5ANBC

Mechanism of eif6 release from the nascent 60s ribosomal subunit
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
205
structure length
205
Chain Sequence
MSGAGSKRKNVFIEKATKLFTTYDKMIVAEADFVGSSQLQKIRKSIRGIGAVLMGKKTMIRKVIRDLADSKPELDALNTYLKQNTCIIFCKDNIAEVKRVINTQRVGAPAKAGVFAPNDVIIPAGPTGMEPTQTSFLQDLKIATKINRGQIDIVNEVHIIKTGQKVGASEATLLQKLNIKPFTYGLEPKIIYDAGACYSPSISEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
pubmed doi rcsb
molecule tags Translation
source organism Homo sapiens
molecule keywords 60S RIBOSOMAL PROTEIN L3
total genus 15
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2015-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00466 Ribosomal_L10 Ribosomal protein L10
C PF17777 RL10P_insert Insertion domain in 60S ribosomal protein L10P
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...