5AFMB

Alpha7-achbp in complex with lobeline and fragment 4
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
207
structure length
207
Chain Sequence
b'GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 41
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afmB00
3TLVA 4TWFA 4DBMA 4A98A 4ILAA 5FJVA 2BG9A 3SQ9A 5AFJA 2WN9A 3RQUA 3UUBA 4UM3A 5HEOA 3UQ7A 3GUAA 5J5GA 4WV9A 2XQ9A 3WTMA 2XNUA 2XQ4A 3U8LA 5CO5A 3WTIA 5HEJA 3UU5A 5J0ZA 4LMKA 4ZJTA 3JADA 4HFDA 5BW2A 2XYSA 2Y7YA 3U8NA 4XK9A 4ZZBA 4IL9A 3P50A 4QAAA 4BQTA 3UU3A 2XNVA 2BJ0A 5LXBA 2QC1B 2W8FA 3U8JA 4QH1A 3EHZA 4ILBA 1UV6A 2BYRA 5L4HA 2PGZA 4TNVA 2ZJVA 5KZUA 2BG9E 4ALXA 2YMEA 2XQ5A 3RQWA 2BR7A 4UM1A 2XNTA 4HFCA 2WNLA 4ZK1A 2VL0A 2Y58A 3C79A 2BR8A 4ZZCA 5J5IA 2Y54A 4TWDA 3SH1A 3U8KA 5JMEA 2XZ6A 5HEHA 4QH5A 3JAEA 5IUXA 2WNCA 4LMJA 3T4MA 3EAMA 3TLWA 2BYPA 3WTJA 3EI0A 4EZ1A 5AFKA 4IREA 3RHWA 4AFTA 2YMDA 5TVCA 3UQ4A 3UU4A 3PEOA 4ILCA 5LG3A 3TLUA 3U8MA 4HFBA 3P4WA 4IL4A 4D01A 2W8GA 2BG9B 2BG9C 3C84A 4HFEA 3SQ6A 4QABA 2BYQA 4Z90A 4UXUA 1UX2A 4X5TA 3ZDGA 2XQ3A 3IGQA 5HEGA 3WTHA 3WTLA 4PIRA 5AFMA 5J5HA 4TNWA 2WZYA 5CFBA 2YOEA 2XQ7A 4ZJSA 3SIOA 4UY2A 2UZ6A 4XHEA 4Z91A 5J5FA 5BRXA 5HCJA 5KE4A 4F8HA 3PMZA 2XQAA 4LMLA 2PH9A 4UM3P 4UM3S 4AFHA 3WIPA 3WTKA 4BFQA 4NPPA 4NZBA 3TLTA 5L4EA 3TLSA 4ZK4A 3RI5A 5AINA 5AFMB 3JAFA 4ZR6A 2YKSA 3WTNA 3ZDHA 4HQPA 3RIFA 2BYSA 4FRRA 3WTOA 4B5DA 5AFNA 4COFA 2ZJUA 2WNJA 2XZ5A 2YN6A 4TWHA 3UU6A 3LSVA 4HFHA 5SYOA 4HFIA 2BYNA 2Y56A 2Y57A 3ZKRA 4QH4A 2XYTA 2X00A 4A97A 4QACA 1I9BA 5AFLA 5L47A 4ZRUA 5BP0A 2XQ8A 2XQ6A 3RIAA 3UU8A 5HEUA 4AFGA 5AFHA 1UW6A 5HCMA 2X00D 2C9TA
chains in the Genus database with same CATH superfamily
3TLVA 4TWFA 4DBMA 4A98A 4ILAA 5FJVA 2BG9A 3SQ9A 5AFJA 2WN9A 3RQUA 3UUBA 4UM3A 5HEOA 3UQ7A 3GUAA 5J5GA 4WV9A 2XQ9A 3WTMA 2XNUA 2XQ4A 3U8LA 5CO5A 3WTIA 5HEJA 3UU5A 5J0ZA 4LMKA 4ZJTA 3JADA 4HFDA 5BW2A 2XYSA 2Y7YA 3U8NA 4XK9A 4ZZBA 4IL9A 3P50A 4QAAA 4BQTA 3UU3A 2XNVA 2BJ0A 5LXBA 2QC1B 2W8FA 3U8JA 4QH1A 3EHZA 4ILBA 1UV6A 2BYRA 5L4HA 2PGZA 4TNVA 2ZJVA 5KZUA 2BG9E 4ALXA 2YMEA 2XQ5A 3RQWA 2BR7A 4UM1A 2XNTA 4HFCA 2WNLA 4ZK1A 2VL0A 2Y58A 3C79A 2BR8A 4ZZCA 5J5IA 2Y54A 4TWDA 3SH1A 3U8KA 5JMEA 2XZ6A 5HEHA 4QH5A 3JAEA 5IUXA 2WNCA 4LMJA 3T4MA 3EAMA 3TLWA 2BYPA 3WTJA 3EI0A 4EZ1A 5AFKA 4IREA 3RHWA 4AFTA 2YMDA 5TVCA 3UQ4A 3UU4A 3PEOA 4ILCA 5LG3A 3TLUA 3U8MA 4HFBA 3P4WA 4IL4A 4D01A 2W8GA 2BG9B 2BG9C 3C84A 4HFEA 3SQ6A 4QABA 2BYQA 4Z90A 4UXUA 1UX2A 4X5TA 3ZDGA 2XQ3A 3IGQA 5HEGA 3WTHA 3WTLA 4PIRA 5AFMA 5J5HA 4TNWA 2WZYA 5CFBA 2YOEA 2XQ7A 4ZJSA 3SIOA 4UY2A 2UZ6A 4XHEA 4Z91A 5J5FA 5BRXA 5HCJA 5KE4A 4F8HA 3PMZA 2XQAA 4LMLA 2PH9A 4UM3P 4UM3S 4AFHA 3WIPA 3WTKA 4BFQA 4NPPA 4NZBA 3TLTA 5L4EA 3TLSA 4ZK4A 3RI5A 5AINA 5AFMB 3JAFA 4ZR6A 2YKSA 3WTNA 3ZDHA 4HQPA 3RIFA 2BYSA 4FRRA 3WTOA 4B5DA 5AFNA 4COFA 2ZJUA 2WNJA 2XZ5A 2YN6A 4TWHA 3UU6A 3LSVA 4HFHA 5SYOA 4HFIA 2BYNA 2Y56A 2Y57A 3ZKRA 4QH4A 2XYTA 2X00A 4A97A 4QACA 1I9BA 5AFLA 5L47A 4ZRUA 5BP0A 2XQ8A 2XQ6A 3RIAA 3UU8A 5HEUA 4AFGA 5AFHA 1UW6A 5HCMA 2X00D 2C9TA
chains in the Genus database with same CATH topology
3TLVA 4TWFA 4DBMA 4A98A 4ILAA 5FJVA 2BG9A 3SQ9A 5AFJA 2WN9A 3RQUA 3UUBA 4UM3A 5HEOA 3UQ7A 3GUAA 5J5GA 4WV9A 2XQ9A 3WTMA 2XNUA 2XQ4A 3U8LA 5CO5A 3WTIA 5HEJA 3UU5A 5J0ZA 4LMKA 4ZJTA 3JADA 4HFDA 5BW2A 2XYSA 2Y7YA 3U8NA 4XK9A 4ZZBA 4IL9A 3P50A 4QAAA 4BQTA 3UU3A 2XNVA 2BJ0A 5LXBA 2QC1B 2W8FA 3U8JA 4QH1A 3EHZA 4ILBA 1UV6A 2BYRA 5L4HA 2PGZA 4TNVA 2ZJVA 5KZUA 2BG9E 4ALXA 2YMEA 2XQ5A 3RQWA 2BR7A 4UM1A 2XNTA 4HFCA 2WNLA 4ZK1A 2VL0A 2Y58A 3C79A 2BR8A 4ZZCA 5J5IA 2Y54A 4TWDA 3SH1A 3U8KA 5JMEA 2XZ6A 5HEHA 4QH5A 3JAEA 5IUXA 2WNCA 4LMJA 3T4MA 3EAMA 3TLWA 2BYPA 3WTJA 3EI0A 4EZ1A 5AFKA 4IREA 3RHWA 4AFTA 2YMDA 5TVCA 3UQ4A 3UU4A 3PEOA 4ILCA 5LG3A 3TLUA 3U8MA 4HFBA 3P4WA 4IL4A 4D01A 2W8GA 2BG9B 2BG9C 3C84A 4HFEA 3SQ6A 4QABA 2BYQA 4Z90A 4UXUA 1UX2A 4X5TA 3ZDGA 2XQ3A 3IGQA 5HEGA 3WTHA 3WTLA 4PIRA 5AFMA 5J5HA 4TNWA 2WZYA 5CFBA 2YOEA 2XQ7A 4ZJSA 3SIOA 4UY2A 2UZ6A 4XHEA 4Z91A 5J5FA 5BRXA 5HCJA 5KE4A 4F8HA 3PMZA 2XQAA 4LMLA 2PH9A 4UM3P 4UM3S 4AFHA 3WIPA 3WTKA 4BFQA 4NPPA 4NZBA 3TLTA 5L4EA 3TLSA 4ZK4A 3RI5A 5AINA 5AFMB 3JAFA 4ZR6A 2YKSA 3WTNA 3ZDHA 4HQPA 3RIFA 2BYSA 4FRRA 3WTOA 4B5DA 5AFNA 4COFA 2ZJUA 2WNJA 2XZ5A 2YN6A 4TWHA 3UU6A 3LSVA 4HFHA 5SYOA 4HFIA 2BYNA 2Y56A 2Y57A 3ZKRA 4QH4A 2XYTA 2X00A 4A97A 4QACA 1I9BA 5AFLA 5L47A 4ZRUA 5BP0A 2XQ8A 2XQ6A 3RIAA 3UU8A 5HEUA 4AFGA 5AFHA 1UW6A 5HCMA 2X00D 2C9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TLV A;  4TWF A;  4DBM A;  4A98 A;  4ILA A;  5FJV A;  2BG9 A;  3SQ9 A;  5AFJ A;  2WN9 A;  3RQU A;  3UUB A;  4UM3 A;  5HEO A;  3UQ7 A;  3GUA A;  5J5G A;  4WV9 A;  2XQ9 A;  3WTM A;  2XNU A;  2XQ4 A;  3U8L A;  5CO5 A;  3WTI A;  5HEJ A;  3UU5 A;  5J0Z A;  4LMK A;  4ZJT A;  3JAD A;  4HFD A;  5BW2 A;  2XYS A;  2Y7Y A;  3U8N A;  4XK9 A;  4ZZB A;  4IL9 A;  3P50 A;  4QAA A;  4BQT A;  3UU3 A;  2XNV A;  2BJ0 A;  5LXB A;  2QC1 B;  2W8F A;  3U8J A;  4QH1 A;  3EHZ A;  4ILB A;  1UV6 A;  2BYR A;  5L4H A;  2PGZ A;  4TNV A;  2ZJV A;  5KZU A;  2BG9 E;  4ALX A;  2YME A;  2XQ5 A;  3RQW A;  2BR7 A;  4UM1 A;  2XNT A;  4HFC A;  2WNL A;  4ZK1 A;  2VL0 A;  2Y58 A;  3C79 A;  2BR8 A;  4ZZC A;  5J5I A;  2Y54 A;  4TWD A;  3SH1 A;  3U8K A;  5JME A;  2XZ6 A;  5HEH A;  4QH5 A;  3JAE A;  5IUX A;  2WNC A;  4LMJ A;  3T4M A;  3EAM A;  3TLW A;  2BYP A;  3WTJ A;  3EI0 A;  4EZ1 A;  5AFK A;  4IRE A;  3RHW A;  4AFT A;  2YMD A;  5TVC A;  3UQ4 A;  3UU4 A;  3PEO A;  4ILC A;  5LG3 A;  3TLU A;  3U8M A;  4HFB A;  3P4W A;  4IL4 A;  4D01 A;  2W8G A;  2BG9 B;  2BG9 C;  3C84 A;  4HFE A;  3SQ6 A;  4QAB A;  2BYQ A;  4Z90 A;  4UXU A;  1UX2 A;  4X5T A;  3ZDG A;  2XQ3 A;  3IGQ A;  5HEG A;  3WTH A;  3WTL A;  4PIR A;  5AFM A;  5J5H A;  4TNW A;  2WZY A;  5CFB A;  2YOE A;  2XQ7 A;  4ZJS A;  3SIO A;  4UY2 A;  2UZ6 A;  4XHE A;  4Z91 A;  5J5F A;  5BRX A;  5HCJ A;  5KE4 A;  4F8H A;  3PMZ A;  2XQA A;  4LML A;  2PH9 A;  4UM3 P;  4UM3 S;  4AFH A;  3WIP A;  3WTK A;  4BFQ A;  4NPP A;  4NZB A;  3TLT A;  5L4E A;  3TLS A;  4ZK4 A;  3RI5 A;  5AIN A;  5AFM B;  3JAF A;  4ZR6 A;  2YKS A;  3WTN A;  3ZDH A;  4HQP A;  3RIF A;  2BYS A;  4FRR A;  3WTO A;  4B5D A;  5AFN A;  4COF A;  2ZJU A;  2WNJ A;  2XZ5 A;  2YN6 A;  4TWH A;  3UU6 A;  3LSV A;  4HFH A;  5SYO A;  4HFI A;  2BYN A;  2Y56 A;  2Y57 A;  3ZKR A;  4QH4 A;  2XYT A;  2X00 A;  4A97 A;  4QAC A;  1I9B A;  5AFL A;  5L47 A;  4ZRU A;  5BP0 A;  2XQ8 A;  2XQ6 A;  3RIA A;  3UU8 A;  5HEU A;  4AFG A;  5AFH A;  1UW6 A;  5HCM A;  2X00 D;  2C9T A; 
#chains in the Genus database with same CATH topology
 3TLV A;  4TWF A;  4DBM A;  4A98 A;  4ILA A;  5FJV A;  2BG9 A;  3SQ9 A;  5AFJ A;  2WN9 A;  3RQU A;  3UUB A;  4UM3 A;  5HEO A;  3UQ7 A;  3GUA A;  5J5G A;  4WV9 A;  2XQ9 A;  3WTM A;  2XNU A;  2XQ4 A;  3U8L A;  5CO5 A;  3WTI A;  5HEJ A;  3UU5 A;  5J0Z A;  4LMK A;  4ZJT A;  3JAD A;  4HFD A;  5BW2 A;  2XYS A;  2Y7Y A;  3U8N A;  4XK9 A;  4ZZB A;  4IL9 A;  3P50 A;  4QAA A;  4BQT A;  3UU3 A;  2XNV A;  2BJ0 A;  5LXB A;  2QC1 B;  2W8F A;  3U8J A;  4QH1 A;  3EHZ A;  4ILB A;  1UV6 A;  2BYR A;  5L4H A;  2PGZ A;  4TNV A;  2ZJV A;  5KZU A;  2BG9 E;  4ALX A;  2YME A;  2XQ5 A;  3RQW A;  2BR7 A;  4UM1 A;  2XNT A;  4HFC A;  2WNL A;  4ZK1 A;  2VL0 A;  2Y58 A;  3C79 A;  2BR8 A;  4ZZC A;  5J5I A;  2Y54 A;  4TWD A;  3SH1 A;  3U8K A;  5JME A;  2XZ6 A;  5HEH A;  4QH5 A;  3JAE A;  5IUX A;  2WNC A;  4LMJ A;  3T4M A;  3EAM A;  3TLW A;  2BYP A;  3WTJ A;  3EI0 A;  4EZ1 A;  5AFK A;  4IRE A;  3RHW A;  4AFT A;  2YMD A;  5TVC A;  3UQ4 A;  3UU4 A;  3PEO A;  4ILC A;  5LG3 A;  3TLU A;  3U8M A;  4HFB A;  3P4W A;  4IL4 A;  4D01 A;  2W8G A;  2BG9 B;  2BG9 C;  3C84 A;  4HFE A;  3SQ6 A;  4QAB A;  2BYQ A;  4Z90 A;  4UXU A;  1UX2 A;  4X5T A;  3ZDG A;  2XQ3 A;  3IGQ A;  5HEG A;  3WTH A;  3WTL A;  4PIR A;  5AFM A;  5J5H A;  4TNW A;  2WZY A;  5CFB A;  2YOE A;  2XQ7 A;  4ZJS A;  3SIO A;  4UY2 A;  2UZ6 A;  4XHE A;  4Z91 A;  5J5F A;  5BRX A;  5HCJ A;  5KE4 A;  4F8H A;  3PMZ A;  2XQA A;  4LML A;  2PH9 A;  4UM3 P;  4UM3 S;  4AFH A;  3WIP A;  3WTK A;  4BFQ A;  4NPP A;  4NZB A;  3TLT A;  5L4E A;  3TLS A;  4ZK4 A;  3RI5 A;  5AIN A;  5AFM B;  3JAF A;  4ZR6 A;  2YKS A;  3WTN A;  3ZDH A;  4HQP A;  3RIF A;  2BYS A;  4FRR A;  3WTO A;  4B5D A;  5AFN A;  4COF A;  2ZJU A;  2WNJ A;  2XZ5 A;  2YN6 A;  4TWH A;  3UU6 A;  3LSV A;  4HFH A;  5SYO A;  4HFI A;  2BYN A;  2Y56 A;  2Y57 A;  3ZKR A;  4QH4 A;  2XYT A;  2X00 A;  4A97 A;  4QAC A;  1I9B A;  5AFL A;  5L47 A;  4ZRU A;  5BP0 A;  2XQ8 A;  2XQ6 A;  3RIA A;  3UU8 A;  5HEU A;  4AFG A;  5AFH A;  1UW6 A;  5HCM A;  2X00 D;  2C9T A; 
#chains in the Genus database with same CATH homology
 3TLV A;  4TWF A;  4DBM A;  4A98 A;  4ILA A;  5FJV A;  2BG9 A;  3SQ9 A;  5AFJ A;  2WN9 A;  3RQU A;  3UUB A;  4UM3 A;  5HEO A;  3UQ7 A;  3GUA A;  5J5G A;  4WV9 A;  2XQ9 A;  3WTM A;  2XNU A;  2XQ4 A;  3U8L A;  5CO5 A;  3WTI A;  5HEJ A;  3UU5 A;  5J0Z A;  4LMK A;  4ZJT A;  3JAD A;  4HFD A;  5BW2 A;  2XYS A;  2Y7Y A;  3U8N A;  4XK9 A;  4ZZB A;  4IL9 A;  3P50 A;  4QAA A;  4BQT A;  3UU3 A;  2XNV A;  2BJ0 A;  5LXB A;  2QC1 B;  2W8F A;  3U8J A;  4QH1 A;  3EHZ A;  4ILB A;  1UV6 A;  2BYR A;  5L4H A;  2PGZ A;  4TNV A;  2ZJV A;  5KZU A;  2BG9 E;  4ALX A;  2YME A;  2XQ5 A;  3RQW A;  2BR7 A;  4UM1 A;  2XNT A;  4HFC A;  2WNL A;  4ZK1 A;  2VL0 A;  2Y58 A;  3C79 A;  2BR8 A;  4ZZC A;  5J5I A;  2Y54 A;  4TWD A;  3SH1 A;  3U8K A;  5JME A;  2XZ6 A;  5HEH A;  4QH5 A;  3JAE A;  5IUX A;  2WNC A;  4LMJ A;  3T4M A;  3EAM A;  3TLW A;  2BYP A;  3WTJ A;  3EI0 A;  4EZ1 A;  5AFK A;  4IRE A;  3RHW A;  4AFT A;  2YMD A;  5TVC A;  3UQ4 A;  3UU4 A;  3PEO A;  4ILC A;  5LG3 A;  3TLU A;  3U8M A;  4HFB A;  3P4W A;  4IL4 A;  4D01 A;  2W8G A;  2BG9 B;  2BG9 C;  3C84 A;  4HFE A;  3SQ6 A;  4QAB A;  2BYQ A;  4Z90 A;  4UXU A;  1UX2 A;  4X5T A;  3ZDG A;  2XQ3 A;  3IGQ A;  5HEG A;  3WTH A;  3WTL A;  4PIR A;  5AFM A;  5J5H A;  4TNW A;  2WZY A;  5CFB A;  2YOE A;  2XQ7 A;  4ZJS A;  3SIO A;  4UY2 A;  2UZ6 A;  4XHE A;  4Z91 A;  5J5F A;  5BRX A;  5HCJ A;  5KE4 A;  4F8H A;  3PMZ A;  2XQA A;  4LML A;  2PH9 A;  4UM3 P;  4UM3 S;  4AFH A;  3WIP A;  3WTK A;  4BFQ A;  4NPP A;  4NZB A;  3TLT A;  5L4E A;  3TLS A;  4ZK4 A;  3RI5 A;  5AIN A;  5AFM B;  3JAF A;  4ZR6 A;  2YKS A;  3WTN A;  3ZDH A;  4HQP A;  3RIF A;  2BYS A;  4FRR A;  3WTO A;  4B5D A;  5AFN A;  4COF A;  2ZJU A;  2WNJ A;  2XZ5 A;  2YN6 A;  4TWH A;  3UU6 A;  3LSV A;  4HFH A;  5SYO A;  4HFI A;  2BYN A;  2Y56 A;  2Y57 A;  3ZKR A;  4QH4 A;  2XYT A;  2X00 A;  4A97 A;  4QAC A;  1I9B A;  5AFL A;  5L47 A;  4ZRU A;  5BP0 A;  2XQ8 A;  2XQ6 A;  3RIA A;  3UU8 A;  5HEU A;  4AFG A;  5AFH A;  1UW6 A;  5HCM A;  2X00 D;  2C9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...