5AFNA

Alpha7-achbp in complex with lobeline and fragment 5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
205
structure length
205
Chain Sequence
b'GEFQRKLYKELVKNYNPDVIPTQRDRPVTVYFSLSLLQIMDVDEKNQVVDVVFWLQMSWTDHYLQWNVSEYPGVKQVSVPISSLWVPDLAAYNAISKPEVLTPQLALVNSSGHVQYLPSIRQRFSCDVSGVDTESGATCKLKFGSWTHHSRELDLQMQEADISGYIPYSRFELVGVTQKRSERFYECCKEPYPDVTFTVTFRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE-BINDING PROTEIN, NEURONAL ACETYLCHOLINE RECEPT
publication title Molecular Blueprint of Allosteric Binding Sites in a Homologue of the Agonist-Binding Domain of the Alpha7 Nicotinic Acetylcholine Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 46
structure length 205
sequence length 205
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-01-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5afnA00
3EI0A 2WNJA 5J0ZA 2BYSA 3C79A 4QABA 5HEHA 4LMKA 4NPPA 5CO5A 2W8FA 4TWDA 2X00D 2BYRA 4ZRUA 3ZKRA 3TLUA 4BQTA 2X00A 4UM1A 3WTJA 3WTHA 5AFLA 4TWFA 3TLSA 4HFIA 4TWHA 2XQ4A 3RHWA 3RQWA 1I9BA 3WTLA 2YKSA 5HCMA 4ZZBA 3TLVA 4IL4A 3ZDHA 5JMEA 2BYNA 2Y57A 4Z91A 4XHEA 4HFHA 4IREA 2XQAA 3RIFA 5KZUA 3WTNA 3IGQA 4WV9A 2PH9A 3RIAA 3RQUA 5J5HA 2C9TA 4D01A 3SIOA 5BW2A 4Z90A 4AFTA 2BJ0A 2XNVA 2BR7A 3U8NA 5AFKA 2XZ6A 4HFEA 4UXUA 4HFBA 3T4MA 1UX2A 2VL0A 2XQ6A 3UU3A 2XNTA 2BG9C 4UM3A 5SYOA 4QH5A 5BP0A 4EZ1A 1UW6A 5L47A 5J5FA 2YMEA 2Y58A 2BG9A 3JAFA 4QACA 3UU4A 3P4WA 2YOEA 4QH4A 3GUAA 5HEGA 4BFQA 2BG9E 4X5TA 2BG9B 2XQ7A 4UM3P 3RI5A 3UU8A 5AFMA 2XQ5A 4DBMA 4TNWA 5J5GA 5AFNA 2W8GA 3JAEA 5L4HA 4ILAA 3UQ4A 5AFMB 5L4EA 4F8HA 4LMLA 4ZJTA 3PEOA 5HCJA 4QAAA 3C84A 4AFHA 5LXBA 4B5DA 3UUBA 4PIRA 2XYSA 1UV6A 2YMDA 4LMJA 3TLWA 3WTOA 2XQ3A 4ALXA 2XQ8A 5HEUA 3EAMA 3WTMA 3U8JA 3U8LA 5IUXA 4ZK1A 4QH1A 3UU5A 5BRXA 2Y54A 4ILBA 3U8MA 3P50A 4FRRA 5TVCA 4ILCA 4ZR6A 2XZ5A 3WIPA 2QC1B 3EHZA 4XK9A 4ZJSA 2BYQA 2Y56A 4HQPA 2WZYA 2XNUA 2ZJVA 4TNVA 2WNLA 2BR8A 4ZK4A 3JADA 4UM3S 4COFA 5LG3A 3SH1A 4AFGA 5AFJA 4ZZCA 4A98A 4HFDA 3UU6A 4A97A 5KE4A 5HEOA 5FJVA 3PMZA 2XQ9A 2WNCA 4NZBA 3TLTA 2YN6A 3LSVA 2XYTA 5CFBA 3WTIA 4HFCA 4IL9A 2Y7YA 4UY2A 3U8KA 2BYPA 2PGZA 2ZJUA 3SQ9A 5AINA 3ZDGA 2UZ6A 2WN9A 5HEJA 5AFHA 3UQ7A 3SQ6A 3WTKA 5J5IA
chains in the Genus database with same CATH superfamily
3EI0A 2WNJA 5J0ZA 2BYSA 3C79A 4QABA 5HEHA 4LMKA 4NPPA 5CO5A 2W8FA 4TWDA 2X00D 2BYRA 4ZRUA 3ZKRA 3TLUA 4BQTA 2X00A 4UM1A 3WTJA 3WTHA 5AFLA 4TWFA 3TLSA 4HFIA 4TWHA 2XQ4A 3RHWA 3RQWA 1I9BA 3WTLA 2YKSA 5HCMA 4ZZBA 3TLVA 4IL4A 3ZDHA 5JMEA 2BYNA 2Y57A 4Z91A 4XHEA 4HFHA 4IREA 2XQAA 3RIFA 5KZUA 3WTNA 3IGQA 4WV9A 2PH9A 3RIAA 3RQUA 5J5HA 2C9TA 4D01A 3SIOA 5BW2A 4Z90A 4AFTA 2BJ0A 2XNVA 2BR7A 3U8NA 5AFKA 2XZ6A 4HFEA 4UXUA 4HFBA 3T4MA 1UX2A 2VL0A 2XQ6A 3UU3A 2XNTA 2BG9C 4UM3A 5SYOA 4QH5A 5BP0A 4EZ1A 1UW6A 5L47A 5J5FA 2YMEA 2Y58A 2BG9A 3JAFA 4QACA 3UU4A 3P4WA 2YOEA 4QH4A 3GUAA 5HEGA 4BFQA 2BG9E 4X5TA 2BG9B 2XQ7A 4UM3P 3RI5A 3UU8A 5AFMA 2XQ5A 4DBMA 4TNWA 5J5GA 5AFNA 2W8GA 3JAEA 5L4HA 4ILAA 3UQ4A 5AFMB 5L4EA 4F8HA 4LMLA 4ZJTA 3PEOA 5HCJA 4QAAA 3C84A 4AFHA 5LXBA 4B5DA 3UUBA 4PIRA 2XYSA 1UV6A 2YMDA 4LMJA 3TLWA 3WTOA 2XQ3A 4ALXA 2XQ8A 5HEUA 3EAMA 3WTMA 3U8JA 3U8LA 5IUXA 4ZK1A 4QH1A 3UU5A 5BRXA 2Y54A 4ILBA 3U8MA 3P50A 4FRRA 5TVCA 4ILCA 4ZR6A 2XZ5A 3WIPA 2QC1B 3EHZA 4XK9A 4ZJSA 2BYQA 2Y56A 4HQPA 2WZYA 2XNUA 2ZJVA 4TNVA 2WNLA 2BR8A 4ZK4A 3JADA 4UM3S 4COFA 5LG3A 3SH1A 4AFGA 5AFJA 4ZZCA 4A98A 4HFDA 3UU6A 4A97A 5KE4A 5HEOA 5FJVA 3PMZA 2XQ9A 2WNCA 4NZBA 3TLTA 2YN6A 3LSVA 2XYTA 5CFBA 3WTIA 4HFCA 4IL9A 2Y7YA 4UY2A 3U8KA 2BYPA 2PGZA 2ZJUA 3SQ9A 5AINA 3ZDGA 2UZ6A 2WN9A 5HEJA 5AFHA 3UQ7A 3SQ6A 3WTKA 5J5IA
chains in the Genus database with same CATH topology
3EI0A 2WNJA 5J0ZA 2BYSA 3C79A 4QABA 5HEHA 4LMKA 4NPPA 5CO5A 2W8FA 4TWDA 2X00D 2BYRA 4ZRUA 3ZKRA 3TLUA 4BQTA 2X00A 4UM1A 3WTJA 3WTHA 5AFLA 4TWFA 3TLSA 4HFIA 4TWHA 2XQ4A 3RHWA 3RQWA 1I9BA 3WTLA 2YKSA 5HCMA 4ZZBA 3TLVA 4IL4A 3ZDHA 5JMEA 2BYNA 2Y57A 4Z91A 4XHEA 4HFHA 4IREA 2XQAA 3RIFA 5KZUA 3WTNA 3IGQA 4WV9A 2PH9A 3RIAA 3RQUA 5J5HA 2C9TA 4D01A 3SIOA 5BW2A 4Z90A 4AFTA 2BJ0A 2XNVA 2BR7A 3U8NA 5AFKA 2XZ6A 4HFEA 4UXUA 4HFBA 3T4MA 1UX2A 2VL0A 2XQ6A 3UU3A 2XNTA 2BG9C 4UM3A 5SYOA 4QH5A 5BP0A 4EZ1A 1UW6A 5L47A 5J5FA 2YMEA 2Y58A 2BG9A 3JAFA 4QACA 3UU4A 3P4WA 2YOEA 4QH4A 3GUAA 5HEGA 4BFQA 2BG9E 4X5TA 2BG9B 2XQ7A 4UM3P 3RI5A 3UU8A 5AFMA 2XQ5A 4DBMA 4TNWA 5J5GA 5AFNA 2W8GA 3JAEA 5L4HA 4ILAA 3UQ4A 5AFMB 5L4EA 4F8HA 4LMLA 4ZJTA 3PEOA 5HCJA 4QAAA 3C84A 4AFHA 5LXBA 4B5DA 3UUBA 4PIRA 2XYSA 1UV6A 2YMDA 4LMJA 3TLWA 3WTOA 2XQ3A 4ALXA 2XQ8A 5HEUA 3EAMA 3WTMA 3U8JA 3U8LA 5IUXA 4ZK1A 4QH1A 3UU5A 5BRXA 2Y54A 4ILBA 3U8MA 3P50A 4FRRA 5TVCA 4ILCA 4ZR6A 2XZ5A 3WIPA 2QC1B 3EHZA 4XK9A 4ZJSA 2BYQA 2Y56A 4HQPA 2WZYA 2XNUA 2ZJVA 4TNVA 2WNLA 2BR8A 4ZK4A 3JADA 4UM3S 4COFA 5LG3A 3SH1A 4AFGA 5AFJA 4ZZCA 4A98A 4HFDA 3UU6A 4A97A 5KE4A 5HEOA 5FJVA 3PMZA 2XQ9A 2WNCA 4NZBA 3TLTA 2YN6A 3LSVA 2XYTA 5CFBA 3WTIA 4HFCA 4IL9A 2Y7YA 4UY2A 3U8KA 2BYPA 2PGZA 2ZJUA 3SQ9A 5AINA 3ZDGA 2UZ6A 2WN9A 5HEJA 5AFHA 3UQ7A 3SQ6A 3WTKA 5J5IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI0 A;  2WNJ A;  5J0Z A;  2BYS A;  3C79 A;  4QAB A;  5HEH A;  4LMK A;  4NPP A;  5CO5 A;  2W8F A;  4TWD A;  2X00 D;  2BYR A;  4ZRU A;  3ZKR A;  3TLU A;  4BQT A;  2X00 A;  4UM1 A;  3WTJ A;  3WTH A;  5AFL A;  4TWF A;  3TLS A;  4HFI A;  4TWH A;  2XQ4 A;  3RHW A;  3RQW A;  1I9B A;  3WTL A;  2YKS A;  5HCM A;  4ZZB A;  3TLV A;  4IL4 A;  3ZDH A;  5JME A;  2BYN A;  2Y57 A;  4Z91 A;  4XHE A;  4HFH A;  4IRE A;  2XQA A;  3RIF A;  5KZU A;  3WTN A;  3IGQ A;  4WV9 A;  2PH9 A;  3RIA A;  3RQU A;  5J5H A;  2C9T A;  4D01 A;  3SIO A;  5BW2 A;  4Z90 A;  4AFT A;  2BJ0 A;  2XNV A;  2BR7 A;  3U8N A;  5AFK A;  2XZ6 A;  4HFE A;  4UXU A;  4HFB A;  3T4M A;  1UX2 A;  2VL0 A;  2XQ6 A;  3UU3 A;  2XNT A;  2BG9 C;  4UM3 A;  5SYO A;  4QH5 A;  5BP0 A;  4EZ1 A;  1UW6 A;  5L47 A;  5J5F A;  2YME A;  2Y58 A;  2BG9 A;  3JAF A;  4QAC A;  3UU4 A;  3P4W A;  2YOE A;  4QH4 A;  3GUA A;  5HEG A;  4BFQ A;  2BG9 E;  4X5T A;  2BG9 B;  2XQ7 A;  4UM3 P;  3RI5 A;  3UU8 A;  5AFM A;  2XQ5 A;  4DBM A;  4TNW A;  5J5G A;  5AFN A;  2W8G A;  3JAE A;  5L4H A;  4ILA A;  3UQ4 A;  5AFM B;  5L4E A;  4F8H A;  4LML A;  4ZJT A;  3PEO A;  5HCJ A;  4QAA A;  3C84 A;  4AFH A;  5LXB A;  4B5D A;  3UUB A;  4PIR A;  2XYS A;  1UV6 A;  2YMD A;  4LMJ A;  3TLW A;  3WTO A;  2XQ3 A;  4ALX A;  2XQ8 A;  5HEU A;  3EAM A;  3WTM A;  3U8J A;  3U8L A;  5IUX A;  4ZK1 A;  4QH1 A;  3UU5 A;  5BRX A;  2Y54 A;  4ILB A;  3U8M A;  3P50 A;  4FRR A;  5TVC A;  4ILC A;  4ZR6 A;  2XZ5 A;  3WIP A;  2QC1 B;  3EHZ A;  4XK9 A;  4ZJS A;  2BYQ A;  2Y56 A;  4HQP A;  2WZY A;  2XNU A;  2ZJV A;  4TNV A;  2WNL A;  2BR8 A;  4ZK4 A;  3JAD A;  4UM3 S;  4COF A;  5LG3 A;  3SH1 A;  4AFG A;  5AFJ A;  4ZZC A;  4A98 A;  4HFD A;  3UU6 A;  4A97 A;  5KE4 A;  5HEO A;  5FJV A;  3PMZ A;  2XQ9 A;  2WNC A;  4NZB A;  3TLT A;  2YN6 A;  3LSV A;  2XYT A;  5CFB A;  3WTI A;  4HFC A;  4IL9 A;  2Y7Y A;  4UY2 A;  3U8K A;  2BYP A;  2PGZ A;  2ZJU A;  3SQ9 A;  5AIN A;  3ZDG A;  2UZ6 A;  2WN9 A;  5HEJ A;  5AFH A;  3UQ7 A;  3SQ6 A;  3WTK A;  5J5I A; 
#chains in the Genus database with same CATH topology
 3EI0 A;  2WNJ A;  5J0Z A;  2BYS A;  3C79 A;  4QAB A;  5HEH A;  4LMK A;  4NPP A;  5CO5 A;  2W8F A;  4TWD A;  2X00 D;  2BYR A;  4ZRU A;  3ZKR A;  3TLU A;  4BQT A;  2X00 A;  4UM1 A;  3WTJ A;  3WTH A;  5AFL A;  4TWF A;  3TLS A;  4HFI A;  4TWH A;  2XQ4 A;  3RHW A;  3RQW A;  1I9B A;  3WTL A;  2YKS A;  5HCM A;  4ZZB A;  3TLV A;  4IL4 A;  3ZDH A;  5JME A;  2BYN A;  2Y57 A;  4Z91 A;  4XHE A;  4HFH A;  4IRE A;  2XQA A;  3RIF A;  5KZU A;  3WTN A;  3IGQ A;  4WV9 A;  2PH9 A;  3RIA A;  3RQU A;  5J5H A;  2C9T A;  4D01 A;  3SIO A;  5BW2 A;  4Z90 A;  4AFT A;  2BJ0 A;  2XNV A;  2BR7 A;  3U8N A;  5AFK A;  2XZ6 A;  4HFE A;  4UXU A;  4HFB A;  3T4M A;  1UX2 A;  2VL0 A;  2XQ6 A;  3UU3 A;  2XNT A;  2BG9 C;  4UM3 A;  5SYO A;  4QH5 A;  5BP0 A;  4EZ1 A;  1UW6 A;  5L47 A;  5J5F A;  2YME A;  2Y58 A;  2BG9 A;  3JAF A;  4QAC A;  3UU4 A;  3P4W A;  2YOE A;  4QH4 A;  3GUA A;  5HEG A;  4BFQ A;  2BG9 E;  4X5T A;  2BG9 B;  2XQ7 A;  4UM3 P;  3RI5 A;  3UU8 A;  5AFM A;  2XQ5 A;  4DBM A;  4TNW A;  5J5G A;  5AFN A;  2W8G A;  3JAE A;  5L4H A;  4ILA A;  3UQ4 A;  5AFM B;  5L4E A;  4F8H A;  4LML A;  4ZJT A;  3PEO A;  5HCJ A;  4QAA A;  3C84 A;  4AFH A;  5LXB A;  4B5D A;  3UUB A;  4PIR A;  2XYS A;  1UV6 A;  2YMD A;  4LMJ A;  3TLW A;  3WTO A;  2XQ3 A;  4ALX A;  2XQ8 A;  5HEU A;  3EAM A;  3WTM A;  3U8J A;  3U8L A;  5IUX A;  4ZK1 A;  4QH1 A;  3UU5 A;  5BRX A;  2Y54 A;  4ILB A;  3U8M A;  3P50 A;  4FRR A;  5TVC A;  4ILC A;  4ZR6 A;  2XZ5 A;  3WIP A;  2QC1 B;  3EHZ A;  4XK9 A;  4ZJS A;  2BYQ A;  2Y56 A;  4HQP A;  2WZY A;  2XNU A;  2ZJV A;  4TNV A;  2WNL A;  2BR8 A;  4ZK4 A;  3JAD A;  4UM3 S;  4COF A;  5LG3 A;  3SH1 A;  4AFG A;  5AFJ A;  4ZZC A;  4A98 A;  4HFD A;  3UU6 A;  4A97 A;  5KE4 A;  5HEO A;  5FJV A;  3PMZ A;  2XQ9 A;  2WNC A;  4NZB A;  3TLT A;  2YN6 A;  3LSV A;  2XYT A;  5CFB A;  3WTI A;  4HFC A;  4IL9 A;  2Y7Y A;  4UY2 A;  3U8K A;  2BYP A;  2PGZ A;  2ZJU A;  3SQ9 A;  5AIN A;  3ZDG A;  2UZ6 A;  2WN9 A;  5HEJ A;  5AFH A;  3UQ7 A;  3SQ6 A;  3WTK A;  5J5I A; 
#chains in the Genus database with same CATH homology
 3EI0 A;  2WNJ A;  5J0Z A;  2BYS A;  3C79 A;  4QAB A;  5HEH A;  4LMK A;  4NPP A;  5CO5 A;  2W8F A;  4TWD A;  2X00 D;  2BYR A;  4ZRU A;  3ZKR A;  3TLU A;  4BQT A;  2X00 A;  4UM1 A;  3WTJ A;  3WTH A;  5AFL A;  4TWF A;  3TLS A;  4HFI A;  4TWH A;  2XQ4 A;  3RHW A;  3RQW A;  1I9B A;  3WTL A;  2YKS A;  5HCM A;  4ZZB A;  3TLV A;  4IL4 A;  3ZDH A;  5JME A;  2BYN A;  2Y57 A;  4Z91 A;  4XHE A;  4HFH A;  4IRE A;  2XQA A;  3RIF A;  5KZU A;  3WTN A;  3IGQ A;  4WV9 A;  2PH9 A;  3RIA A;  3RQU A;  5J5H A;  2C9T A;  4D01 A;  3SIO A;  5BW2 A;  4Z90 A;  4AFT A;  2BJ0 A;  2XNV A;  2BR7 A;  3U8N A;  5AFK A;  2XZ6 A;  4HFE A;  4UXU A;  4HFB A;  3T4M A;  1UX2 A;  2VL0 A;  2XQ6 A;  3UU3 A;  2XNT A;  2BG9 C;  4UM3 A;  5SYO A;  4QH5 A;  5BP0 A;  4EZ1 A;  1UW6 A;  5L47 A;  5J5F A;  2YME A;  2Y58 A;  2BG9 A;  3JAF A;  4QAC A;  3UU4 A;  3P4W A;  2YOE A;  4QH4 A;  3GUA A;  5HEG A;  4BFQ A;  2BG9 E;  4X5T A;  2BG9 B;  2XQ7 A;  4UM3 P;  3RI5 A;  3UU8 A;  5AFM A;  2XQ5 A;  4DBM A;  4TNW A;  5J5G A;  5AFN A;  2W8G A;  3JAE A;  5L4H A;  4ILA A;  3UQ4 A;  5AFM B;  5L4E A;  4F8H A;  4LML A;  4ZJT A;  3PEO A;  5HCJ A;  4QAA A;  3C84 A;  4AFH A;  5LXB A;  4B5D A;  3UUB A;  4PIR A;  2XYS A;  1UV6 A;  2YMD A;  4LMJ A;  3TLW A;  3WTO A;  2XQ3 A;  4ALX A;  2XQ8 A;  5HEU A;  3EAM A;  3WTM A;  3U8J A;  3U8L A;  5IUX A;  4ZK1 A;  4QH1 A;  3UU5 A;  5BRX A;  2Y54 A;  4ILB A;  3U8M A;  3P50 A;  4FRR A;  5TVC A;  4ILC A;  4ZR6 A;  2XZ5 A;  3WIP A;  2QC1 B;  3EHZ A;  4XK9 A;  4ZJS A;  2BYQ A;  2Y56 A;  4HQP A;  2WZY A;  2XNU A;  2ZJV A;  4TNV A;  2WNL A;  2BR8 A;  4ZK4 A;  3JAD A;  4UM3 S;  4COF A;  5LG3 A;  3SH1 A;  4AFG A;  5AFJ A;  4ZZC A;  4A98 A;  4HFD A;  3UU6 A;  4A97 A;  5KE4 A;  5HEO A;  5FJV A;  3PMZ A;  2XQ9 A;  2WNC A;  4NZB A;  3TLT A;  2YN6 A;  3LSV A;  2XYT A;  5CFB A;  3WTI A;  4HFC A;  4IL9 A;  2Y7Y A;  4UY2 A;  3U8K A;  2BYP A;  2PGZ A;  2ZJU A;  3SQ9 A;  5AIN A;  3ZDG A;  2UZ6 A;  2WN9 A;  5HEJ A;  5AFH A;  3UQ7 A;  3SQ6 A;  3WTK A;  5J5I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...