The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
143
|
sequence length |
443
|
structure length |
430
|
Chain Sequence |
CSMAPTYERPAAPVADSWSLDWKSFIVDAELRRLVDMALDNNRSLRQTLLDIEAARAQYRIQRADRVPGLNAAATGNRQRQPADLSAGNRSEVASSYQVGLALPEYELDLFGRVKSLTDAALQQYLASEEAARAARIALVAEVSQAYLSYDGALRRLALTRQTLVSREYSFALIDQRRAAGAATALDYQEALGLVEQARAEQERNLRQKQQAFNALVLLLGSDDAAQAIPRSPGQRPKLLQDIAPGTPSELIERRPDILAAEHRLRARNADIGAARAAFFPRISLTGSFGTSSAEMSGLFDGGSRSWSFLPTLTLPIFDGGRNRANLSLAEARKDSAVAAYEGTIQTAFREVADALAASDTLRREEKALRALANSSNEALKLAKARYESGVDNHLRYLDAQRSSFLNEIAFIDGSTQRQIALVDLFRALG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structures of OprN and OprJ, outer membrane factors of multidrug tripartite efflux pumps of Pseudomonas aeruginosa.
pubmed doi rcsb |
| molecule tags |
Membrane protein
|
| source organism |
Pseudomonas aeruginosa (strain atcc 15692 / pao1 / 1c / prs 101 / lmg 12228)
|
| molecule keywords |
Outer membrane protein OprJ
|
| total genus |
143
|
| structure length |
430
|
| sequence length |
443
|
| chains with identical sequence |
B, C
|
| ec nomenclature | |
| pdb deposition date | 2015-10-21 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02321 | OEP | Outer membrane efflux protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Outer membrane efflux proteins (OEP) | Outer membrane efflux proteins (OEP) | ||
| Mainly Beta | Single Sheet | Outer membrane efflux proteins (OEP) | Outer membrane efflux proteins (OEP) |
#chains in the Genus database with same CATH superfamily 1YC9 A; 4MT0 A; 4Y1K A; 5AZO A; 1WP1 A; 2XMN A; 5IUY A; 2VDD A; 4K7K A; 4MT4 A; 5AZP A; 5AZS A; 4K7R A; 2WMZ A; 3D5K A; 1TQQ A; 4K34 A; 3PIK A; 2VDE A; 1EK9 A; 5BUN A; #chains in the Genus database with same CATH topology 1YC9 A; 4MT0 A; 4Y1K A; 5AZO A; 1WP1 A; 2XMN A; 5IUY A; 2VDD A; 4K7K A; 4MT4 A; 5AZP A; 5AZS A; 4K7R A; 2WMZ A; 3D5K A; 1TQQ A; 4K34 A; 3PIK A; 2VDE A; 1EK9 A; 5BUN A; #chains in the Genus database with same CATH homology 1YC9 A; 4MT0 A; 4Y1K A; 5AZO A; 1WP1 A; 2XMN A; 5IUY A; 2VDD A; 4K7K A; 4MT4 A; 5AZP A; 5AZS A; 4K7R A; 2WMZ A; 3D5K A; 1TQQ A; 4K34 A; 3PIK A; 2VDE A; 1EK9 A; 5BUN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
