5AFUU

Cryo-em structure of dynein tail-dynactin-bicd2n complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
168
structure length
168
Chain Sequence
PGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEKPMIIGTNNVFEVGCYSQAMKMGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPTLQLDFLMKILPNYHHLKKTMKGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Dynactin Complex and its Interaction with Dynein.
pubmed doi rcsb
molecule keywords DYNEIN TAIL
molecule tags Motor protein
total genus 33
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 2015-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5afuU00
1J2ZA 3GVDA 4E1KA 4HURA 1KQAA 1Z90A 2QIAA 5E3RA 1QRMA 3VBNA 4EGGA 2WLFA 3IXCA 5E3PA 1HV9A 3ECTA 1MR7A 4HZDA 1MRLA 4KNRA 3MC4A 2W0VA 1MR9A 2V0JA 3HJJA 1KK4A 4M99A 5AFUV 1QRLA 1OCXA 3JQYA 3OUPA 4IHFA 5DEMA 2OI6A 3GOSA 3PMOA 3P1BA 3R3RA 2QIVX 1KRVA 4G87A 1V3WA 2AQ9A 2WLGA 3FWWA 1YP3A 2XATA 3KWDA 2I5KA 3DK5A 3R2WA 4KNXA 4KPZA 3R3IA 1HM9A 4AA7A 3ST8A 4HUSA 4E6TA 4AC3A 5F42A 4MFGA 3Q1XA 3T57A 3BSSA 1FXJA 4ISXA 1HM0A 4J09A 1SSQA 4EA9A 3BRKX 3R5BA 4FCEA 3FS8A 2V0LA 3DJ4A 3R8YA 2NPOA 1YP4A 2WLCA 2RIJA 3BSWA 3CJ8A 1KGTA 1SSTA 2IC7A 3TDTA 3VBMA 5AFUU 2W0WA 4N27A 3VBJA 2VHEA 2V0HA 3D98A 2WLDA 2JF3A 4N6AA 1G97A 2VD4A 1XHDA 2P2OA 4G3SA 3TK8A 1KK5A 5ADXV 1FWYA 3DHOA 3TWDA 3KWEA 2IUAA 2TDTA 1S80A 3OTZA 4MZUA 4E75A 2OI5A 4N69A 4R7PA 2IU8A 3OTMA 4M28A 1KK6A 3VBPA 3HSQA 4IHGA 4EAAA 3TV0A 4M98A 3TIOA 3EG4A 3GUEA 1LXAA 3TISA 5L6SA 3R5CA 2GGQA 4E79A 1KRRA 3FSYA 4EA7A 2V0IA 4KQLA 3SRTA 2GGOA 1XATA 1KGQA 3R0SA 1V67A 4R37A 5ADXU 3EH0A 4EA8A 1QRFA 2JF2A 1KRUA 1KHRA 5U2KA 2IU9A 3BXYA 4MYOA 3VBIA 3OW5A 3F1XA 3FTTA 3OU9A 3R1WA 4N6BA 5L6VA 2QKXA 2ICXA 3SPTA 4E6UA 2FKOA 2OEGA 4H7OA 3FOQA 5E3QA 3NZ2A 3P47A 5DG3A 3D8VA 4M9CA 3I3AA 2ICYA 1SSMA 3FSXA 3MQHA 1HM8A 1YP2A 4HCQA 3MQGA 3C8VA 3I3XA 3KWCA 4EABA 2WLEA 4K6RA 4J18A 4AAWA 1T3DA 2V0KA 3R5DA 4G3QA 4DCLA 1THJA 1QREA 3VBKA 1QRGA 3IGJA 4M2BA 4HZCA 1QQ0A 3BSYA 3R5AA 4KPXA 4EQYA 3FSCA 3VNPA 4M2AA 1G95A 1TDTA 2OEFA 2OI7A 4IHHA 3BFPA 4R36A 3EEVA 4G3PA 5DEPA 3VBLA 3V4EA 2Q4JA 3FSBA
chains in the Genus database with same CATH superfamily
1J2ZA 3GVDA 4E1KA 4HURA 1KQAA 1Z90A 2QIAA 5E3RA 1QRMA 3VBNA 4EGGA 2WLFA 3IXCA 5E3PA 1HV9A 3ECTA 1MR7A 4HZDA 1MRLA 1L0SA 3OH0A 3MC4A 2W0VA 4KNRA 1MR9A 2V0JA 3HJJA 1KK4A 4M99A 5AFUV 1QRLA 1OCXA 3JQYA 3OUPA 4IHFA 5DEMA 2OI6A 3GOSA 3PMOA 3P1BA 3R3RA 2QIVX 3OH4A 1KRVA 4G87A 4KPZA 1V3WA 1M8NA 2AQ9A 2WLGA 3FWWA 1YP3A 2XATA 3GQ9A 2I5KA 3DK5A 3KWDA 3R2WA 4KNXA 3R3IA 1HM9A 4AA7A 3ST8A 4HUSA 4E6TA 4AC3A 5F42A 4MFGA 3Q1XA 3T57A 3BSSA 1FXJA 4ISXA 1HM0A 4J09A 3OH2A 1SSQA 4EA9A 3BRKX 3R5BA 4FCEA 3FS8A 2V0LA 3DJ4A 3R8YA 2NPOA 1YP4A 2WLCA 2RIJA 3BSWA 3CJ8A 1KGTA 1SSTA 2IC7A 3TDTA 3VBMA 5AFUU 2W0WA 4N27A 3VBJA 2VHEA 2V0HA 3D98A 2WLDA 2JF3A 4N6AA 1G97A 2VD4A 1XHDA 2P2OA 4G3SA 3TK8A 1KK5A 3OGZA 5ADXV 1FWYA 3DHOA 3TWDA 3KWEA 2IUAA 2TDTA 1S80A 3OTZA 4MZUA 4E75A 2OI5A 4N69A 4R7PA 2IU8A 3OTMA 4M28A 1KK6A 3VBPA 3HSQA 4IHGA 4EAAA 3TV0A 4M98A 3TIOA 3EG4A 3GUEA 1LXAA 3TISA 5L6SA 3R5CA 3OH3A 2GGQA 4E79A 1KRRA 3FSYA 3OH1A 4EA7A 2V0IA 4KQLA 3SRTA 2GGOA 1XATA 1KGQA 3R0SA 1V67A 4R37A 5ADXU 3EH0A 4EA8A 1QRFA 2JF2A 1KRUA 1KHRA 1Z2FA 5U2KA 2IU9A 3BXYA 4MYOA 3VBIA 1N4IA 3F1XA 3FTTA 3OU9A 3OW5A 3R1WA 4N6BA 5L6VA 2QKXA 2ICXA 3SPTA 4E6UA 2FKOA 2OEGA 4H7OA 3FOQA 5E3QA 3SUCA 3NZ2A 3P47A 5DG3A 3D8VA 4M9CA 3I3AA 2ICYA 1SSMA 3FSXA 3MQHA 1HM8A 1YP2A 3GQAA 3MQGA 4HCQA 3C8VA 3I3XA 3KWCA 4EABA 2WLEA 4K6RA 4J18A 4AAWA 1T3DA 2V0KA 3R5DA 1EWWA 4G3QA 4DCLA 1THJA 1QREA 3VBKA 3GQ8A 1QRGA 3IGJA 4M2BA 4HZCA 1QQ0A 3BSYA 3R5AA 4KPXA 4EQYA 3FSCA 3VNPA 4M2AA 1G95A 1TDTA 2OEFA 2OI7A 4IHHA 3BFPA 4R36A 3EEVA 4G3PA 5DEPA 3VBLA 3V4EA 2Q4JA 3FSBA 3GQ7A
chains in the Genus database with same CATH topology
1J2ZA 3GVDA 4E1KA 4HURA 1KQAA 1Z90A 2QIAA 5E3RA 1QRMA 3VBNA 4EGGA 2WLFA 3IXCA 5E3PA 1HV9A 3ECTA 1MR7A 4HZDA 1MRLA 4KNRA 3MC4A 2W0VA 1MR9A 2V0JA 3HJJA 1KK4A 4M99A 5AFUV 1QRLA 1OCXA 3JQYA 3OUPA 4IHFA 5DEMA 2OI6A 3GOSA 3PMOA 3P1BA 3R3RA 2QIVX 1KRVA 4G87A 1V3WA 2AQ9A 2WLGA 3FWWA 1YP3A 2XATA 3KWDA 2I5KA 3DK5A 3R2WA 4KNXA 4KPZA 3R3IA 1HM9A 4AA7A 3ST8A 4HUSA 4E6TA 4AC3A 5F42A 4MFGA 3Q1XA 3T57A 3BSSA 1FXJA 4ISXA 1HM0A 4J09A 1SSQA 4EA9A 3BRKX 3R5BA 4FCEA 3FS8A 2V0LA 3DJ4A 3R8YA 2NPOA 1YP4A 2WLCA 2RIJA 3BSWA 3CJ8A 1KGTA 1SSTA 2IC7A 3TDTA 3VBMA 5AFUU 2W0WA 4N27A 3VBJA 2VHEA 2V0HA 3D98A 2WLDA 2JF3A 4N6AA 1G97A 2VD4A 1XHDA 2P2OA 4G3SA 3TK8A 1KK5A 5ADXV 1FWYA 3DHOA 3TWDA 3KWEA 2IUAA 2TDTA 1S80A 3OTZA 4MZUA 4E75A 2OI5A 4N69A 4R7PA 2IU8A 3OTMA 4M28A 1KK6A 3VBPA 3HSQA 4IHGA 4EAAA 3TV0A 4M98A 3TIOA 3EG4A 3GUEA 1LXAA 3TISA 5L6SA 3R5CA 2GGQA 4E79A 1KRRA 3FSYA 4EA7A 2V0IA 4KQLA 3SRTA 2GGOA 1XATA 1KGQA 3R0SA 1V67A 4R37A 5ADXU 3EH0A 4EA8A 1QRFA 2JF2A 1KRUA 1KHRA 5U2KA 2IU9A 3BXYA 4MYOA 3VBIA 3OW5A 3F1XA 3FTTA 3OU9A 3R1WA 4N6BA 5L6VA 2QKXA 2ICXA 3SPTA 4E6UA 2FKOA 2OEGA 4H7OA 3FOQA 5E3QA 3NZ2A 3P47A 5DG3A 3D8VA 4M9CA 3I3AA 2ICYA 1SSMA 3FSXA 3MQHA 1HM8A 1YP2A 4HCQA 3MQGA 3C8VA 3I3XA 3KWCA 4EABA 2WLEA 4K6RA 4J18A 4AAWA 1T3DA 2V0KA 3R5DA 4G3QA 4DCLA 1THJA 1QREA 3VBKA 1QRGA 3IGJA 4M2BA 4HZCA 1QQ0A 3BSYA 3R5AA 4KPXA 4EQYA 3FSCA 3VNPA 4M2AA 1G95A 1TDTA 2OEFA 2OI7A 4IHHA 3BFPA 4R36A 3EEVA 4G3PA 5DEPA 3VBLA 3V4EA 2Q4JA 3FSBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J2Z A;  3GVD A;  4E1K A;  4HUR A;  1KQA A;  1Z90 A;  2QIA A;  5E3R A;  1QRM A;  3VBN A;  4EGG A;  2WLF A;  3IXC A;  5E3P A;  1HV9 A;  3ECT A;  1MR7 A;  4HZD A;  1MRL A;  4KNR A;  3MC4 A;  2W0V A;  1MR9 A;  2V0J A;  3HJJ A;  1KK4 A;  4M99 A;  5AFU V;  1QRL A;  1OCX A;  3JQY A;  3OUP A;  4IHF A;  5DEM A;  2OI6 A;  3GOS A;  3PMO A;  3P1B A;  3R3R A;  2QIV X;  1KRV A;  4G87 A;  1V3W A;  2AQ9 A;  2WLG A;  3FWW A;  1YP3 A;  2XAT A;  3KWD A;  2I5K A;  3DK5 A;  3R2W A;  4KNX A;  4KPZ A;  3R3I A;  1HM9 A;  4AA7 A;  3ST8 A;  4HUS A;  4E6T A;  4AC3 A;  5F42 A;  4MFG A;  3Q1X A;  3T57 A;  3BSS A;  1FXJ A;  4ISX A;  1HM0 A;  4J09 A;  1SSQ A;  4EA9 A;  3BRK X;  3R5B A;  4FCE A;  3FS8 A;  2V0L A;  3DJ4 A;  3R8Y A;  2NPO A;  1YP4 A;  2WLC A;  2RIJ A;  3BSW A;  3CJ8 A;  1KGT A;  1SST A;  2IC7 A;  3TDT A;  3VBM A;  5AFU U;  2W0W A;  4N27 A;  3VBJ A;  2VHE A;  2V0H A;  3D98 A;  2WLD A;  2JF3 A;  4N6A A;  1G97 A;  2VD4 A;  1XHD A;  2P2O A;  4G3S A;  3TK8 A;  1KK5 A;  5ADX V;  1FWY A;  3DHO A;  3TWD A;  3KWE A;  2IUA A;  2TDT A;  1S80 A;  3OTZ A;  4MZU A;  4E75 A;  2OI5 A;  4N69 A;  4R7P A;  2IU8 A;  3OTM A;  4M28 A;  1KK6 A;  3VBP A;  3HSQ A;  4IHG A;  4EAA A;  3TV0 A;  4M98 A;  3TIO A;  3EG4 A;  3GUE A;  1LXA A;  3TIS A;  5L6S A;  3R5C A;  2GGQ A;  4E79 A;  1KRR A;  3FSY A;  4EA7 A;  2V0I A;  4KQL A;  3SRT A;  2GGO A;  1XAT A;  1KGQ A;  3R0S A;  1V67 A;  4R37 A;  5ADX U;  3EH0 A;  4EA8 A;  1QRF A;  2JF2 A;  1KRU A;  1KHR A;  5U2K A;  2IU9 A;  3BXY A;  4MYO A;  3VBI A;  3OW5 A;  3F1X A;  3FTT A;  3OU9 A;  3R1W A;  4N6B A;  5L6V A;  2QKX A;  2ICX A;  3SPT A;  4E6U A;  2FKO A;  2OEG A;  4H7O A;  3FOQ A;  5E3Q A;  3NZ2 A;  3P47 A;  5DG3 A;  3D8V A;  4M9C A;  3I3A A;  2ICY A;  1SSM A;  3FSX A;  3MQH A;  1HM8 A;  1YP2 A;  4HCQ A;  3MQG A;  3C8V A;  3I3X A;  3KWC A;  4EAB A;  2WLE A;  4K6R A;  4J18 A;  4AAW A;  1T3D A;  2V0K A;  3R5D A;  4G3Q A;  4DCL A;  1THJ A;  1QRE A;  3VBK A;  1QRG A;  3IGJ A;  4M2B A;  4HZC A;  1QQ0 A;  3BSY A;  3R5A A;  4KPX A;  4EQY A;  3FSC A;  3VNP A;  4M2A A;  1G95 A;  1TDT A;  2OEF A;  2OI7 A;  4IHH A;  3BFP A;  4R36 A;  3EEV A;  4G3P A;  5DEP A;  3VBL A;  3V4E A;  2Q4J A;  3FSB A; 
#chains in the Genus database with same CATH topology
 1J2Z A;  3GVD A;  4E1K A;  4HUR A;  1KQA A;  1Z90 A;  2QIA A;  5E3R A;  1QRM A;  3VBN A;  4EGG A;  2WLF A;  3IXC A;  5E3P A;  1HV9 A;  3ECT A;  1MR7 A;  4HZD A;  1MRL A;  1L0S A;  3OH0 A;  3MC4 A;  2W0V A;  4KNR A;  1MR9 A;  2V0J A;  3HJJ A;  1KK4 A;  4M99 A;  5AFU V;  1QRL A;  1OCX A;  3JQY A;  3OUP A;  4IHF A;  5DEM A;  2OI6 A;  3GOS A;  3PMO A;  3P1B A;  3R3R A;  2QIV X;  3OH4 A;  1KRV A;  4G87 A;  4KPZ A;  1V3W A;  1M8N A;  2AQ9 A;  2WLG A;  3FWW A;  1YP3 A;  2XAT A;  3GQ9 A;  2I5K A;  3DK5 A;  3KWD A;  3R2W A;  4KNX A;  3R3I A;  1HM9 A;  4AA7 A;  3ST8 A;  4HUS A;  4E6T A;  4AC3 A;  5F42 A;  4MFG A;  3Q1X A;  3T57 A;  3BSS A;  1FXJ A;  4ISX A;  1HM0 A;  4J09 A;  3OH2 A;  1SSQ A;  4EA9 A;  3BRK X;  3R5B A;  4FCE A;  3FS8 A;  2V0L A;  3DJ4 A;  3R8Y A;  2NPO A;  1YP4 A;  2WLC A;  2RIJ A;  3BSW A;  3CJ8 A;  1KGT A;  1SST A;  2IC7 A;  3TDT A;  3VBM A;  5AFU U;  2W0W A;  4N27 A;  3VBJ A;  2VHE A;  2V0H A;  3D98 A;  2WLD A;  2JF3 A;  4N6A A;  1G97 A;  2VD4 A;  1XHD A;  2P2O A;  4G3S A;  3TK8 A;  1KK5 A;  3OGZ A;  5ADX V;  1FWY A;  3DHO A;  3TWD A;  3KWE A;  2IUA A;  2TDT A;  1S80 A;  3OTZ A;  4MZU A;  4E75 A;  2OI5 A;  4N69 A;  4R7P A;  2IU8 A;  3OTM A;  4M28 A;  1KK6 A;  3VBP A;  3HSQ A;  4IHG A;  4EAA A;  3TV0 A;  4M98 A;  3TIO A;  3EG4 A;  3GUE A;  1LXA A;  3TIS A;  5L6S A;  3R5C A;  3OH3 A;  2GGQ A;  4E79 A;  1KRR A;  3FSY A;  3OH1 A;  4EA7 A;  2V0I A;  4KQL A;  3SRT A;  2GGO A;  1XAT A;  1KGQ A;  3R0S A;  1V67 A;  4R37 A;  5ADX U;  3EH0 A;  4EA8 A;  1QRF A;  2JF2 A;  1KRU A;  1KHR A;  1Z2F A;  5U2K A;  2IU9 A;  3BXY A;  4MYO A;  3VBI A;  1N4I A;  3F1X A;  3FTT A;  3OU9 A;  3OW5 A;  3R1W A;  4N6B A;  5L6V A;  2QKX A;  2ICX A;  3SPT A;  4E6U A;  2FKO A;  2OEG A;  4H7O A;  3FOQ A;  5E3Q A;  3SUC A;  3NZ2 A;  3P47 A;  5DG3 A;  3D8V A;  4M9C A;  3I3A A;  2ICY A;  1SSM A;  3FSX A;  3MQH A;  1HM8 A;  1YP2 A;  3GQA A;  3MQG A;  4HCQ A;  3C8V A;  3I3X A;  3KWC A;  4EAB A;  2WLE A;  4K6R A;  4J18 A;  4AAW A;  1T3D A;  2V0K A;  3R5D A;  1EWW A;  4G3Q A;  4DCL A;  1THJ A;  1QRE A;  3VBK A;  3GQ8 A;  1QRG A;  3IGJ A;  4M2B A;  4HZC A;  1QQ0 A;  3BSY A;  3R5A A;  4KPX A;  4EQY A;  3FSC A;  3VNP A;  4M2A A;  1G95 A;  1TDT A;  2OEF A;  2OI7 A;  4IHH A;  3BFP A;  4R36 A;  3EEV A;  4G3P A;  5DEP A;  3VBL A;  3V4E A;  2Q4J A;  3FSB A;  3GQ7 A; 
#chains in the Genus database with same CATH homology
 1J2Z A;  3GVD A;  4E1K A;  4HUR A;  1KQA A;  1Z90 A;  2QIA A;  5E3R A;  1QRM A;  3VBN A;  4EGG A;  2WLF A;  3IXC A;  5E3P A;  1HV9 A;  3ECT A;  1MR7 A;  4HZD A;  1MRL A;  4KNR A;  3MC4 A;  2W0V A;  1MR9 A;  2V0J A;  3HJJ A;  1KK4 A;  4M99 A;  5AFU V;  1QRL A;  1OCX A;  3JQY A;  3OUP A;  4IHF A;  5DEM A;  2OI6 A;  3GOS A;  3PMO A;  3P1B A;  3R3R A;  2QIV X;  1KRV A;  4G87 A;  1V3W A;  2AQ9 A;  2WLG A;  3FWW A;  1YP3 A;  2XAT A;  3KWD A;  2I5K A;  3DK5 A;  3R2W A;  4KNX A;  4KPZ A;  3R3I A;  1HM9 A;  4AA7 A;  3ST8 A;  4HUS A;  4E6T A;  4AC3 A;  5F42 A;  4MFG A;  3Q1X A;  3T57 A;  3BSS A;  1FXJ A;  4ISX A;  1HM0 A;  4J09 A;  1SSQ A;  4EA9 A;  3BRK X;  3R5B A;  4FCE A;  3FS8 A;  2V0L A;  3DJ4 A;  3R8Y A;  2NPO A;  1YP4 A;  2WLC A;  2RIJ A;  3BSW A;  3CJ8 A;  1KGT A;  1SST A;  2IC7 A;  3TDT A;  3VBM A;  5AFU U;  2W0W A;  4N27 A;  3VBJ A;  2VHE A;  2V0H A;  3D98 A;  2WLD A;  2JF3 A;  4N6A A;  1G97 A;  2VD4 A;  1XHD A;  2P2O A;  4G3S A;  3TK8 A;  1KK5 A;  5ADX V;  1FWY A;  3DHO A;  3TWD A;  3KWE A;  2IUA A;  2TDT A;  1S80 A;  3OTZ A;  4MZU A;  4E75 A;  2OI5 A;  4N69 A;  4R7P A;  2IU8 A;  3OTM A;  4M28 A;  1KK6 A;  3VBP A;  3HSQ A;  4IHG A;  4EAA A;  3TV0 A;  4M98 A;  3TIO A;  3EG4 A;  3GUE A;  1LXA A;  3TIS A;  5L6S A;  3R5C A;  2GGQ A;  4E79 A;  1KRR A;  3FSY A;  4EA7 A;  2V0I A;  4KQL A;  3SRT A;  2GGO A;  1XAT A;  1KGQ A;  3R0S A;  1V67 A;  4R37 A;  5ADX U;  3EH0 A;  4EA8 A;  1QRF A;  2JF2 A;  1KRU A;  1KHR A;  5U2K A;  2IU9 A;  3BXY A;  4MYO A;  3VBI A;  3OW5 A;  3F1X A;  3FTT A;  3OU9 A;  3R1W A;  4N6B A;  5L6V A;  2QKX A;  2ICX A;  3SPT A;  4E6U A;  2FKO A;  2OEG A;  4H7O A;  3FOQ A;  5E3Q A;  3NZ2 A;  3P47 A;  5DG3 A;  3D8V A;  4M9C A;  3I3A A;  2ICY A;  1SSM A;  3FSX A;  3MQH A;  1HM8 A;  1YP2 A;  4HCQ A;  3MQG A;  3C8V A;  3I3X A;  3KWC A;  4EAB A;  2WLE A;  4K6R A;  4J18 A;  4AAW A;  1T3D A;  2V0K A;  3R5D A;  4G3Q A;  4DCL A;  1THJ A;  1QRE A;  3VBK A;  1QRG A;  3IGJ A;  4M2B A;  4HZC A;  1QQ0 A;  3BSY A;  3R5A A;  4KPX A;  4EQY A;  3FSC A;  3VNP A;  4M2A A;  1G95 A;  1TDT A;  2OEF A;  2OI7 A;  4IHH A;  3BFP A;  4R36 A;  3EEV A;  4G3P A;  5DEP A;  3VBL A;  3V4E A;  2Q4J A;  3FSB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...