  3R3I A;  1T3D A;  3MC4 A;  5L6S A;  1G97 A;  5DEM A;  3MQH A;  4K6R A;  3D8V A;  1HV9 A;  2W0V A;  4IHF A;  2WLF A;  3OTM A;  3R5D A;  4KPX A;  1V3W A;  2QIA A;  3FSC A;  4EA9 A;  4G3S A;  4N69 A;  3SPT A;  4E6T A;  1KHR A;  3VBL A;  3VBJ A;  2OEG A;  4H7O A;  4EGG A;  3V4E A;  3CJ8 A;  1V67 A;  1KGT A;  3KWE A;  3R1W A;  5ADX V;  2FKO A;  3BRK X;  3EH0 A;  1SSQ A;  3C8V A;  4N6B A;  4MZU A;  1YP2 A;  4HCQ A;  3VNP A;  1KK4 A;  4KNR A;  3VBK A;  2OI5 A;  3BSS A;  1KRU A;  4M9C A;  4N27 A;  2V0L A;  1YP3 A;  5F42 A;  3D98 A;  3TK8 A; 
#chains in the Genus database with same CATH topology
 2RIJ A;  3BSW A;  3FSB A;  5DG3 A;  1MRL A;  4AC3 A;  2XAT A;  1Z2F A;  4EA8 A;  3Q1X A;  1EWW A;  4AA7 A;  3OGZ A;  4M28 A;  1Z90 A;  3R8Y A;  3KWC A;  4HZD A;  3BXY A;  1HM8 A;  1QRF A;  4HUS A;  4M2B A;  5AFU U;  1THJ A;  1HM9 A;  1TDT A;  3FSX A;  3TIO A;  1QRG A;  4HZC A;  3IGJ A;  3ST8 A;  5L6V A;  3OH4 A;  3DK5 A;  2OEF A;  3SRT A;  4M2A A;  3OH0 A;  1L0S A;  5DEP A;  3R0S A;  2V0K A;  1FWY A;  3TWD A;  3OH1 A;  2JF3 A;  3OUP A;  4G3P A;  4M99 A;  3FS8 A;  3I3A A;  2NPO A;  2WLC A;  2WLE A;  4IHH A;  1MR7 A;  3IXC A;  4KQL A;  3OW5 A;  3R2W A;  1G95 A;  2IU8 A;  3OTZ A;  2IUA A;  3VBI A;  1KRR A;  3FOQ A;  2JF2 A;  1HM0 A;  2AQ9 A;  2WLG A;  1XHD A;  2I5K A;  2IU9 A;  3MQG A;  3KWD A;  2GGQ A;  2V0H A;  4J18 A;  3VBM A;  3TV0 A;  1KQA A;  3DHO A;  2VHE A;  3JQY A;  4E75 A;  3BSY A;  2QIV X;  4MFG A;  3R5A A;  3FWW A;  2V0J A;  4KNX A;  2ICX A;  4EA7 A;  3OH3 A;  3GOS A;  3P47 A;  1KRV A;  3GUE A;  4R36 A;  1XAT A;  3EG4 A;  3TIS A;  2IC7 A;  2VD4 A;  3GVD A;  5AFU V;  3VBN A;  4EAA A;  3NZ2 A;  3VBP A;  5E3R A;  1N4I A;  5ADX U;  1QQ0 A;  1QRM A;  1SST A;  4R7P A;  4E6U A;  4G87 A;  1FXJ A;  2TDT A;  4IHG A;  4EAB A;  3F1X A;  1YP4 A;  3HJJ A;  4AAW A;  1MR9 A;  1S80 A;  5E3Q A;  2WLD A;  3ECT A;  2OI6 A;  4N6A A;  2OI7 A;  3GQ7 A;  3OU9 A;  4E1K A;  1KK6 A;  2ICY A;  1SSM A;  3P1B A;  3FSY A;  1J2Z A;  3I3X A;  1KK5 A;  4FCE A;  2P2O A;  4ISX A;  1QRE A;  3T57 A;  4MYO A;  3GQA A;  3R5B A;  4KPZ A;  2W0W A;  4G3Q A;  1KGQ A;  4E79 A;  2QKX A;  4R37 A;  1OCX A;  3FTT A;  3DJ4 A;  3HSQ A;  4M98 A;  3EEV A;  2V0I A;  3BFP A;  3TDT A;  4EQY A;  3GQ9 A;  2GGO A;  5E3P A;  1LXA A;  3R3R A;  4HUR A;  4J09 A;  4DCL A;  5U2K A;  3R5C A;  2Q4J A;  1QRL A;  3PMO A;  3R3I A;  1T3D A;  3MC4 A;  5L6S A;  1G97 A;  5DEM A;  3MQH A;  4K6R A;  3D8V A;  1HV9 A;  3OH2 A;  2W0V A;  4IHF A;  2WLF A;  3OTM A;  3R5D A;  4KPX A;  1V3W A;  2QIA A;  3FSC A;  4EA9 A;  4G3S A;  4N69 A;  3SPT A;  4E6T A;  1KHR A;  3VBL A;  3VBJ A;  2OEG A;  4H7O A;  3SUC A;  4EGG A;  3V4E A;  3CJ8 A;  1V67 A;  1KGT A;  3KWE A;  3R1W A;  5ADX V;  2FKO A;  1M8N A;  3BRK X;  3EH0 A;  1SSQ A;  3C8V A;  4N6B A;  4MZU A;  1YP2 A;  4HCQ A;  3VNP A;  1KK4 A;  4KNR A;  3VBK A;  2OI5 A;  3BSS A;  3GQ8 A;  1KRU A;  4M9C A;  4N27 A;  2V0L A;  1YP3 A;  5F42 A;  3D98 A;  3TK8 A; 
#chains in the Genus database with same CATH homology
 2RIJ A;  3BSW A;  3FSB A;  5DG3 A;  1MRL A;  4AC3 A;  2XAT A;  4EA8 A;  3Q1X A;  4AA7 A;  4M28 A;  1Z90 A;  3R8Y A;  3KWC A;  4HZD A;  3BXY A;  1HM8 A;  1QRF A;  4HUS A;  4M2B A;  5AFU U;  1THJ A;  1HM9 A;  1TDT A;  3FSX A;  3TIO A;  1QRG A;  4HZC A;  3IGJ A;  3ST8 A;  5L6V A;  3DK5 A;  2OEF A;  3SRT A;  4M2A A;  5DEP A;  3R0S A;  2V0K A;  1FWY A;  3TWD A;  4M99 A;  2JF3 A;  3OUP A;  4G3P A;  3FS8 A;  3I3A A;  2NPO A;  2WLC A;  2WLE A;  4IHH A;  1MR7 A;  3IXC A;  4KQL A;  3OW5 A;  3R2W A;  1G95 A;  2IU8 A;  3OTZ A;  2IUA A;  3VBI A;  1KRR A;  3FOQ A;  2JF2 A;  1HM0 A;  2AQ9 A;  2WLG A;  1XHD A;  2I5K A;  2IU9 A;  3MQG A;  3KWD A;  2GGQ A;  2V0H A;  4J18 A;  3VBM A;  3TV0 A;  1KQA A;  3DHO A;  2VHE A;  3JQY A;  4E75 A;  3BSY A;  2QIV X;  4MFG A;  3R5A A;  3FWW A;  2V0J A;  4KNX A;  2ICX A;  4EA7 A;  3P47 A;  3GOS A;  1KRV A;  3GUE A;  4R36 A;  1XAT A;  3EG4 A;  3TIS A;  2IC7 A;  2VD4 A;  3GVD A;  5AFU V;  3VBN A;  4EAA A;  3NZ2 A;  3VBP A;  5E3R A;  5ADX U;  1QQ0 A;  1QRM A;  1SST A;  4R7P A;  4E6U A;  4G87 A;  1FXJ A;  2TDT A;  4IHG A;  4EAB A;  3F1X A;  1YP4 A;  3HJJ A;  4AAW A;  1MR9 A;  1S80 A;  5E3Q A;  2WLD A;  3ECT A;  2OI6 A;  4N6A A;  2OI7 A;  3OU9 A;  4E1K A;  1KK6 A;  2ICY A;  1SSM A;  3P1B A;  3FSY A;  1J2Z A;  3I3X A;  1KK5 A;  4FCE A;  2P2O A;  4ISX A;  1QRE A;  3T57 A;  4MYO A;  3R5B A;  4KPZ A;  2W0W A;  4G3Q A;  1KGQ A;  4E79 A;  2QKX A;  4R37 A;  1OCX A;  3FTT A;  3DJ4 A;  3HSQ A;  4M98 A;  3EEV A;  2V0I A;  3BFP A;  3TDT A;  4EQY A;  2GGO A;  5E3P A;  1LXA A;  3R3R A;  4HUR A;  4J09 A;  4DCL A;  5U2K A;  3R5C A;  2Q4J A;  1QRL A;  3PMO A;  3R3I A;  1T3D A;  3MC4 A;  5L6S A;  1G97 A;  5DEM A;  3MQH A;  4K6R A;  3D8V A;  1HV9 A;  2W0V A;  4IHF A;  2WLF A;  3OTM A;  3R5D A;  4KPX A;  1V3W A;  2QIA A;  3FSC A;  4EA9 A;  4G3S A;  4N69 A;  3SPT A;  4E6T A;  1KHR A;  3VBL A;  3VBJ A;  2OEG A;  4H7O A;  4EGG A;  3V4E A;  3CJ8 A;  1V67 A;  1KGT A;  3KWE A;  3R1W A;  5ADX V;  2FKO A;  3BRK X;  3EH0 A;  1SSQ A;  3C8V A;  4N6B A;  4MZU A;  1YP2 A;  4HCQ A;  3VNP A;  1KK4 A;  4KNR A;  3VBK A;  2OI5 A;  3BSS A;  1KRU A;  4M9C A;  4N27 A;  2V0L A;  1YP3 A;  5F42 A;  3D98 A;  3TK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...