5AV7A

Crystal structure of calsepa lectin in complex with bisected glycan
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
150
structure length
141
Chain Sequence
VPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGNNPIALTFSSTKDTITVGGGGPDSITGTEMVNIGTDEYLTGISGTFGIYLDNNVLRSITFTTNLKAHGPYGQKVGTPFSSANEIVGFLGRSGYYVDAIGTYNRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic visualization of a flipped-back conformation of bisected glycans bound to specific lectins
pubmed doi rcsb
molecule keywords Lectin
molecule tags Sugar binding protein
source organism Calystegia sepium
total genus 25
structure length 141
sequence length 150
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 5av7A00
3MITA 3MIVA 5BN6E 1VBPA 2BN0A 1M26A 4PIFA 3P8SA 3WOCA 1PXDA 1ZGSA 1C3NA 2GUXA 1UH0A 1XEZA 1WS5C 1JOTA 1WS4C 4AKBA 1J4UA 4MQ0A 1UH1A 1X1VA 3VZFA 5J4XA 1VBOA 3APAA 2JZ4A 3LL0A 1KU8A 3AQGA 3LKYA 1UGYC 1JACA 3LL1A 3O44A 4R6QA 2GUCA 2HYQA 1C3KA 4PIKA 1UGWC 3VY7A 4AKDA 1J4SA 4R6RA 2GUEA 2HYRA 4WOGA 3VY6A 3LLYA 1XXRA 1TP8A 3VZGA 3R52A 3LLZA 4DDNA 5J50A 3LM1A 1C3MA 4PIUA 3MIUA 5J4TA 3R51A 2GUDA 5EXGA 4R6PA 4AKCA 3LL2A 2GTYA 1ZGRA 1UGXA 1OUWA 1UGWA 4R6OA 5JM1A 4AK4A 5J51A 1WS5A 2NU5A 1WS4A 2BMYA 5AV7A 3R50A 1KUJA 4PITA 4GX7A 1J4TA 2BMZA 3WOBA 2NUOA 1XXQA 1TOQA 1UGYA 4R6NA 3VZEA
chains in the Genus database with same CATH superfamily
3MITA 3MIVA 5BN6E 1VMOA 1VBPA 2BN0A 1M26A 4PIFA 3P8SA 3WOCA 1PXDA 1ZGSA 4QX0A 1C3NA 2GUXA 1UH0A 1XEZA 1WS5C 1JOTA 1WS4C 3EB7A 4AKBA 1J4UA 4MQ0A 1UH1A 1X1VA 3VZFA 5J4XA 1VBOA 3APAA 4QX2A 2JZ4A 3LL0A 1KU8A 3AQGA 3LKYA 1UGYC 1JACA 2QP2A 3LL1A 3O44A 2GUCA 4R6QA 2HYQA 1C3KA 4PIKA 1UGWC 4QX3A 3VY7A 4AKDA 1J4SA 2GUEA 4R6RA 2HYRA 4WOGA 3VY6A 1DLCA 4D8MA 3LLYA 1XXRA 1TP8A 3VZGA 3R52A 3LLZA 4MOAA 4DDNA 5J50A 3LM1A 1C3MA 4PIUA 2C9KA 3MIUA 5J4TA 3R51A 2GUDA 5EXGA 4R6PA 4AKCA 3LL2A 2GTYA 1JI6A 4ARXA 1OUWA 1UGWA 1UGXA 1W99A 4R6NA 4R6OA 5JM1A 4AK4A 5J51A 1WS5A 2NU5A 1WS4A 2BMYA 5AV7A 3R50A 1KUJA 4PITA 4GX7A 4ARYA 1J4TA 1I5PA 2BMZA 3WOBA 2NUOA 4W8JA 1CIYA 1XXQA 1TOQA 1UGYA 1ZGRA 4QX1A 3VZEA 3TOWA
chains in the Genus database with same CATH topology
3MITA 3MIVA 5BN6E 1VBPA 2BN0A 1M26A 4PIFA 3P8SA 3WOCA 1PXDA 1ZGSA 1C3NA 2GUXA 1UH0A 1XEZA 1WS5C 1JOTA 1WS4C 4AKBA 1J4UA 4MQ0A 1UH1A 1X1VA 3VZFA 5J4XA 1VBOA 3APAA 2JZ4A 3LL0A 1KU8A 3AQGA 3LKYA 1UGYC 1JACA 3LL1A 3O44A 4R6QA 2GUCA 2HYQA 1C3KA 4PIKA 1UGWC 3VY7A 4AKDA 1J4SA 4R6RA 2GUEA 2HYRA 4WOGA 3VY6A 3LLYA 1XXRA 1TP8A 3VZGA 3R52A 3LLZA 4DDNA 5J50A 3LM1A 1C3MA 4PIUA 3MIUA 5J4TA 3R51A 2GUDA 5EXGA 4R6PA 4AKCA 3LL2A 2GTYA 1ZGRA 1UGXA 1OUWA 1UGWA 4R6OA 5JM1A 4AK4A 5J51A 1WS5A 2NU5A 1WS4A 2BMYA 5AV7A 3R50A 1KUJA 4PITA 4GX7A 1J4TA 2BMZA 3WOBA 2NUOA 1XXQA 1TOQA 1UGYA 4R6NA 3VZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MIT A;  3MIV A;  5BN6 E;  1VBP A;  2BN0 A;  1M26 A;  4PIF A;  3P8S A;  3WOC A;  1PXD A;  1ZGS A;  1C3N A;  2GUX A;  1UH0 A;  1XEZ A;  1WS5 C;  1JOT A;  1WS4 C;  4AKB A;  1J4U A;  4MQ0 A;  1UH1 A;  1X1V A;  3VZF A;  5J4X A;  1VBO A;  3APA A;  2JZ4 A;  3LL0 A;  1KU8 A;  3AQG A;  3LKY A;  1UGY C;  1JAC A;  3LL1 A;  3O44 A;  4R6Q A;  2GUC A;  2HYQ A;  1C3K A;  4PIK A;  1UGW C;  3VY7 A;  4AKD A;  1J4S A;  4R6R A;  2GUE A;  2HYR A;  4WOG A;  3VY6 A;  3LLY A;  1XXR A;  1TP8 A;  3VZG A;  3R52 A;  3LLZ A;  4DDN A;  5J50 A;  3LM1 A;  1C3M A;  4PIU A;  3MIU A;  5J4T A;  3R51 A;  2GUD A;  5EXG A;  4R6P A;  4AKC A;  3LL2 A;  2GTY A;  1ZGR A;  1UGX A;  1OUW A;  1UGW A;  4R6O A;  5JM1 A;  4AK4 A;  5J51 A;  1WS5 A;  2NU5 A;  1WS4 A;  2BMY A;  5AV7 A;  3R50 A;  1KUJ A;  4PIT A;  4GX7 A;  1J4T A;  2BMZ A;  3WOB A;  2NUO A;  1XXQ A;  1TOQ A;  1UGY A;  4R6N A;  3VZE A; 
#chains in the Genus database with same CATH topology
 3MIT A;  3MIV A;  5BN6 E;  1VMO A;  1VBP A;  2BN0 A;  1M26 A;  4PIF A;  3P8S A;  3WOC A;  1PXD A;  1ZGS A;  4QX0 A;  1C3N A;  2GUX A;  1UH0 A;  1XEZ A;  1WS5 C;  1JOT A;  1WS4 C;  3EB7 A;  4AKB A;  1J4U A;  4MQ0 A;  1UH1 A;  1X1V A;  3VZF A;  5J4X A;  1VBO A;  3APA A;  4QX2 A;  2JZ4 A;  3LL0 A;  1KU8 A;  3AQG A;  3LKY A;  1UGY C;  1JAC A;  2QP2 A;  3LL1 A;  3O44 A;  2GUC A;  4R6Q A;  2HYQ A;  1C3K A;  4PIK A;  1UGW C;  4QX3 A;  3VY7 A;  4AKD A;  1J4S A;  2GUE A;  4R6R A;  2HYR A;  4WOG A;  3VY6 A;  1DLC A;  4D8M A;  3LLY A;  1XXR A;  1TP8 A;  3VZG A;  3R52 A;  3LLZ A;  4MOA A;  4DDN A;  5J50 A;  3LM1 A;  1C3M A;  4PIU A;  2C9K A;  3MIU A;  5J4T A;  3R51 A;  2GUD A;  5EXG A;  4R6P A;  4AKC A;  3LL2 A;  2GTY A;  1JI6 A;  4ARX A;  1OUW A;  1UGW A;  1UGX A;  1W99 A;  4R6N A;  4R6O A;  5JM1 A;  4AK4 A;  5J51 A;  1WS5 A;  2NU5 A;  1WS4 A;  2BMY A;  5AV7 A;  3R50 A;  1KUJ A;  4PIT A;  4GX7 A;  4ARY A;  1J4T A;  1I5P A;  2BMZ A;  3WOB A;  2NUO A;  4W8J A;  1CIY A;  1XXQ A;  1TOQ A;  1UGY A;  1ZGR A;  4QX1 A;  3VZE A;  3TOW A; 
#chains in the Genus database with same CATH homology
 3MIT A;  3MIV A;  5BN6 E;  1VBP A;  2BN0 A;  1M26 A;  4PIF A;  3P8S A;  3WOC A;  1PXD A;  1ZGS A;  1C3N A;  2GUX A;  1UH0 A;  1XEZ A;  1WS5 C;  1JOT A;  1WS4 C;  4AKB A;  1J4U A;  4MQ0 A;  1UH1 A;  1X1V A;  3VZF A;  5J4X A;  1VBO A;  3APA A;  2JZ4 A;  3LL0 A;  1KU8 A;  3AQG A;  3LKY A;  1UGY C;  1JAC A;  3LL1 A;  3O44 A;  4R6Q A;  2GUC A;  2HYQ A;  1C3K A;  4PIK A;  1UGW C;  3VY7 A;  4AKD A;  1J4S A;  4R6R A;  2GUE A;  2HYR A;  4WOG A;  3VY6 A;  3LLY A;  1XXR A;  1TP8 A;  3VZG A;  3R52 A;  3LLZ A;  4DDN A;  5J50 A;  3LM1 A;  1C3M A;  4PIU A;  3MIU A;  5J4T A;  3R51 A;  2GUD A;  5EXG A;  4R6P A;  4AKC A;  3LL2 A;  2GTY A;  1ZGR A;  1UGX A;  1OUW A;  1UGW A;  4R6O A;  5JM1 A;  4AK4 A;  5J51 A;  1WS5 A;  2NU5 A;  1WS4 A;  2BMY A;  5AV7 A;  3R50 A;  1KUJ A;  4PIT A;  4GX7 A;  1J4T A;  2BMZ A;  3WOB A;  2NUO A;  1XXQ A;  1TOQ A;  1UGY A;  4R6N A;  3VZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...