5AFMA

Alpha7-achbp in complex with lobeline and fragment 4
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
205
structure length
205
Chain Sequence
b'GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 43
structure length 205
sequence length 205
chains with identical sequence C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afmA00
3ZDGA 4WV9A 4PIRA 2BG9E 3ZDHA 3ZKRA 1I9BA 3PEOA 5FJVA 5J5FA 2BYSA 2ZJVA 4A97A 3JAFA 3UU8A 2XQ9A 2YN6A 4ILAA 5L47A 5AFMA 5IUXA 4Z90A 2XYSA 3PMZA 3UUBA 2C9TA 2XQ8A 4QACA 2XQ5A 2BR7A 4NPPA 2XNUA 3UU5A 2XQ7A 4BQTA 5HEGA 3RQUA 4ZR6A 4X5TA 2BJ0A 4ILBA 5BRXA 2WN9A 5HEHA 4XHEA 5AFHA 5LG3A 5J5GA 3C84A 3WTIA 2PGZA 5J0ZA 2XNTA 3WTMA 5CFBA 4FRRA 3SH1A 4HFEA 4LMKA 3WTJA 3C79A 4LMLA 5LXBA 4AFHA 2Y57A 4ZZCA 2UZ6A 3IGQA 2XQ6A 4NZBA 5CO5A 4BFQA 4UM3S 5J5HA 3EAMA 3UU4A 2W8GA 2WZYA 2XQ4A 2PH9A 4ZRUA 1UV6A 3UU6A 4UXUA 3WTLA 5AFJA 2XZ5A 2BYNA 4QH1A 4TNWA 3SIOA 4AFGA 2XQ3A 2W8FA 2WNLA 4TWFA 3RI5A 4DBMA 3TLWA 2Y56A 5AFNA 5AFLA 2BG9C 2WNCA 3EI0A 5HCMA 3UU3A 4Z91A 3TLSA 3JADA 4AFTA 4LMJA 3UQ7A 4ZJTA 4ZK4A 3LSVA 3U8NA 5TVCA 4COFA 3U8KA 2YOEA 4IL9A 5HEUA 3RQWA 3P50A 4ALXA 3GUAA 4HFDA 4EZ1A 3WTKA 3SQ6A 2BG9B 3U8JA 2X00A 4IL4A 4UY2A 5AFMB 4HFBA 5HCJA 3WIPA 5L4EA 1UX2A 4D01A 5AINA 1UW6A 3TLVA 2VL0A 3RIFA 2YMDA 3SQ9A 2BYPA 3U8MA 2BYQA 5AFKA 2BR8A 4UM3P 2YMEA 2XNVA 4QAAA 2WNJA 2Y7YA 3UQ4A 5KE4A 3TLUA 4QABA 4HFHA 2ZJUA 3RHWA 4TNVA 2XYTA 3TLTA 4A98A 2YKSA 5KZUA 4QH5A 4ILCA 3RIAA 5BW2A 2X00D 4IREA 3WTOA 5HEOA 4UM3A 2BG9A 5SYOA 4F8HA 4UM1A 4TWDA 3JAEA 3P4WA 4HQPA 2BYRA 3WTNA 2XZ6A 5BP0A 5JMEA 4ZZBA 2Y58A 4ZK1A 4HFCA 4B5DA 4HFIA 3U8LA 4QH4A 3WTHA 4TWHA 3T4MA 5J5IA 5L4HA 2Y54A 4ZJSA 4XK9A 2QC1B 2XQAA 5HEJA 3EHZA
chains in the Genus database with same CATH superfamily
3ZDGA 4WV9A 4PIRA 2BG9E 3ZDHA 3ZKRA 1I9BA 3PEOA 5FJVA 5J5FA 2BYSA 2ZJVA 4A97A 3JAFA 3UU8A 2XQ9A 2YN6A 4ILAA 5L47A 5AFMA 5IUXA 4Z90A 2XYSA 3PMZA 3UUBA 2C9TA 2XQ8A 4QACA 2XQ5A 2BR7A 4NPPA 2XNUA 3UU5A 2XQ7A 4BQTA 5HEGA 3RQUA 4ZR6A 4X5TA 2BJ0A 4ILBA 5BRXA 2WN9A 5HEHA 4XHEA 5AFHA 5LG3A 5J5GA 3C84A 3WTIA 2PGZA 5J0ZA 2XNTA 3WTMA 5CFBA 4FRRA 3SH1A 4HFEA 4LMKA 3WTJA 3C79A 4LMLA 5LXBA 4AFHA 2Y57A 4ZZCA 2UZ6A 3IGQA 2XQ6A 4NZBA 5CO5A 4BFQA 4UM3S 5J5HA 3EAMA 3UU4A 2W8GA 2WZYA 2XQ4A 2PH9A 4ZRUA 1UV6A 3UU6A 4UXUA 3WTLA 5AFJA 2XZ5A 2BYNA 4QH1A 4TNWA 3SIOA 4AFGA 2XQ3A 2W8FA 2WNLA 4TWFA 3RI5A 4DBMA 3TLWA 2Y56A 5AFNA 5AFLA 2BG9C 2WNCA 3EI0A 5HCMA 3UU3A 4Z91A 3TLSA 3JADA 4AFTA 4LMJA 3UQ7A 4ZJTA 4ZK4A 3LSVA 3U8NA 5TVCA 4COFA 3U8KA 2YOEA 4IL9A 5HEUA 3RQWA 3P50A 4ALXA 3GUAA 4HFDA 4EZ1A 3WTKA 3SQ6A 2BG9B 3U8JA 2X00A 4IL4A 4UY2A 5AFMB 4HFBA 5HCJA 3WIPA 5L4EA 1UX2A 4D01A 5AINA 1UW6A 3TLVA 2VL0A 3RIFA 2YMDA 3SQ9A 2BYPA 3U8MA 2BYQA 5AFKA 2BR8A 4UM3P 2YMEA 2XNVA 4QAAA 2WNJA 2Y7YA 3UQ4A 5KE4A 3TLUA 4QABA 4HFHA 2ZJUA 3RHWA 4TNVA 2XYTA 3TLTA 4A98A 2YKSA 5KZUA 4QH5A 4ILCA 3RIAA 5BW2A 2X00D 4IREA 3WTOA 5HEOA 4UM3A 2BG9A 5SYOA 4F8HA 4UM1A 4TWDA 3JAEA 3P4WA 4HQPA 2BYRA 3WTNA 2XZ6A 5BP0A 5JMEA 4ZZBA 2Y58A 4ZK1A 4HFCA 4B5DA 4HFIA 3U8LA 4QH4A 3WTHA 4TWHA 3T4MA 5J5IA 5L4HA 2Y54A 4ZJSA 4XK9A 2QC1B 2XQAA 5HEJA 3EHZA
chains in the Genus database with same CATH topology
3ZDGA 4WV9A 4PIRA 2BG9E 3ZDHA 3ZKRA 1I9BA 3PEOA 5FJVA 5J5FA 2BYSA 2ZJVA 4A97A 3JAFA 3UU8A 2XQ9A 2YN6A 4ILAA 5L47A 5AFMA 5IUXA 4Z90A 2XYSA 3PMZA 3UUBA 2C9TA 2XQ8A 4QACA 2XQ5A 2BR7A 4NPPA 2XNUA 3UU5A 2XQ7A 4BQTA 5HEGA 3RQUA 4ZR6A 4X5TA 2BJ0A 4ILBA 5BRXA 2WN9A 5HEHA 4XHEA 5AFHA 5LG3A 5J5GA 3C84A 3WTIA 2PGZA 5J0ZA 2XNTA 3WTMA 5CFBA 4FRRA 3SH1A 4HFEA 4LMKA 3WTJA 3C79A 4LMLA 5LXBA 4AFHA 2Y57A 4ZZCA 2UZ6A 3IGQA 2XQ6A 4NZBA 5CO5A 4BFQA 4UM3S 5J5HA 3EAMA 3UU4A 2W8GA 2WZYA 2XQ4A 2PH9A 4ZRUA 1UV6A 3UU6A 4UXUA 3WTLA 5AFJA 2XZ5A 2BYNA 4QH1A 4TNWA 3SIOA 4AFGA 2XQ3A 2W8FA 2WNLA 4TWFA 3RI5A 4DBMA 3TLWA 2Y56A 5AFNA 5AFLA 2BG9C 2WNCA 3EI0A 5HCMA 3UU3A 4Z91A 3TLSA 3JADA 4AFTA 4LMJA 3UQ7A 4ZJTA 4ZK4A 3LSVA 3U8NA 5TVCA 4COFA 3U8KA 2YOEA 4IL9A 5HEUA 3RQWA 3P50A 4ALXA 3GUAA 4HFDA 4EZ1A 3WTKA 3SQ6A 2BG9B 3U8JA 2X00A 4IL4A 4UY2A 5AFMB 4HFBA 5HCJA 3WIPA 5L4EA 1UX2A 4D01A 5AINA 1UW6A 3TLVA 2VL0A 3RIFA 2YMDA 3SQ9A 2BYPA 3U8MA 2BYQA 5AFKA 2BR8A 4UM3P 2YMEA 2XNVA 4QAAA 2WNJA 2Y7YA 3UQ4A 5KE4A 3TLUA 4QABA 4HFHA 2ZJUA 3RHWA 4TNVA 2XYTA 3TLTA 4A98A 2YKSA 5KZUA 4QH5A 4ILCA 3RIAA 5BW2A 2X00D 4IREA 3WTOA 5HEOA 4UM3A 2BG9A 5SYOA 4F8HA 4UM1A 4TWDA 3JAEA 3P4WA 4HQPA 2BYRA 3WTNA 2XZ6A 5BP0A 5JMEA 4ZZBA 2Y58A 4ZK1A 4HFCA 4B5DA 4HFIA 3U8LA 4QH4A 3WTHA 4TWHA 3T4MA 5J5IA 5L4HA 2Y54A 4ZJSA 4XK9A 2QC1B 2XQAA 5HEJA 3EHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZDG A;  4WV9 A;  4PIR A;  2BG9 E;  3ZDH A;  3ZKR A;  1I9B A;  3PEO A;  5FJV A;  5J5F A;  2BYS A;  2ZJV A;  4A97 A;  3JAF A;  3UU8 A;  2XQ9 A;  2YN6 A;  4ILA A;  5L47 A;  5AFM A;  5IUX A;  4Z90 A;  2XYS A;  3PMZ A;  3UUB A;  2C9T A;  2XQ8 A;  4QAC A;  2XQ5 A;  2BR7 A;  4NPP A;  2XNU A;  3UU5 A;  2XQ7 A;  4BQT A;  5HEG A;  3RQU A;  4ZR6 A;  4X5T A;  2BJ0 A;  4ILB A;  5BRX A;  2WN9 A;  5HEH A;  4XHE A;  5AFH A;  5LG3 A;  5J5G A;  3C84 A;  3WTI A;  2PGZ A;  5J0Z A;  2XNT A;  3WTM A;  5CFB A;  4FRR A;  3SH1 A;  4HFE A;  4LMK A;  3WTJ A;  3C79 A;  4LML A;  5LXB A;  4AFH A;  2Y57 A;  4ZZC A;  2UZ6 A;  3IGQ A;  2XQ6 A;  4NZB A;  5CO5 A;  4BFQ A;  4UM3 S;  5J5H A;  3EAM A;  3UU4 A;  2W8G A;  2WZY A;  2XQ4 A;  2PH9 A;  4ZRU A;  1UV6 A;  3UU6 A;  4UXU A;  3WTL A;  5AFJ A;  2XZ5 A;  2BYN A;  4QH1 A;  4TNW A;  3SIO A;  4AFG A;  2XQ3 A;  2W8F A;  2WNL A;  4TWF A;  3RI5 A;  4DBM A;  3TLW A;  2Y56 A;  5AFN A;  5AFL A;  2BG9 C;  2WNC A;  3EI0 A;  5HCM A;  3UU3 A;  4Z91 A;  3TLS A;  3JAD A;  4AFT A;  4LMJ A;  3UQ7 A;  4ZJT A;  4ZK4 A;  3LSV A;  3U8N A;  5TVC A;  4COF A;  3U8K A;  2YOE A;  4IL9 A;  5HEU A;  3RQW A;  3P50 A;  4ALX A;  3GUA A;  4HFD A;  4EZ1 A;  3WTK A;  3SQ6 A;  2BG9 B;  3U8J A;  2X00 A;  4IL4 A;  4UY2 A;  5AFM B;  4HFB A;  5HCJ A;  3WIP A;  5L4E A;  1UX2 A;  4D01 A;  5AIN A;  1UW6 A;  3TLV A;  2VL0 A;  3RIF A;  2YMD A;  3SQ9 A;  2BYP A;  3U8M A;  2BYQ A;  5AFK A;  2BR8 A;  4UM3 P;  2YME A;  2XNV A;  4QAA A;  2WNJ A;  2Y7Y A;  3UQ4 A;  5KE4 A;  3TLU A;  4QAB A;  4HFH A;  2ZJU A;  3RHW A;  4TNV A;  2XYT A;  3TLT A;  4A98 A;  2YKS A;  5KZU A;  4QH5 A;  4ILC A;  3RIA A;  5BW2 A;  2X00 D;  4IRE A;  3WTO A;  5HEO A;  4UM3 A;  2BG9 A;  5SYO A;  4F8H A;  4UM1 A;  4TWD A;  3JAE A;  3P4W A;  4HQP A;  2BYR A;  3WTN A;  2XZ6 A;  5BP0 A;  5JME A;  4ZZB A;  2Y58 A;  4ZK1 A;  4HFC A;  4B5D A;  4HFI A;  3U8L A;  4QH4 A;  3WTH A;  4TWH A;  3T4M A;  5J5I A;  5L4H A;  2Y54 A;  4ZJS A;  4XK9 A;  2QC1 B;  2XQA A;  5HEJ A;  3EHZ A; 
#chains in the Genus database with same CATH topology
 3ZDG A;  4WV9 A;  4PIR A;  2BG9 E;  3ZDH A;  3ZKR A;  1I9B A;  3PEO A;  5FJV A;  5J5F A;  2BYS A;  2ZJV A;  4A97 A;  3JAF A;  3UU8 A;  2XQ9 A;  2YN6 A;  4ILA A;  5L47 A;  5AFM A;  5IUX A;  4Z90 A;  2XYS A;  3PMZ A;  3UUB A;  2C9T A;  2XQ8 A;  4QAC A;  2XQ5 A;  2BR7 A;  4NPP A;  2XNU A;  3UU5 A;  2XQ7 A;  4BQT A;  5HEG A;  3RQU A;  4ZR6 A;  4X5T A;  2BJ0 A;  4ILB A;  5BRX A;  2WN9 A;  5HEH A;  4XHE A;  5AFH A;  5LG3 A;  5J5G A;  3C84 A;  3WTI A;  2PGZ A;  5J0Z A;  2XNT A;  3WTM A;  5CFB A;  4FRR A;  3SH1 A;  4HFE A;  4LMK A;  3WTJ A;  3C79 A;  4LML A;  5LXB A;  4AFH A;  2Y57 A;  4ZZC A;  2UZ6 A;  3IGQ A;  2XQ6 A;  4NZB A;  5CO5 A;  4BFQ A;  4UM3 S;  5J5H A;  3EAM A;  3UU4 A;  2W8G A;  2WZY A;  2XQ4 A;  2PH9 A;  4ZRU A;  1UV6 A;  3UU6 A;  4UXU A;  3WTL A;  5AFJ A;  2XZ5 A;  2BYN A;  4QH1 A;  4TNW A;  3SIO A;  4AFG A;  2XQ3 A;  2W8F A;  2WNL A;  4TWF A;  3RI5 A;  4DBM A;  3TLW A;  2Y56 A;  5AFN A;  5AFL A;  2BG9 C;  2WNC A;  3EI0 A;  5HCM A;  3UU3 A;  4Z91 A;  3TLS A;  3JAD A;  4AFT A;  4LMJ A;  3UQ7 A;  4ZJT A;  4ZK4 A;  3LSV A;  3U8N A;  5TVC A;  4COF A;  3U8K A;  2YOE A;  4IL9 A;  5HEU A;  3RQW A;  3P50 A;  4ALX A;  3GUA A;  4HFD A;  4EZ1 A;  3WTK A;  3SQ6 A;  2BG9 B;  3U8J A;  2X00 A;  4IL4 A;  4UY2 A;  5AFM B;  4HFB A;  5HCJ A;  3WIP A;  5L4E A;  1UX2 A;  4D01 A;  5AIN A;  1UW6 A;  3TLV A;  2VL0 A;  3RIF A;  2YMD A;  3SQ9 A;  2BYP A;  3U8M A;  2BYQ A;  5AFK A;  2BR8 A;  4UM3 P;  2YME A;  2XNV A;  4QAA A;  2WNJ A;  2Y7Y A;  3UQ4 A;  5KE4 A;  3TLU A;  4QAB A;  4HFH A;  2ZJU A;  3RHW A;  4TNV A;  2XYT A;  3TLT A;  4A98 A;  2YKS A;  5KZU A;  4QH5 A;  4ILC A;  3RIA A;  5BW2 A;  2X00 D;  4IRE A;  3WTO A;  5HEO A;  4UM3 A;  2BG9 A;  5SYO A;  4F8H A;  4UM1 A;  4TWD A;  3JAE A;  3P4W A;  4HQP A;  2BYR A;  3WTN A;  2XZ6 A;  5BP0 A;  5JME A;  4ZZB A;  2Y58 A;  4ZK1 A;  4HFC A;  4B5D A;  4HFI A;  3U8L A;  4QH4 A;  3WTH A;  4TWH A;  3T4M A;  5J5I A;  5L4H A;  2Y54 A;  4ZJS A;  4XK9 A;  2QC1 B;  2XQA A;  5HEJ A;  3EHZ A; 
#chains in the Genus database with same CATH homology
 3ZDG A;  4WV9 A;  4PIR A;  2BG9 E;  3ZDH A;  3ZKR A;  1I9B A;  3PEO A;  5FJV A;  5J5F A;  2BYS A;  2ZJV A;  4A97 A;  3JAF A;  3UU8 A;  2XQ9 A;  2YN6 A;  4ILA A;  5L47 A;  5AFM A;  5IUX A;  4Z90 A;  2XYS A;  3PMZ A;  3UUB A;  2C9T A;  2XQ8 A;  4QAC A;  2XQ5 A;  2BR7 A;  4NPP A;  2XNU A;  3UU5 A;  2XQ7 A;  4BQT A;  5HEG A;  3RQU A;  4ZR6 A;  4X5T A;  2BJ0 A;  4ILB A;  5BRX A;  2WN9 A;  5HEH A;  4XHE A;  5AFH A;  5LG3 A;  5J5G A;  3C84 A;  3WTI A;  2PGZ A;  5J0Z A;  2XNT A;  3WTM A;  5CFB A;  4FRR A;  3SH1 A;  4HFE A;  4LMK A;  3WTJ A;  3C79 A;  4LML A;  5LXB A;  4AFH A;  2Y57 A;  4ZZC A;  2UZ6 A;  3IGQ A;  2XQ6 A;  4NZB A;  5CO5 A;  4BFQ A;  4UM3 S;  5J5H A;  3EAM A;  3UU4 A;  2W8G A;  2WZY A;  2XQ4 A;  2PH9 A;  4ZRU A;  1UV6 A;  3UU6 A;  4UXU A;  3WTL A;  5AFJ A;  2XZ5 A;  2BYN A;  4QH1 A;  4TNW A;  3SIO A;  4AFG A;  2XQ3 A;  2W8F A;  2WNL A;  4TWF A;  3RI5 A;  4DBM A;  3TLW A;  2Y56 A;  5AFN A;  5AFL A;  2BG9 C;  2WNC A;  3EI0 A;  5HCM A;  3UU3 A;  4Z91 A;  3TLS A;  3JAD A;  4AFT A;  4LMJ A;  3UQ7 A;  4ZJT A;  4ZK4 A;  3LSV A;  3U8N A;  5TVC A;  4COF A;  3U8K A;  2YOE A;  4IL9 A;  5HEU A;  3RQW A;  3P50 A;  4ALX A;  3GUA A;  4HFD A;  4EZ1 A;  3WTK A;  3SQ6 A;  2BG9 B;  3U8J A;  2X00 A;  4IL4 A;  4UY2 A;  5AFM B;  4HFB A;  5HCJ A;  3WIP A;  5L4E A;  1UX2 A;  4D01 A;  5AIN A;  1UW6 A;  3TLV A;  2VL0 A;  3RIF A;  2YMD A;  3SQ9 A;  2BYP A;  3U8M A;  2BYQ A;  5AFK A;  2BR8 A;  4UM3 P;  2YME A;  2XNV A;  4QAA A;  2WNJ A;  2Y7Y A;  3UQ4 A;  5KE4 A;  3TLU A;  4QAB A;  4HFH A;  2ZJU A;  3RHW A;  4TNV A;  2XYT A;  3TLT A;  4A98 A;  2YKS A;  5KZU A;  4QH5 A;  4ILC A;  3RIA A;  5BW2 A;  2X00 D;  4IRE A;  3WTO A;  5HEO A;  4UM3 A;  2BG9 A;  5SYO A;  4F8H A;  4UM1 A;  4TWD A;  3JAE A;  3P4W A;  4HQP A;  2BYR A;  3WTN A;  2XZ6 A;  5BP0 A;  5JME A;  4ZZB A;  2Y58 A;  4ZK1 A;  4HFC A;  4B5D A;  4HFI A;  3U8L A;  4QH4 A;  3WTH A;  4TWH A;  3T4M A;  5J5I A;  5L4H A;  2Y54 A;  4ZJS A;  4XK9 A;  2QC1 B;  2XQA A;  5HEJ A;  3EHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...