5AFLA

Alpha7-achbp in complex with lobeline and fragment 3
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
205
Chain Sequence
b'GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 47
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5aflA00
4NPPA 3RIAA 5IUXA 3TLSA 3WTJA 4QACA 2PH9A 3PMZA 4LMLA 3UU6A 3WTMA 3U8LA 4UXUA 4UM1A 5CFBA 4AFGA 3ZKRA 2XQAA 2XNTA 4QAAA 4EZ1A 3TLTA 2XZ6A 4BQTA 4LMKA 3WTHA 5L4HA 2YN6A 3WTNA 2BG9A 5TVCA 3RQWA 4ZRUA 3RQUA 4F8HA 4NZBA 5AFLA 3UQ7A 2BYQA 4IL9A 3UU8A 2WZYA 3WTIA 2WNJA 2WNLA 4UY2A 5SYOA 3RI5A 4ILAA 3EAMA 2Y54A 4D01A 5AFMB 2XYTA 4ILCA 4X5TA 5JMEA 2BR7A 4ILBA 4BFQA 3U8MA 2YOEA 5HEHA 3SIOA 4QH4A 5AINA 4TWFA 1I9BA 2BYPA 2WNCA 5CO5A 2YKSA 2XNUA 3P50A 5J5FA 5J5IA 2XQ5A 3SQ6A 4A98A 4IREA 2ZJVA 3SQ9A 5J0ZA 5HCMA 3PEOA 3UU3A 3RHWA 2XQ6A 4DBMA 3ZDGA 2XNVA 2C9TA 2QC1B 5HEGA 5J5GA 4ZR6A 3UU4A 5KZUA 2ZJUA 3ZDHA 5AFHA 3JAEA 4A97A 3SH1A 5AFMA 5KE4A 4ZJSA 4UM3A 5BP0A 2YMEA 3IGQA 4UM3P 5BW2A 3LSVA 4COFA 2WN9A 5L4EA 4HFHA 3GUAA 3UU5A 3C84A 4ALXA 5AFNA 2BG9C 4TWDA 4HQPA 4XHEA 4Z90A 2XQ4A 4TNWA 3WTKA 4UM3S 3P4WA 5J5HA 4ZZCA 2W8FA 5AFKA 4WV9A 4HFCA 5FJVA 3U8KA 4ZK1A 5HEJA 4TNVA 2BYSA 5L47A 5LXBA 2W8GA 2Y7YA 4LMJA 5HCJA 5HEOA 2BG9E 2XQ8A 2Y56A 3T4MA 3JADA 3UUBA 2XZ5A 3U8NA 4HFEA 3C79A 4TWHA 3RIFA 3WIPA 4HFDA 4HFBA 3TLWA 1UV6A 3UQ4A 4FRRA 4Z91A 2XQ9A 3TLVA 3WTLA 4PIRA 4ZJTA 2Y58A 4AFHA 3JAFA 2X00D 2BR8A 1UX2A 2XYSA 2VL0A 4QABA 2BYNA 4QH5A 3U8JA 4B5DA 5BRXA 4IL4A 2UZ6A 2XQ3A 5AFJA 4XK9A 4HFIA 1UW6A 4AFTA 2PGZA 2X00A 3TLUA 2BYRA 5LG3A 2XQ7A 5HEUA 2BG9B 3WTOA 4ZK4A 2YMDA 4ZZBA 3EHZA 4QH1A 2BJ0A 2Y57A 3EI0A
chains in the Genus database with same CATH superfamily
4NPPA 3RIAA 5IUXA 3TLSA 3WTJA 4QACA 2PH9A 3PMZA 4LMLA 3UU6A 3WTMA 3U8LA 4UXUA 4UM1A 5CFBA 4AFGA 3ZKRA 2XQAA 2XNTA 4QAAA 4EZ1A 3TLTA 2XZ6A 4BQTA 4LMKA 3WTHA 5L4HA 2YN6A 3WTNA 2BG9A 5TVCA 3RQWA 4ZRUA 3RQUA 4F8HA 4NZBA 5AFLA 3UQ7A 2BYQA 4IL9A 3UU8A 2WZYA 3WTIA 2WNJA 2WNLA 4UY2A 5SYOA 3RI5A 4ILAA 3EAMA 2Y54A 4D01A 5AFMB 2XYTA 4ILCA 4X5TA 5JMEA 2BR7A 4ILBA 4BFQA 3U8MA 2YOEA 5HEHA 3SIOA 4QH4A 5AINA 4TWFA 1I9BA 2BYPA 2WNCA 5CO5A 2YKSA 2XNUA 3P50A 5J5FA 5J5IA 2XQ5A 3SQ6A 4A98A 4IREA 2ZJVA 3SQ9A 5J0ZA 5HCMA 3PEOA 3UU3A 3RHWA 2XQ6A 4DBMA 3ZDGA 2XNVA 2C9TA 2QC1B 5HEGA 5J5GA 4ZR6A 3UU4A 5KZUA 2ZJUA 3ZDHA 5AFHA 3JAEA 4A97A 3SH1A 5AFMA 5KE4A 4ZJSA 4UM3A 5BP0A 2YMEA 3IGQA 4UM3P 5BW2A 3LSVA 4COFA 2WN9A 5L4EA 4HFHA 3GUAA 3UU5A 3C84A 4ALXA 5AFNA 2BG9C 4TWDA 4HQPA 4XHEA 4Z90A 2XQ4A 4TNWA 3WTKA 4UM3S 3P4WA 5J5HA 4ZZCA 2W8FA 5AFKA 4WV9A 4HFCA 5FJVA 3U8KA 4ZK1A 5HEJA 4TNVA 2BYSA 5L47A 5LXBA 2W8GA 2Y7YA 4LMJA 5HCJA 5HEOA 2BG9E 2XQ8A 2Y56A 3T4MA 3JADA 3UUBA 2XZ5A 3U8NA 4HFEA 3C79A 4TWHA 3RIFA 3WIPA 4HFDA 4HFBA 3TLWA 1UV6A 3UQ4A 4FRRA 4Z91A 2XQ9A 3TLVA 3WTLA 4PIRA 4ZJTA 2Y58A 4AFHA 3JAFA 2X00D 2BR8A 1UX2A 2XYSA 2VL0A 4QABA 2BYNA 4QH5A 3U8JA 4B5DA 5BRXA 4IL4A 2UZ6A 2XQ3A 5AFJA 4XK9A 4HFIA 1UW6A 4AFTA 2PGZA 2X00A 3TLUA 2BYRA 5LG3A 2XQ7A 5HEUA 2BG9B 3WTOA 4ZK4A 2YMDA 4ZZBA 3EHZA 4QH1A 2BJ0A 2Y57A 3EI0A
chains in the Genus database with same CATH topology
4NPPA 3RIAA 5IUXA 3TLSA 3WTJA 4QACA 2PH9A 3PMZA 4LMLA 3UU6A 3WTMA 3U8LA 4UXUA 4UM1A 5CFBA 4AFGA 3ZKRA 2XQAA 2XNTA 4QAAA 4EZ1A 3TLTA 2XZ6A 4BQTA 4LMKA 3WTHA 5L4HA 2YN6A 3WTNA 2BG9A 5TVCA 3RQWA 4ZRUA 3RQUA 4F8HA 4NZBA 5AFLA 3UQ7A 2BYQA 4IL9A 3UU8A 2WZYA 3WTIA 2WNJA 2WNLA 4UY2A 5SYOA 3RI5A 4ILAA 3EAMA 2Y54A 4D01A 5AFMB 2XYTA 4ILCA 4X5TA 5JMEA 2BR7A 4ILBA 4BFQA 3U8MA 2YOEA 5HEHA 3SIOA 4QH4A 5AINA 4TWFA 1I9BA 2BYPA 2WNCA 5CO5A 2YKSA 2XNUA 3P50A 5J5FA 5J5IA 2XQ5A 3SQ6A 4A98A 4IREA 2ZJVA 3SQ9A 5J0ZA 5HCMA 3PEOA 3UU3A 3RHWA 2XQ6A 4DBMA 3ZDGA 2XNVA 2C9TA 2QC1B 5HEGA 5J5GA 4ZR6A 3UU4A 5KZUA 2ZJUA 3ZDHA 5AFHA 3JAEA 4A97A 3SH1A 5AFMA 5KE4A 4ZJSA 4UM3A 5BP0A 2YMEA 3IGQA 4UM3P 5BW2A 3LSVA 4COFA 2WN9A 5L4EA 4HFHA 3GUAA 3UU5A 3C84A 4ALXA 5AFNA 2BG9C 4TWDA 4HQPA 4XHEA 4Z90A 2XQ4A 4TNWA 3WTKA 4UM3S 3P4WA 5J5HA 4ZZCA 2W8FA 5AFKA 4WV9A 4HFCA 5FJVA 3U8KA 4ZK1A 5HEJA 4TNVA 2BYSA 5L47A 5LXBA 2W8GA 2Y7YA 4LMJA 5HCJA 5HEOA 2BG9E 2XQ8A 2Y56A 3T4MA 3JADA 3UUBA 2XZ5A 3U8NA 4HFEA 3C79A 4TWHA 3RIFA 3WIPA 4HFDA 4HFBA 3TLWA 1UV6A 3UQ4A 4FRRA 4Z91A 2XQ9A 3TLVA 3WTLA 4PIRA 4ZJTA 2Y58A 4AFHA 3JAFA 2X00D 2BR8A 1UX2A 2XYSA 2VL0A 4QABA 2BYNA 4QH5A 3U8JA 4B5DA 5BRXA 4IL4A 2UZ6A 2XQ3A 5AFJA 4XK9A 4HFIA 1UW6A 4AFTA 2PGZA 2X00A 3TLUA 2BYRA 5LG3A 2XQ7A 5HEUA 2BG9B 3WTOA 4ZK4A 2YMDA 4ZZBA 3EHZA 4QH1A 2BJ0A 2Y57A 3EI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPP A;  3RIA A;  5IUX A;  3TLS A;  3WTJ A;  4QAC A;  2PH9 A;  3PMZ A;  4LML A;  3UU6 A;  3WTM A;  3U8L A;  4UXU A;  4UM1 A;  5CFB A;  4AFG A;  3ZKR A;  2XQA A;  2XNT A;  4QAA A;  4EZ1 A;  3TLT A;  2XZ6 A;  4BQT A;  4LMK A;  3WTH A;  5L4H A;  2YN6 A;  3WTN A;  2BG9 A;  5TVC A;  3RQW A;  4ZRU A;  3RQU A;  4F8H A;  4NZB A;  5AFL A;  3UQ7 A;  2BYQ A;  4IL9 A;  3UU8 A;  2WZY A;  3WTI A;  2WNJ A;  2WNL A;  4UY2 A;  5SYO A;  3RI5 A;  4ILA A;  3EAM A;  2Y54 A;  4D01 A;  5AFM B;  2XYT A;  4ILC A;  4X5T A;  5JME A;  2BR7 A;  4ILB A;  4BFQ A;  3U8M A;  2YOE A;  5HEH A;  3SIO A;  4QH4 A;  5AIN A;  4TWF A;  1I9B A;  2BYP A;  2WNC A;  5CO5 A;  2YKS A;  2XNU A;  3P50 A;  5J5F A;  5J5I A;  2XQ5 A;  3SQ6 A;  4A98 A;  4IRE A;  2ZJV A;  3SQ9 A;  5J0Z A;  5HCM A;  3PEO A;  3UU3 A;  3RHW A;  2XQ6 A;  4DBM A;  3ZDG A;  2XNV A;  2C9T A;  2QC1 B;  5HEG A;  5J5G A;  4ZR6 A;  3UU4 A;  5KZU A;  2ZJU A;  3ZDH A;  5AFH A;  3JAE A;  4A97 A;  3SH1 A;  5AFM A;  5KE4 A;  4ZJS A;  4UM3 A;  5BP0 A;  2YME A;  3IGQ A;  4UM3 P;  5BW2 A;  3LSV A;  4COF A;  2WN9 A;  5L4E A;  4HFH A;  3GUA A;  3UU5 A;  3C84 A;  4ALX A;  5AFN A;  2BG9 C;  4TWD A;  4HQP A;  4XHE A;  4Z90 A;  2XQ4 A;  4TNW A;  3WTK A;  4UM3 S;  3P4W A;  5J5H A;  4ZZC A;  2W8F A;  5AFK A;  4WV9 A;  4HFC A;  5FJV A;  3U8K A;  4ZK1 A;  5HEJ A;  4TNV A;  2BYS A;  5L47 A;  5LXB A;  2W8G A;  2Y7Y A;  4LMJ A;  5HCJ A;  5HEO A;  2BG9 E;  2XQ8 A;  2Y56 A;  3T4M A;  3JAD A;  3UUB A;  2XZ5 A;  3U8N A;  4HFE A;  3C79 A;  4TWH A;  3RIF A;  3WIP A;  4HFD A;  4HFB A;  3TLW A;  1UV6 A;  3UQ4 A;  4FRR A;  4Z91 A;  2XQ9 A;  3TLV A;  3WTL A;  4PIR A;  4ZJT A;  2Y58 A;  4AFH A;  3JAF A;  2X00 D;  2BR8 A;  1UX2 A;  2XYS A;  2VL0 A;  4QAB A;  2BYN A;  4QH5 A;  3U8J A;  4B5D A;  5BRX A;  4IL4 A;  2UZ6 A;  2XQ3 A;  5AFJ A;  4XK9 A;  4HFI A;  1UW6 A;  4AFT A;  2PGZ A;  2X00 A;  3TLU A;  2BYR A;  5LG3 A;  2XQ7 A;  5HEU A;  2BG9 B;  3WTO A;  4ZK4 A;  2YMD A;  4ZZB A;  3EHZ A;  4QH1 A;  2BJ0 A;  2Y57 A;  3EI0 A; 
#chains in the Genus database with same CATH topology
 4NPP A;  3RIA A;  5IUX A;  3TLS A;  3WTJ A;  4QAC A;  2PH9 A;  3PMZ A;  4LML A;  3UU6 A;  3WTM A;  3U8L A;  4UXU A;  4UM1 A;  5CFB A;  4AFG A;  3ZKR A;  2XQA A;  2XNT A;  4QAA A;  4EZ1 A;  3TLT A;  2XZ6 A;  4BQT A;  4LMK A;  3WTH A;  5L4H A;  2YN6 A;  3WTN A;  2BG9 A;  5TVC A;  3RQW A;  4ZRU A;  3RQU A;  4F8H A;  4NZB A;  5AFL A;  3UQ7 A;  2BYQ A;  4IL9 A;  3UU8 A;  2WZY A;  3WTI A;  2WNJ A;  2WNL A;  4UY2 A;  5SYO A;  3RI5 A;  4ILA A;  3EAM A;  2Y54 A;  4D01 A;  5AFM B;  2XYT A;  4ILC A;  4X5T A;  5JME A;  2BR7 A;  4ILB A;  4BFQ A;  3U8M A;  2YOE A;  5HEH A;  3SIO A;  4QH4 A;  5AIN A;  4TWF A;  1I9B A;  2BYP A;  2WNC A;  5CO5 A;  2YKS A;  2XNU A;  3P50 A;  5J5F A;  5J5I A;  2XQ5 A;  3SQ6 A;  4A98 A;  4IRE A;  2ZJV A;  3SQ9 A;  5J0Z A;  5HCM A;  3PEO A;  3UU3 A;  3RHW A;  2XQ6 A;  4DBM A;  3ZDG A;  2XNV A;  2C9T A;  2QC1 B;  5HEG A;  5J5G A;  4ZR6 A;  3UU4 A;  5KZU A;  2ZJU A;  3ZDH A;  5AFH A;  3JAE A;  4A97 A;  3SH1 A;  5AFM A;  5KE4 A;  4ZJS A;  4UM3 A;  5BP0 A;  2YME A;  3IGQ A;  4UM3 P;  5BW2 A;  3LSV A;  4COF A;  2WN9 A;  5L4E A;  4HFH A;  3GUA A;  3UU5 A;  3C84 A;  4ALX A;  5AFN A;  2BG9 C;  4TWD A;  4HQP A;  4XHE A;  4Z90 A;  2XQ4 A;  4TNW A;  3WTK A;  4UM3 S;  3P4W A;  5J5H A;  4ZZC A;  2W8F A;  5AFK A;  4WV9 A;  4HFC A;  5FJV A;  3U8K A;  4ZK1 A;  5HEJ A;  4TNV A;  2BYS A;  5L47 A;  5LXB A;  2W8G A;  2Y7Y A;  4LMJ A;  5HCJ A;  5HEO A;  2BG9 E;  2XQ8 A;  2Y56 A;  3T4M A;  3JAD A;  3UUB A;  2XZ5 A;  3U8N A;  4HFE A;  3C79 A;  4TWH A;  3RIF A;  3WIP A;  4HFD A;  4HFB A;  3TLW A;  1UV6 A;  3UQ4 A;  4FRR A;  4Z91 A;  2XQ9 A;  3TLV A;  3WTL A;  4PIR A;  4ZJT A;  2Y58 A;  4AFH A;  3JAF A;  2X00 D;  2BR8 A;  1UX2 A;  2XYS A;  2VL0 A;  4QAB A;  2BYN A;  4QH5 A;  3U8J A;  4B5D A;  5BRX A;  4IL4 A;  2UZ6 A;  2XQ3 A;  5AFJ A;  4XK9 A;  4HFI A;  1UW6 A;  4AFT A;  2PGZ A;  2X00 A;  3TLU A;  2BYR A;  5LG3 A;  2XQ7 A;  5HEU A;  2BG9 B;  3WTO A;  4ZK4 A;  2YMD A;  4ZZB A;  3EHZ A;  4QH1 A;  2BJ0 A;  2Y57 A;  3EI0 A; 
#chains in the Genus database with same CATH homology
 4NPP A;  3RIA A;  5IUX A;  3TLS A;  3WTJ A;  4QAC A;  2PH9 A;  3PMZ A;  4LML A;  3UU6 A;  3WTM A;  3U8L A;  4UXU A;  4UM1 A;  5CFB A;  4AFG A;  3ZKR A;  2XQA A;  2XNT A;  4QAA A;  4EZ1 A;  3TLT A;  2XZ6 A;  4BQT A;  4LMK A;  3WTH A;  5L4H A;  2YN6 A;  3WTN A;  2BG9 A;  5TVC A;  3RQW A;  4ZRU A;  3RQU A;  4F8H A;  4NZB A;  5AFL A;  3UQ7 A;  2BYQ A;  4IL9 A;  3UU8 A;  2WZY A;  3WTI A;  2WNJ A;  2WNL A;  4UY2 A;  5SYO A;  3RI5 A;  4ILA A;  3EAM A;  2Y54 A;  4D01 A;  5AFM B;  2XYT A;  4ILC A;  4X5T A;  5JME A;  2BR7 A;  4ILB A;  4BFQ A;  3U8M A;  2YOE A;  5HEH A;  3SIO A;  4QH4 A;  5AIN A;  4TWF A;  1I9B A;  2BYP A;  2WNC A;  5CO5 A;  2YKS A;  2XNU A;  3P50 A;  5J5F A;  5J5I A;  2XQ5 A;  3SQ6 A;  4A98 A;  4IRE A;  2ZJV A;  3SQ9 A;  5J0Z A;  5HCM A;  3PEO A;  3UU3 A;  3RHW A;  2XQ6 A;  4DBM A;  3ZDG A;  2XNV A;  2C9T A;  2QC1 B;  5HEG A;  5J5G A;  4ZR6 A;  3UU4 A;  5KZU A;  2ZJU A;  3ZDH A;  5AFH A;  3JAE A;  4A97 A;  3SH1 A;  5AFM A;  5KE4 A;  4ZJS A;  4UM3 A;  5BP0 A;  2YME A;  3IGQ A;  4UM3 P;  5BW2 A;  3LSV A;  4COF A;  2WN9 A;  5L4E A;  4HFH A;  3GUA A;  3UU5 A;  3C84 A;  4ALX A;  5AFN A;  2BG9 C;  4TWD A;  4HQP A;  4XHE A;  4Z90 A;  2XQ4 A;  4TNW A;  3WTK A;  4UM3 S;  3P4W A;  5J5H A;  4ZZC A;  2W8F A;  5AFK A;  4WV9 A;  4HFC A;  5FJV A;  3U8K A;  4ZK1 A;  5HEJ A;  4TNV A;  2BYS A;  5L47 A;  5LXB A;  2W8G A;  2Y7Y A;  4LMJ A;  5HCJ A;  5HEO A;  2BG9 E;  2XQ8 A;  2Y56 A;  3T4M A;  3JAD A;  3UUB A;  2XZ5 A;  3U8N A;  4HFE A;  3C79 A;  4TWH A;  3RIF A;  3WIP A;  4HFD A;  4HFB A;  3TLW A;  1UV6 A;  3UQ4 A;  4FRR A;  4Z91 A;  2XQ9 A;  3TLV A;  3WTL A;  4PIR A;  4ZJT A;  2Y58 A;  4AFH A;  3JAF A;  2X00 D;  2BR8 A;  1UX2 A;  2XYS A;  2VL0 A;  4QAB A;  2BYN A;  4QH5 A;  3U8J A;  4B5D A;  5BRX A;  4IL4 A;  2UZ6 A;  2XQ3 A;  5AFJ A;  4XK9 A;  4HFI A;  1UW6 A;  4AFT A;  2PGZ A;  2X00 A;  3TLU A;  2BYR A;  5LG3 A;  2XQ7 A;  5HEU A;  2BG9 B;  3WTO A;  4ZK4 A;  2YMD A;  4ZZB A;  3EHZ A;  4QH1 A;  2BJ0 A;  2Y57 A;  3EI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...