5B38A

Kir3dl1*005 in complex with hla-b*57:01
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
275
structure length
275
Chain Sequence
GSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Killer cell immunoglobulin-like receptor 3DL1 polymorphism defines distinct hierarchies of HLA class I recognition
pubmed doi rcsb
source organism Homo sapiens
total genus 71
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2016-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5b38A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5b38A01
4Q74A 4Z7VF 3VWJB 4YGVA 4G5ZL 5CUSH 1MWAH 3QIBA 3CFBA 4UTBH 1QR1A 2VDNH 4CMHB 1U6AL 1II4E 3W81A 3CFEB 3P77A 3FFCB 4MNQD 3BIKA 3MLUL 2YK1H 3VXMB 4GUPA 5GGUB 1NANI 3ROOB 2Z31A 4HQQL 5E5MA 4YHYC 4ENED 5HGBB 1RUPL 4HXAL 5IW1A 1JTPA 4FFZL 1M71A 5CZXD 2H1PL 1T89A 2CK2A 1Z9LA 4FQJL 4NP4H 4RFOL 4PJEF 4ZAKC 4WDIA 3D85D 5HDQL 1DQMH 5H35A 3CCHA 1NGWB 1FL3B 3VXRA 2NY3C 1T2XA 1BZQK 5EU3A 5ACZB 4RGNE 1EMTL 1PBYA 4LLMB 2YPLB 4MZ2A 3NA9H 4Y19A 1U3HD 1BP3B 4M62L 4Z7UB 4LAJH 3GBNL 1A3RL 1L6ZA 4J1UA 3JWDC 1NGQH 1IZJA 3MTRA 3KPMA 4MA1C 2G5BA 2QSVA 1NGXA 3ARDB 3MGOA 2Q3AA 1G9NC 2B4CC 4KK8C 4R4ND 5AUMB 1K8DA 1P69B 2BMKB 1ACYL 2G9HB 2VLKA 5C92A 4WW2B 4XMLL 4YHPA 4HKJA 3ZTNL 4K3DL 1S7XB 4MXWH 4JO3L 1UB6B 1ZMYA 1Y18A 5GGRA 1FIGH 3KYKH 4YJZL 4WHTA 2LU3A 4Q2ZA 2NPLX 3PABB 3O41B 4MQ7B 3ZE1F 3EYVA 5I74C 3UPAA 2HG5B 3GMMB 3WNLA 3P40A 3RWIB 2E7MA 3TVMD 5C1MB 3W9DB 1BAFL 1NBQA 4PBVC 3K80A 4PJ5B 4N0UB 2HH0H 2MPAL 3CFKB 3CVIL 3VH8G 1YZZA 3OKNA 1IGJA 1U42A 2CKBH 1J0JA 4YGVB 5DUPL 1N5AA 7FABL 3CFBB 1QR1B 1T2JA 2XWJA 1YY9D 2PCPA 3OAUL 3P77B 1OARL 3RU8H 3BYTA 3F7RA 5J1SC 4NN7C 3BIKB 5E24E 4PJAA 4GUPB 3MLVL 2DWEA 1R3KB 3LQAH 1KJ2L 3B9DA 2EH8L 3LS4L 5IW1B 2Y6SC 3V0WL 2EDQA 1QBBA 4HJGA 4MLIA 5ADPL 2FNBA 4KPHL 2JTDA 2ZSVA 3ULVF 4ZO9A 4YHNA 5HYFA 1NMCC 3VFVA 1GL4B 2XOTA 5H35B 1AGCA 3CCHB 1QFOA 5T5FH 1EHLL 4PRHA 3EIFA 15C8H 5C2BL 3ZLQC 3TZVC 4ZAKA 4Y19B 3S97C 3SE9H 2XI9A 4GAGH 4J1UB 2VLJD 1OGAA 5EUOF 3KPMB 2G5BB 1NGXB 1OWWA 2MKLC 1K8DB 4H20H 2VNCA 2VLKB 1QBLL 1FZKA 1D6VL 4YHPB 4HKJB 4LSPH 2VERN 1FAKT 2I9LA 1Y18B 4QRRE 5GGRB 2F58L 4K9EC 4WHTB 4Q2ZB 2AV1A 3MV8E 5K9QI 2VXVH 3EYVB 4TPRL 3RDTC 5KSBA 4HUNB 1ITBB 4Q0XL 3U0PA 1GZPA 5E2WL 1KN4L 35C8H 2JB5L 1P2CB 2D31A 1VFBA 3D0LA 4I4WA 4NC0B 3IXTA 5E9DE 1GC1H 2HLFD 3QWQB 4JG1L 4JKPH 5FUZL 4NQEE 4MNHA 2ZUQC 1S7VA 2Y36H 1IGJB 3OKNB 1N5AB 2FR4A 1U3JA 3HKFA 2XWJB 4U6HA 2HMID 4UT6L 4TVSa 3BRDA 4NCC1 4PLJC 4PJAB 2P5WE 2GFBA 4PYGA 2DWEB 1WVZA 3PJSA 3ZZ1A 3D3VA 3EYSL 3WSQH 2NTFA 4F9LC 1D5BA 1OT1A 3DUUA 3LKOA 4HJGB 4Y1AD 5CD3A 4EI5C 1F11B 1I3RA 5DT1H 1FZOA 4YHNB 1MCSA 3VFVB 4YHYB 2BRRL 1AGCB 3CXDH 3O4LB 4PRHB 4QYOB 4WW1A 5IT2H 4NQSA 4UNUA 1BX2A 3WIIL 3D48R 2FEDD 2UYLA 2DICA 4KKAD 3RP1A 3HMXH 3AVEA 4ZAKB 1B0RA 4M02A 4PGZA 3UC0L 1OGAB 4XPTH 1XAUA 2XA8L 3LS5L 2NY3B 4JRYB 4B50A 5KVFH 2ZJSL 5KAQF 2DLTA 1S8DA 5EOCJ 5EOQH 1A02N 3H3BC 1OP3H 1EJ6A 3DETC 3TZVA 2B1HH 3LSOA 5T3XH 1FZKB 2P43B 2HFEA 5L7XH 2PNDA 2I9LB 5E4EC 4OFIA 4MA1B 1OAZH 1Q9WA 3HI6L 2D7NA 5H37G 4XVUD 2NY5C 4YZFE 3T3ME 1PD6A 4NT6A 3TBSA 4NWUH 3V4VL 5KSBB 3GSQB 3U0PB 4LPUA 1CD1B 2IH1A 1VFBB 5GS0L 3ARGC 3D0LB 4I4WB 3IXTB 2Z35A 2EDXA 4FRWA 5AYQA 1K9TA 1MHEA 4MNHB 4DN4H 5I74B 1S7VB 1MRCH 3RDTA 1SMAA 5GGSA 2FR4B 3SCMC 4HWNA 4U6HB 5DS8A 1CCZA 3ALPA 5DRXB 2VXQL 2M2DA 4M7JH 4JFFE 5GRVL 1CGXA 3CMOL 4JCMA 2GFBB 5ICXA 2MMXA 3A6BH 3DSFH 3D3VB 2NTFB 3T3PE 5E08L 2ADFL 3SDAD 4FTVD 2XZQH 3LKOB 1D5BB 3DUUB 3QIUC 3UPRB 2ERJC 5CD3B 1I3RB 4NN7B 3ZDYF 1U8PA 3QCUH 1VFOA 3MXVH 4NQCE 1PG7H 1YECH 1A4KA 3O9WD 4F9LA 3C5JA 3Q6GH 4NQSB 4EI5A 4HKBB 2CXGA 1BX2B 3INUL 1V7NH 4EUPG 1KCRH 4GQ9L 2UYLB 4LCWA 2DAVA 3UJTL 4LSVL 3D9AH 1B0RB 4KQ3L 1U8NA 4HIIA 1NMCB 2APTA 3EJJX 4WUUA 1ND0A 4AZ8A 1S8DB 2R4SH 1S7RA 4QXTA 4QHMA 3TZVB 4KTYA 3LSOB 3KPPA 2HFEB 2VLRE 5E2UL 3KS0H 1MCWM 2DQCL 3UYPA 3MCKA 1Q9WB 3FFDA 4L5FL 4UZGA 1Z5LB 4P9HC 4BK5A 3HB3D 4XWGL 2DBLL 4NT6B 1P7HL 3FO1A 5KOMC 1NPUA 4LLYB 3TGXA 1KIRA 4XH2A 3LHPL 5SWQA 2Z35B 3P9LA 2OZ4A 1WIPA 4G6KL 2D7PA 4OZGA 4OUUB 1I1FA 1DLHA 3RDTB 5I1LA 4EVNA 4W4OC 4C83A 5GGSB 3C9NA 3OWEA 1CU4L 3Q5TA 3MXWL 3ARGA 5DS8B 2F5AL 1CK0L 1I75A 3OR6A 3WLWC 1FE8H 2ZUQB 3QJFA 5ICXB 3ZSTA 3MLPA 4UOW0 1CF8H 1JPFA 4HBCL 3IF1A 3SCMA 3W0WA 3GSNH 3R1GH 2NXZD 2QQLH 5EBGA 1UZ8A 2IC2A 1SBSH 1U8PB 1UG9A 3AREC 3KPSD 4LP4A 4W4NA 1A4KB 1JYVA 1JNJA 1MHHA 3SDDA 4AEIL 1ZSDB 3C5JB 1MCOL 5IWLC 3QIUA 1KCKA 1C1EL 4YZFF 2EDNA 3T3MF 4EI5B 1EHNA 1OSPH 4YQXL 4LCWB 5SX5K 3MRPA 4XZUA 2R1YA 2ZUYA 3IDXH 4HUMB 4JE4B 3NA4A 4WUUB 1ND0B 2V5MA 4ZYKA 2R29L 1S7RB 2IFFL 1X4YA 3QDHA 4QXTB 1NC2D 4QHMB 3UJIL 4ODSL 5JMOC 4QXGH 3KPPB 4G8FA 4U7MA 1A6WH 3T2QA 4KGJA 2V2WB 5C7XL 1G1YA 1HH9B 2WBJC 4L8CA 1D9KD 1BM3H 3SGJC 2R0WL 1N64L 1REIA 3T3PF 4DZ8A 4JCLA 5IMOA 5BCAA 3FO1B 2E27L 3QCVL 2ESVA 4LEXL 4R2GC 4PJDE 1KIRB 4XH2B 5SWQB 5E4EB 2IQ9L 4O5LH 4OZGB 3VGBA 4M1GL 3GI8H 1CN4A 1I1FB 2VOTA 2BVQA 1RZIA 5KS9A 4NKOA 5I1LB 1OSZA 4EVNB 4C83B 1QZ1A 3ARGB 1OW0C 2J88H 4MJIE 2BNQE 2LABA 3HZMA 2XG4A 3OR6B 3AMKA 3IJHA 2UZIH 3N85L 3QJFB 4DVBA 5ALBH 4W4OA 4BA8A 1JPFB 4V3EB 3IF1B 5BJTA 3SCMB 1GHFL 3W0WB 1CL7L 2PXYC 1QQDA 3MRIA 3IFOA 2CUIA 4NHCH 3QEGH 4JHBA 1UZ8B 3X3GL 1AXSA 3T0BA 3F62A 1FN4A 3IU4H 1MHHB 2OTPA 2XQBH 1SVCP 3NZHL 3QIUB 3C60C 3C6SA 2ERJB 1G6RH 5GPRA 4PG2C 5HHQA 2AAVA 3AGVA 3MRPB 4XZUB 3AREA 1QNZH 1N0XH 2R1YB 1NCWL 4LVEA 2B0SH 4U05A 5IWLA 4ZYKB 1KB9J 2D7TL 2N1KA 1MJUH 4G9FD 5FM5M 3MODH 4G8FB 1EXUA 3QYCA 4M1CC 5HGAA 1HYSC 4L8CB 1RZ8A 4L4TA 4I48B 4EBQH 4DZ8B 5IMOB 1INDH 2EC9T 2YXFA 2ESVB 3ESVF 1HHIA 2G5RA 3BESR 3OKLA 4TSCL 4OGXH 4XP6H 3T2NL 3HTLX 4MDJA 5ITBL 4X5WB 1RZIB 3SGJA 4NKOB 1OSZB 2XNAA 4IMKC 3DRTA 4NPYA 1RZJH 4R9HA 5GXBB 1Z0NA 3HZMB 5HYSA 3RAJL 3BRFA 3IJHB 5KVDH 5T1KD 5I0DA 5FA4A 1DBAH 1BQLH 3U46A 3GO1L 3Q48A 4HKXA 5ANME 4DVBB 3STLA 3DVGA 2OX5A 2JK5A 4B5EA 2DN7A 4PJBA 4YHMH 5EC2A 1EFXA 1QQDB 3MRIB 3IFOB 4LBEA 1PG7X 3FOLB 1AXSB 1MAJA 4BZ2H 3G9AB 4NZJA 3IFLH 5CLTA 3V5DA 1J1OL 1Q0XH 2PXYA 3L7EA 4P4KC 4U1IA 5IB2A 4UIMA 5LGHH 1IL1A 5HHQB 2DBJA 1RJYA 2W9DH 1RJLA 5J1AA 2GYSA 3AREB 4NM8L 5M7QA 1YMMB 4PJDF 2DD8H 2QADD 3B9KC 1QR4A 4I2XA 2OTUA 4E41E 4N8VG 4JQIL 1KJ2A 3C60A 1VPOL 4P2QA 3VI3E 3KGRA 4PG2A 5EU6A 1A3LL 1YEKL 2EDBA 4F57L 5BVPH 4ZXBC 1EXUB 5C07A 2J6EL 1UWXK 2ZCKL 3ZKMD 3MA9L 5HGAB 1F97A 3P0GB 4ETQA 1RZ8B 1MRDL 4L4TB 4JDTH 1WZLA 2C1OA 4LHUG 5EWIH 1YYLH 4ONHB 1HHIB 1JYWA 3KAAA 2YD6A 1OCWL 4R8WL 3U7WL 2QQKL 1KC5L 4FZEL 1FLTX 3MROA 2VJXA 3EKCA 1F4XL 1JRHI 1CQYA 1UC6A 4OFYA 5C0EA 3DUHA 2XNAB 3NCMA 3DRTB 4JHWL 1VGEL 4P2RD 3OX8B 4R2GB 1MVUA 5HYSB 1TVDA 5BXFB 4XGZA 2BP3A 5FA4B 4PJXE 3U46B 2Y07L 4PRPA 1U41A 3STLB 4IMKA 2LAAA 2JK5B 4PJBB 4JFDB 3U4BL 5EC2B 1EFXB 5E2JA 1BEYH 3WMSA 4LK4A 1FCCA 3NPSC 1EGJA 3P4OA 1PQZA 4OF5A 1A6ZA 1JFQL 4GKSA 4ORGA 4QHUA 4XNXL 3QO0B 2X1QA 4KUCD 3D0VA 3VGEA 3LQAC 4PJ7B 4LCUA 3VD3A 5KVGH 4OCXH 2PXYB 1BVZA 1MIMH 2EE6A 3L7EB 2X1XR 3FTGA 4U1IB 4UIMB 5IB2B 2Z9TA 4HZLA 1IL1B 5GJSL 1RJYB 1RJLB 5J1AB 3NCEB 4GRLD 1Q9KA 4JQVA 4UQ2A 1QSZA 1CGSL 4I2XB 5CILL 3BGFC 4N0CC 4TYUA 2OTUB 3VD9A 1S78C 2B8OT 3C60B 3QEQA 4P2QB 4P4KA 5DJ8A 1DZBA 4GW4A 4TVPH 5EU6B 4K3JH 4XNMA 4NFDA 4YPGA 4L4VE 1MUJA 4RMUA 1JGVL 3PWLB 5C07B 5MEQA 4C58B 4XVTL 1P9MC 5EO9B 4XRCA 4ETQB 4MQXD 3TA3D 3K2UH 4KXZI 1OTSD 4ZXBA 1T1YB 4JO1H 4N9GA 1IFHH 1ZLUH 4KRMB 5SWZD 3MROB 4MVBC 4OF0A 2EXWD 5C0EB 4FNLH 5ACMA 3P30L 4AMKL 1A0QH 4G42A 1U93A 2HRPL 3VGGA 4Z95L 3EFFA 1MVUB 1GC1C 3TNMA 4XGZB 5CIPH 2J7LA 5L2KE 2VWEE 2FX9H 3GKWH 4XI5C 4PRPB 3SGDI 3G6DH 4X4ZA 2DLHA 4MHHI 4G8GE 3VI3F 4P3CL 1I4FA 3MC0A 4N1HB 1S7WA 3BISA 4PREA 3KPTA 4P4RA 3VXUA 3WJJC 3PIQA 3P4OB 1PQZB 1A6ZB 4GKSB 4JM2C 4ORGB 5KN5A 3TF7C 4QHUB 3JTSB 3WDIA 3PDGA 3S96A 2VN7A 2L4OA 5L88H 4LCUB 1MWAB 4WWID 3VXSE 2F53B 2NNAA 4N68A 2OTWA 3FTGB 4HFWA 4HZLB 2EH7L 5DQJA 5C71A 3PHSA 4PRIB 3GHBH 5E8OA 5KW9H 5DLMH 1GAFH 4JRWA 3E3QE 4UQ2B 3H7BA 4G43A 2HT2D 2CH8A 1RVFH 2WZPD 1IKNC 3QRFM 2VMFA 3QEQB 4P4KB 5DJ8B 4C56A 4GW4B 1JN6B 5BZDA 2O5XL 5CEXA 1FFOA 4XNMB 4YPGB 1MUJB 4I13B 3B9EA 1MIEL 4Q97A 2X05A 5MEQB 3BPLC 3B9KB 4M8QA 4BUGA 4EDXA 4N0CA 3AXLA 1MPAH 3S37X 3MGAA 4DUXA 4XRCB 4Q9QL 4PJXF 4OLUH 2WWKO 3U9UA 5F7NC 3P3YA 3PWVB 2B4CL 1QYGL 4GSDL 4ZXBB 3BN9D 5D2LE 1IT9L 1XIWC 2JCCE 4WU7A 1Q1JL 5AAWA 1P9MA 2X09A 3BUTA 4MAYD 4I0PD 3EYQC 2CKNA 4OFPA 4M9OA 3Q5OA 5HHMA 4JREC 2BX5A 3KG5A 1FAIH 1GYAA 4G42B 1U93B 3EFFB 5EA0L 5DMIL 1FIEA 3TNMB 4XMPH 4MVBA 4FXKA 2VDPH 4RX4D 3SBWC 3P9WB 1CR9L 2VDRH 3ULUE 1I4FB 1T6WA 1S7WB 4PREB 4P4RB 5SV3A 3PIQB 2FLBT 5KN5B 5DK2B 1X5XA 3UYRH 1J8HD 2H45A 4EOWL 3ULVD 1JTTA 4ZTOH 4F58H 3SE4C 2NNAB 3JTTA 1MCWW 2OTWB 3WJJA 4PP1C 1XEDA 4HFWB 1ZLWH 3NPSB 5DQJB 4ZUWA 2R56L 3UCRA 1B0WA 4JM2A 5E8OB 3TF7A 4OJFH 3H7BB 4XMKL 4G43B 2NMSA 6CGTA 4YHOH 4QXWA 4C56B 4X80H 1IEBA 4U1NA 5BZDB 3U0TB 4DKAA 5CEXB 1CFTA 1FFOB 3PWUA 5GRJH 5TQ2H 2EO9A 1SBBA 4LIQL 3MLTA 5I15L 3DI3B 1H8SA 4M8QB 4EDXB 3BGFB 2ICCA 3AXLB 3ARZA 5FGBC 3T2PA 3NH7H 5SX4H 2FJFB 5MENA 3TPUE 3D1MC 1D5IL 5B38G 3HPJA 1V7MH 2ORBH 2VB5A 4WU7B 5CJ8A 3VXPA 1TNMA 1CICC 1LK3H 1A7OH 5KJRH 4G7VL 5I1JH 3HE6D 5TFSH 3SKMA 1GGUA 5HHMB 1JPSL 3MRCA 4GMTH 1XIWA 2EZ0D 2K3TA 3NFNA 2V5RA 4RGND 3EO0A 5FCUH 4FXKB 5GGVH 3RI5K 4WTZG 1IGTA 2EDTA 3NACH 4BZ1H 3EGSA 4NSKA 1RMFL 4AIOA 2BXYA 4HPYH 1NCTA 1BFVL 4YR6A 4NNPL 1JZ3A 3T1FB 5DD3H 4WI8A 3SBWA 4D9RE 3WFCL 1CFSA 4M61B 4N5UA 3PP3K 4P57A 4XP5L 4EXPX 2ATKA 1I8KA 3K1DA 3JTTB 5LCVH 5I8OL 1JNNL 2D4DA 4ZUWB 3QEHA 5CLWA 1AY1H 4O02H 4JM2B 5D2LF 1B4RA 2JCCF 4I77H 4TTDC 1INQA 1JF6A 2BY3A 1VENA 4LLDA 3BZFA 3CX2A 3SE4A 1IEBB 4U1NB 1CFTB 1V3KA 3PWUB 1Q8MA 4JY5H 1XFPA 3FN3A 2NY2D 1FFPA 2IG2H 1L7IL 4OTXL 5TE6H 2FBJH 5MENB 5JOPE 1JGDA 3MRLA 2W9LA 4KUZH 3HPJB 4ALAH 3ULUF 3BPLB 4OUOA 1MF2L 3ILQC 3ARSA 5FGBA 3VXPB 4XNYH 3ARFC 3QUYD 4JO2L 1MCHA 2NX5E 1ZT4A 3RVUC 1ZEAH 5A2KH 3T1WA 3SKMB 4KJQC 3SOBH 5EIIA 3JTCA 4YBQD 1ZE3C 3MRCB 2H9GA 5E8DH 3MUZ1 1XIWB 2OCFD 2FH6A 3D87B 1CICA 3NFNB 1BQHA 2VDQL 5CJOH 5GISL 3FAXA 3VRJA 4ONFH 4FOMA 5JQ6L 3EO0B 1G1CA 5FYLE 1QLFA 1P7QA 2EDHA 4JREB 2I27N 1IGTB 3U7YL 4NSKB 4RAHA 3SDYL 5CZXC 4LHUA 4D0CA 1ZT1B 3LCYA 4MA8H 4PLKD 4YR6B 1MHPH 4POZC 4OIAA 2ARJA 1WUNT 5AEAA 2AI0H 4P57B 3A6CH 4F8QA 1F2QA 1I8KB 3LD8C 1ZHLA 5F6HI 3NFSH 5I18H 3MV8D 4PLNC 4DGIL 3QEHB 2F54E 4UIKH 5E8EA 4LPCA 4AIXA 3MMEA 3BRGC 4LLDB 2FECL 4KQ4H 1HWGB 3BZFB 2VZSA 1IE5A 2GT9A 5E9DD 1RULL 5DJXA 3EAKA 4IEFB 4NQED 3DO3A 4JDZA 5F6HJ 2DKUA 1FFPB 5FOBA 2Z93A 2E6PA 4NQDE 5KSUA 1RUQL 1JRHL 2RR3A 4HPOH 1KLGA 1XF1A 3OJVC 2Q1EA 4UDUA 1JGDB 3MRLB 1HIMH 2KQMA 2P5WD 2DL9A 1UT9A 4QY8A 1WICA 1UXWB 1NFDE 2CGRL 3ME0A 4C4KO 1UYWH 2YUZA 1ZT4B 2R23A 1JHKL 4FQ2L 4N8PA 5JR1H 3LKSB 5CZVL 1UH2A 5A2JH 1GH7A 4QO1A 2HKHH 2YN3A 2IBZX 3MLZH 4KTDH 1PZUB 1A7PH 3I85A 3V7AE 4GBXC 4H8WH 4CDGC 2ZOLB 1CICB 3ARFA 1BQHB 3VRJB 5I2IA 1FDLL 1QLFB 1QUNA 1P7QB 2Z8SA 3SDXA 4DOHB 1TJGH 1IAKA 1RZJC 4UB0H 5GS3A 4HH8A 4QXUH 5ADOH 4LHUB 4MA3A 5IIEA 3GBML 4WENB 3N1FC 4D0CB 1ZHNA 4DKFH 3IJSA 3Q0HA 1IC5L 4KH2A 4N5ED 3DO7A 1U8MA 1FZMA 2ARJB 2IBGA 5J12C 5ISZB 1R3HA 1ZHLB 5I1IH 4RMSA 5FYKH 4KK9D 4G6ML 1MREL 1SMOA 5ABDE 4GH7B 1JF1A 3WFBH 2D03H 5E8EB 1ZLVH 1MOEA 4P5MA 3MMEB 5D7IE 1NSNL 4F8TA 1H5BA 4XPHH 5FO7A 3AY4A 2GT9B 5DJXB 4YHKL 1IGMH 3T8XA 4JDZB 4ELKB 4JB9H 4GKOA 4UINL 1NLDL 2V5SA 1U3HA 2HVJA 2ZCLH 3LV3A 4QRTA 5FOBB 1J87A 5D2NC 1FPTL 1G6RA 1HZHL 1OM3L 5KSUB 5CP7A 2BHYA 2D9QB 4OLWL 1KLGB 3I3BA 2XY2A 1SQ2N 4UDUB 4JFFD 4OD1L 3CIQA 3O6KL 3H42L 2N56A 1I3GL 4GAJH 4L9DA 1UM5H 3U79A 1A6UH 4S1DC 3FT3A 3QA3A 2VLME 4LQFL 4WI2A 4LCIH 2X4OA 4KVNH 1CLOH 1IC4L 5DD0L 4NQCD 2ZCHH 4JFZH 4L8DA 2VH5L 2DIBA 5GRYA 4AEHL 2BNRE 3TVMA 3OB0H 3MRDA 1JNLH 3WNMA 3G04B 3QAZC 2MOVA 3MRFA 1PKOA 3ARFB 3O2WH 3IYLW 1UA6H 5GRVK 5I2IB 3KLAB 5TE7L 1Q9LA 1K6QL 1IAKB 5ILTH 2EDKA 1DBKH 2XRAL 3U1SL 3UX9B 4DFIA 3L3OA 5HYJA 3VW3H 2RHEA 4MA3B 5IIEB 5DVNA 1OT2A 3IJSB 2P1YA 1FBIH 3DO7B 1KLFA 1U3ZA 1U8MB 1FZMB 2FWOA 3MLSL 3KJ6H 2APBA 4JFPA 5EIVA 1DEEA 2VLRD 3DTXA 3KDMA 4HC1L 5I8KH 5D7LA 1R3HB 2HKFH 4PFEA 3CDFA 1D3CA 4U2YA 2VDMH 2XA3A 1N6QL 2FEDC 1JF1B 4H0IA 1ZXQA 4KKAC 1Z9SA 2YUVA 1NFDF 2WINA 4P5MB 4XPAH 3KS0J 3WNPA 4PJHE 1I7TA 1H5BB 4UV7L 3LD8B 5FOJA 4Y8DC 2OXHA 5FO7B 5JIKA 1YDPA 4UV4H 3T8XB 1CDBA 2BCKA 4OZHE 4QTIL 3LDBC 4QRTB 2VLJA 2GSIB 3F7QA 3BH8A 2AJUL 1G6RB 4ETYA 3LPWA 5CP7B 4QKXB 4XVUC 2DQIL 4RAVB 5DYOB 3BP7B 3BSZH 4LCYB 3CPLA 4M43H 3FT3B 3WS3A 1RZ7H 3QA3B 1QBMH 5D2NA 1QVOA 2XKSA 4YUEH 2FSEA 2X4OB 1NL0H 4EI6A 3T08A 4H25A 2IALA 4L8DB 3RKPA 1DEDA 3MRDB 1JNHB 4Z77A 4F7PA 3WFEL 3P0VL 3MRFB 4LKXB 4HGMA 1GGCH 4NO0D 4PV8A 3IJYB 1Q9LB 5D72H 5EORH 3QXAA 5D7IF 3T4AA 3OG6B 3UBXG 1TTGA 1X9QA 5IFHL 3ZYOA 3QUXD 3QQ4A 3L3OB 4GBXB 3BKCL 5HYJB 3KPQA 1LE9A 5C0BE 2J2ZA 2V5YA 1YEEH 2DI8A 2V2TA 2FWOB 5F96H 4S1SH 1X5AA 2CUHA 5D6DC 4JFPB 1DEEB 3DTXB 3KDMB 5D7LB 3IT8D 4UTBL 4RMRA 5JHLH 5GRWA 1CXLA 4O51A 1U2CA 2YK1L 5A3IC 3MJ8A 1AKJD 2WINB 1OGTA 1F45A 3Q1SH 4PS4H 5J12B 1I7TB 1OQOA 3T0EC 1PYWA 2V17H 1YDPB 4WTZA 3FZUC 2BCKB 1T1WA 5DJ0A 4ZNEE 5IF0A 2VXTL 4ZUVA 2VRAA 1N5YL 2AS5M 4M6OL 1P1ZA 1MEXH 4V1DE 3LVEA 3I2CL 4X8XA 1TETH 1DQML 4MJID 3BH8B 2BNQD 2DOCA 1B88A 5GZOC 3IU3A 4HWEH 5BRZB 3SY0A 1DL7H 1ZTXH 1NCBH 1YEFL 4GW5A 3FRPG 3S98A 3WS3B 1WLHA 5D2NB 5IVZA 1QVOB 2L0DA 3QDJD 2FSEB 2HT3D 2YBRA 5F7WC 2E9WA 4EI6B 1A4JA 4H25B 4IM8A 1KXQE 2IALB 4JJ5A 1AE6H 3PQYE 3DXAE 3IB4A 4Z77B 4F7PB 5IVXA 3TYFB 5HHNB 5T1LD 3DBXA 4PV8B 5A40E 1FIGL 2GAZA 4HGKC 4L3EE 3QXAB 3OMZA 4DGYH 4JN1L 4PJHF 3THML 1MAKA 1PAMA 3QQ4B 1LWRA 3QAZB 1MHCA 4N90E 3KPQB 4OZHF 1LE9B 1FGVH 2NXZC 4D0BA 3GSVB 4YHIA 2V2TB 2CLVA 2CKBL 4NIKB 1RV6X 3SE3C 2ATPB 3SDAA 4FTVA 3NIGE 1LEKA 5CIPA 3PP4H 2IPUK 1LO4H 3EUUA 4JFEE 4KKBD 3RU8L 1VERA 4O51B 4K94H 4HEPG 3K8LA 1JP5A 3MJ8B 1OGTB 1RY7B 5E0QA 3ULSA 5HD8D 2F15A 4RISH 5D6DA 5I71C 1CWVA 1INEL 1BBDH 2ZNWA 2EYTA 3N1QC 1PYWB 1AFVH 4MSWB 3CGTA 1FJ1B 1LGVA 4UBDD 4PRAB 1T1WB 3HCVA 4KJYA 4ZUVB 5IF0B 1RIUL 4HCRA 3CUPA 4KROC 2WWKT 4YDLC 3TO2A 5T5FL 3ISWA 5FKAA 3T0EA 1D9KC 4M6ML 3GMPB 3SY0B 1HHJA 4PJ9D 1H3GA 3LDBB 1KELL 1NMBH 4X4ME 5FYJU 3SE9L 3WNOA 2YD2A 4U1MB 4GAGL 2R39A 1QKZL 5IVZB 5MEOA 3MV01 3STZA 2YBRB 4ZSOA 3S6CA 2FEEL 1A4JB 4YPJA 1SJHA 4H20L 4JJ5B 2R69H 4XHJD 3NAAL 5IVXB 1DQQA 4LSPL 2R8SH 2X5PA 4L4JA 3DBXB 4OLEA 4BSWA 3QWOA 4KTEH 4ODWA 4JR9H 1EVUA 2GAZB 5D8JH 3OJMB 3M1BA 3ARWA 4E41D 4Q9RH 1MHCB 5J1TC 1FG2A 4BFIA 4U49A 4D0BB 3TESA 4YHIB 5JW4N 2OBGA 3UTSA 2CLVB 3MLXH 5DHVA 2OL3A 1MI5E 5IKCB 2DQDH 1LEKB 1GOFA 3B6SB 5CIPB 5IESL 4Z7NE 1EO5A 2ENSA 4AJ0A 3SDCC 2ED9A 1RJZA 5CSZA 3X17A 2YEZA 2LU7A 1AO7E 2YZ8A 4OSUH 1L8JA 1FORL 3SE3A 5MHSE 2EYTB 4YDJA 1FNGA 1VESA 2Z4QB 5HI5D 1BJ1J 3HCVB 3PHOB 4YXHH 1DANU 4NJ9L 3CUPB 3HC4L 3RA7L 2R1WA 1F4HA 4CU6A 1KJMA 3TO2B 5HYQA 3CXDL 5FKAB 3T0EB 3RX7A 4JFYA 4LGSB 5DI8A 3RI5F 3BPNC 4Z9KB 3HMXL 2H6PA 2YS4A 4EDWL 4PJGE 3U2SA 5EZOH 1A6AA 5DRZA 3TJHD 3STZB 4X8JA 1D9KA 4ZSOB 1XCTA 2E3VA 1SJHB 3LEYH 2B1HL 3KVQA 2EEAA 3NIGF 4R6UA 2AVGA 3RBSA 1BFTA 2EYRA 4AK1A 3BKML 3CNKA 4BSWB 1JBJA 3QWOB 4KZEL 1T3FA 2R2HA 4TSBL 3M1BB 2A9NH 3V52L 2YD7A 2AP2A 1OAYL 2YUXA 3IXAA 4O9HH 3Q2CA 1U8LA 2BDNL 3V4PH 5FDYA 1FG2B 4CAGA 2GCYA 3OAYK 1BD2B 4BFIB 1OB1A 4NO5A 3UTSB 4L4VD 4Z7QE 4X4YB 1MRCL 4LARH 5DHVB 1GGBL 2O5YH 4AM0A 1CYGA 4KJWD 3TV3H 4E9LA 1S7QA 1PX4A 2NXZB 1RJZB 2W1NA 5CSZB 4ZPVA 2DQHH 1S9VB 1GGIL 2AK4B 2NY4D 4YDJB 1FNGB 2XZQL 5DXWA 2WMPA 3SDCA 3IS0X 1KYOK 1NQBA 1LHZA 4Q58C 2VR4A 5BQ7A 3MXVL 4ZS6D 1AQKL 1KPRA 1SEQH 5I71B 1DUYA 2R1WB 2XQYG 4IMLA 4U3HA 1KJMB 3GSWB 5HYQB 5DF0A 3Q6GL 4JFYB 5K9KA 1K5NA 2X4UA 1X5GA 5JW4R 3FB7A 5L2KD 3V7MA 1FNAA 5FF6A 3VXTB 2H6PB 4N1EA 4KROB 1OF2A 4DKEH 3BZ4A 1NBZB 4G8GD 5CMAA 4YDLB 3U2SB 2Z91A 1A6AB 4XPBH 1WF5A 1NAML 3H0TA 5DRZB 5E2TL 4X8JB 1D9KB 2R4SL 2ZNXA 2C3HA 4AH2A 1OLZA 1H9VA 5D1QD 1H3XA 4YAQA 4D3CH 2FX8H 5FKPA 3VXSD 4Z7NF 2EYRB 1F13A 1RIVH 2LTQC 1KSRA 5BV7H 1T3FB 2R2HB 1GXEA 1E4XH 3BIAX 5F1NA 4H8WC 5E94A 3IXAB 5FCSH 1JJUA 3B43A 5HHXH 1U8LB 3JXAA 1D5MB 4KDWA 2APVA 4GJTB 2GCYB 1T7XA 1OB1B 5A16A 4LU5L 4NO5B 1YPZB 4OLZH 4F7TA 3BP4A 2VABA 1G7HA 4OCWH 5F7EL 4PGBB 4AM0B 4X98A 5CEYA 3IVKA 5B4MD 1S7QB 1PGRB 1JL8A 1D6EA 2W65B 1IM3A 4QT5A 1KCVH 4CU8A 2VSDA 3M07A 4PJGF 3SGEI 5IOPA 4FABH 4OBSA 3GSNL 1NCAH 3OKKB 3R1GL 3RUGE 1ZT7A 3SDCB 1BWMA 1LK2A 5EDXA 4PD4K 4LF3A 5BQ7B 5IEKA 1IEHA 1JWUA 1KPRB 3HR5A 1DUYB 4IMLB 4P2YA 1X5JA 1T1ZA 4Y5YC 5K9KB 5E7BA 3KXFA 2OLDA 1K5NB 2V5TA 2X4UB 3BP6A 4MQXC 3FB7B 4IRZL 1OSPL 4N8CL 3QXDB 4C4KT 1T0NB 2ILLA 1E6OL 1OTSC 2A1WH 3QZWG 4WFHE 1OF2B 3BZ4B 1YEJL 1P53A 1Z3GL 5CMAB 3ULUD 2OSLB 3H0TB 4LNRA 5E95B 2XFXA 4Z7QF 4AH2B 3BPNB 3E2HC 4LAQL 3TBWA 2EXWC 3GIVA 1QP1A 4YAQB 5DD1H 3GHEL 1VB9A 3K8MA 5FKPB 1A6WL 3U0WH 2OJZH 2XWBA 1W72H 4HDIA 3KYNA 2CRIA 1JPGA 1KEMH 3TP4A 3VXQA 5F1NB 1X5IA 1SJXA 1NC4A 2HJKA 4KRPD 5EO0A 5TH2A 4AYFA 2B2XH 3GI8L 5SX4I 3SQOH 5A16B 4ODUA 1A7RH 2AJSL 3BP4B 3I3EA 2VABB 1G7HB 3LMJH 4OLXH 3QUZD 1ZVHA 4GG8A 5BVJB 4X98B 5CEYB 2J88L 1D6EB 2KQNA 1IM3B 1LQSR 4QT5B 2UZIL 3LIZH 5IOPB 3FO0H 4BUHA 2HT2C 2VISB 2KH2B 2PF6A 3QDGA 4WUKH 5CS7A 1F90L 1ZT7B 3RHWK 4IS6A 1LK2B 4LF3B 4GRLA 5IEKB 3IU4L 2DLEA 2UUDH 2XKUA 1Q0YL 5KSVA 1U3YA 1LVEA 1T1ZB 5EULV 1DSFL 1N0LA 1XGYL 1GPOL 2R0LH 3KXFB 1MFCH 3BP6B 1YNLH 4HXBL 1YJDH 3STBA 5C0CE 3SJVA 2EIEA 1BF2A 2AQ3A 1DBJH 1QNZL 2DIAA 5J06A 2CD0A 1A5FL 2B0SL 3ZL4L 5H94A 4MDIA 3W9EA 3DX7A 1E4WH 4Y5YA 3LEXA 2XFXB 4KMLB 5FIEA 4MAYC 2OJEA 3TA3A 2OK0H 3TBWB 3GIVB 2VDOH 4JHAH 3MODL 4D9RD 5DC9B 3I6KB 4CDHA 2XWBB 3MBXH 2P5EA 1QLEH 4HDIB 1J88A 2UZYB 3KYNB 3MBED 4BQ8A 1MLCA 3K2MC 3QHZH 4MXQC 1JPGB 3VXQB 3E2HA 4EBQL 2DM4A 5FDWA 2JJTC 1QSFE 1WEJH 1P4BH 5DD5H 3ES6A 4OLYL 3KLDA 1NC4B 2HJKB 3RUGF 4Z7VA 1JZ4A 4X7SH 5EO0B 5TH2B 2LTQB 1JF5A 4O58H 4ODUB 1RUKH 2NZ9C 1L9NA 3X11B 4YFLI 3ULVC 5TDPA 4GG8B 3PWNA 1H3UA 1A14L 4HWBH 4KKLC 5AYUH 5JOPD 5L2JB 1DBAL 4NKIH 4ELMA 4OI8A 4HIXH 4X99A 4FQXD 3QDGB 2NX5D 1O5DT 5A2FA 2XYCA 4IS6B 4XPFH 1UFUA 4HUKB 2IMMA 5AZEL 5M95B 2YRPA 3A67H 4JKMA 4X6EA 2R15A 1Q0XL 3QPQD 3G08A 1VEPA 4XHQA 4PG9A 5FYLD 3SJVB 3MYZA 5CD5C 4J6RH 2DD8L 3QG6A 4JVUA 2C3GA 5H94B 4MDIB 4I8DA 2HAZA 3W9EB 3DX7B 3ARRA 4Y5YB 3VGHA 5D7JD 5EBWB 3LEXB 2OJEB 3HE6C 3MX0A 5HHVL 1A1MA 2Q86A 3X13A 3ARBC 5FV1L 4MA7H 5INCA 2EZ0C 1G0XA 2P5EB 1B9ZA 1RUMH 3GJFA 5GHWH 3IGAA 4M7ZC 3DGCR 4U33A 4HFUH 1OAUH 5MP6H 2YR3A 4MAYA 4I0PA 4RGNC 2F54D 2ICES 1WWAX 4TUKL 1A21A 4Z7OE 2J8UA 3E2HB 1HDMA 4FXGA 4FP8H 3VXME 5EWIL 5FDWB 1RSFA 4Z7VB 3ES6B 3LKRA 4YWGH 1YN7A 1SYVA 2PTUA 4D2NA 4MXQA 1E28A 2QSQA 5TDPB 4RX4A 3UTTE 1EDQA 2JJTA 1IGCH 2YRZA 1QRNA 1EJOL 2IGFH 1JUFA 4NQDD 2JJSC 3HNSL 3R8QA 3O3BA 1J8HA 3VRIB 2YPLE 4ELMB 3O3EA 1XGQA 2PR4H 4X99B 3HNTH 5DWUH 3IAPA 1DQJA 4OLVH 2ICEA 2C3VA 5E03A 4OCLC 3WD5H 4LSSH 1HOCB 1LMKA 2NY2C 4A2LA 5KVGL 4X6EB 4KDTA 1NBVL 1R0AH 2FZ3A 4OCXL 1QSVA 4MB4A 3G08B 4R4FH 1I9IH 4U6XA 4HKZA 5IBLC 2JLLA 3QHTC 1IZKA 1H0DA 2A77L 4PG9B 4BFEA 1WZ1H 1K3ZA 1MCIA 2ZUVA 2WLZA 1CE6A 5K9JL 1P84K 5I30L 4P3DA 5EN2A 3DMMC 1VHPA 4HMCA 3B8YA 4POYA 4TVPL 5F93C 2ITDA 2VDKL 4P49A 4JG0H 4PJ5E 2YN5A 1I3UA 4ODTH 4N0UE 5IW3A 2Q86B 3RQ3A 3X13B 4WEBL 3QULA 4XCFL 4WY7H 3GJFB 5I1HL 3IGAB 4MAYB 4HUUA 2ZUWA 3MV11 2QHLA 3ARXA 2J8UB 3HE6A 2QSCL 1HDMB 3K2UL 4FXGB 4NWTH 3ARBA 2FX7H 3JBG7 4JRXD 3LKRB 4HWUA 1YN7B 3OXRB 1SYVB 1EIBA 5FUOL 5AD0A 3ROLA 1RZFH 1U8JA 2D0GA 1IKFL 4JZOA 1E28B 3T0WA 1PEWA 5HI3C 5B3JE 4PP8C 2JELH 2FB4H 4FNLL 1F3RB 1QRNB 3CFCL 3VMNA 1JUFB 3HZVA 2W9EL 2O61A 3B8SA 3GKWL 1J8HB 3WN5C 3GSUA 4W6XB 2NQCA 4NJAH 1G84A 3O3EB 1XGQB 3LZFL 2VLMD 1GIGL 2JJSA 2ADIA 4H1LH 1DQJB 2DRUA 2ICEB 2C3VB 2ZKHH 2CLRA 2VIRA 1FO0H 5FM5O 2MFNA 3RZCC 2BNRD 5FUCC 3DX6A 1AJ7H 2FZ3B 4U6XB 1OP5H 4Z7OF 1AGBA 4HKZB 1H0DB 1DCLA 1MJ7H 5JNYA 2X1OA 1AI1H 4MS8D 1K2DA 3MRQA 3V6BR 5KW9L 3P11L 1GAFL 1CE6B 3EO9H 4P3DB 1G9EA 3KLHD 3HUJA 5EN2B 3WXVH 3HZYA 1RVFL 4BKLA 1VGKA 1OAXH 1JCKA 5E00A 3LH2L 3FT4A 1LDPH 2C26A 5JHDA 4J3XA 1QFUL 3QULB 3B83A 2EEDA 4J4PC 1MPAL 1AR1D 4U1SA 1VSCA 1KN2H 4HUUB 4OLUL 2CIIB 3HE6B 3WKMH 1PSKL 3DX8A 5IHLB 1DFBH 3ARBB 1CFNA 5E5UB 4J3UA 3RTQD 2ZPKH 4M7KL 3UMTA 4M7ZB 4Y4KC 3MOAL 3UPCA 1NH6A 1J0HA 4RGNB 5AD0B 4D94A 1KXVC 3ROLB 4WI9A 1U8JB 3HG1E 4DKDC 3MOBL 4JZOB 1NGZA 4WW2F 2PTTB 3QUMH 4HK3N 5D96C 4XBPA 4YHLL 2CR6A 3RIFK 3WHXA 3HZVB 3O4LE 4PRHE 4PPTA 3BO8A 25C8L 4XMPL 3ZT7A 4KK9C 1QPXA 2O61B 3R06A 4AQ1B 5DTFA 3A0OA 2P24A 3GSUB 4TOYL 3TBVA 2VDRL 3MV7E 4JRYE 4JHZA 1KB5L 2VIRB 2VXUH 1IBGH 2Y06H 5DR5H 5E6ZA 3DX6B 3H8NA 4F58L 1QOKA 4OGZA 5C6TL 1TMCA 1AGBB 5E9DA 1G9MH 3H9ZA 4U7KA 5JNYB 4NQEA 1UM4L 4K23H 3OF6A 1PX3A 4R7NB 5GS2H 2WWMD 1K2DB 4IBLT 3LB6C 3MRQB 4R90H 3REVA 3S5LA 3RZCA 2H2SC 5KSBE 2NY2B 3HUJB 2BY2A 1L4IA 3BMVA 5EFIA 4YHOL 2MQCA 3HZYB 3GJEA 1EUTA 2HWZH 2AEWA 4BKLB 1VGKB 1W2KT 4X80L 1LE5A 4OAWA 1IQDA 1BGXH 5C0BD 2FIKA 3TO4D 2VLLA 2HJFA 3FT4B 5B3JF 5GRJL 5TQ2L 1NCDH 5FECA 5JHDB 1ZK9A 4PJ8D 2XXCB 1XF3A 3SE8L 3VMOA 3DMMB 3NH7L 4U1SB 4KKCD 3P73A 4PB0H 4U0RC 1ZANL 2YHGA 1T03H 1CXFA 4RDQF 4GXVL 4YDIL 2YWYA 3DX8B 3BXNA 2P7TA 1CFNB 2ORBL 5CEZH 1P6FA 4MCZA 3AAZA 4J4PA 3L9RA 5BV7C 4QHKJ 4NNYA 5EOCH 4LSTH 1CDGA 2HJLA 4YBHA 3SQBA 1A22B 4V1DD 1NMAH 4XBPB 3WHXB 4HJJL 4Y4KA 3OAZH 5HJ3B 1RZGA 1CZ8H 2VN4A 3NFPA 5FCUL 3R06B 4O2FA 5GGVL 5DTFB 4FQIH 1SM3L 2NCMA 5TQ0H 3TBVB 3NACL 3EOAA 4MYWB 4BZ1L 4OCRH 5F9OL 3DVNA 1JGLH 1HYRC 1NAKH 1V3LA 3KPRA 3LOWA 4LIQE 3WN5B 2WQ8A 3CLFH 4AL8L 3PQYD 3M8OL 2FIRT 3DXAD 4WO4D 5HPMA 1TMCB 5E9DB 3NABH 4KAQH 1V5JA 4NQEB 3JUZA 4L3ED 4XP4H 3NCCB 1AY1L 2VQTA 3VG0L 3REVB 1TVHA 2XTJC 3RZCB 2HFGH 1YN6B 2J5LC 3GJEB 3UO1L 4N90D 1LE5B 4OAWB 1IQDB 1QO3A 5HDLA 1YY8A 2FIKB 2HJFB 4JFFA 1WBZA 4GG6E 5FECB 4OCSL 3SN6N 3ERYA 1XF3B 2CIKA 1IQWL 5IMKA 2X4QA 5EU7E 5FYJL 4JFED 4UTAL 2EECA 3H3KA 3TT3H 4OQTH 2CJUH 3BXNB 2P7TB 1BREA 2IANE 5E4IA 3QUXC 4MCZB 3PL6D 3EDEA 3L9RB 5T33H 2VC2H 2XZCL 3PUCA 4XNYL 4NNYB 2N7AA 4ZMAT 1QFWI 2BNUA 2HJLB 3RWDA 3SOBL 5F6IC 1DLFH 4OT1H 3PV7A 1FH5L 1PFCA 1UJ3C 3C09C 4Y4KB 1RZGB 5JLZA 3GMOA 5CJOL 2AERT 4OGYH 4H1LG 1YNKH 3NFPB 4O2FB 5KSBF 4LCWE 5D96B 4LRIC 3EOAB 2X1PA 3DYPA 4WUUE 3DVNB 3W39A 3GUTA 2IWGA 3V79C 1VCAA 3KPRB 4TULH 1SY6H 4MA8L 2AJZA 4ZD3H 1TVBA 5MERB 5FB8A 3ULUL 1Y6NR 1CBVH 1UQSA 4GLRH 3CSYA 4XNUH 4UIKL 4DEPC 1J05B 4JM4H 1TVHB 5DFVD 4OGAC 4PYHA 3MRGA 4YBLC 4NC2B 3CK0H 1ADQA 4JPKH 1QO3B 3CC5A 4FQHA 1YY8B 3MJ9A 2CQVA 4OZGE 4JFFB 4XX1E 1WBZB 4JZJA 2CIKB 3TJEH 1MI5D 1DJSA 5IMKB 5TGBA 4XCCH 3KHQA 5CFHA 3PGFH 2YRLA 1T7YA 3PG2A 4RMTA 1I7UB 3BKYH 5JW5A 4X9FA 2G2RA 2X70B 1AO7D 2QBWA 3L5XH 2EDEA 3JV6A 2AEIT 3BD4A 2GJ6E 5HGDA 5MHSD 2DQJH 1UYWL 4NO0A 4U0RB 1EBAA 4OM0L 2BNUB 2IEPA 1R3IH 2QQNH 4R3SA 2EC9U 2MSPA 2E8ZA 3OZ9L 4HT1H 3ZHDA 4FG6D 1W72A 4KTDL 3QUXA 1A7PL 1NCNA 3O0RH 2R9HC 5HI4D 2AJXL 1UACL 2PW2B 3QI9D 4B7IA 5BV7B 3GMOB 5ICYA 3BGAA 4KHXH 5LAXA 4JKKA 1DP0A 4KI5C 1UVQA 4L1DA 4UB0L 4ISVA 3G9VA 3O4OC 2QQQA 1UJ3A 4X6BA 1CLYH 2CDEA 3C2AH 4ODVH 2Y7QA 4ZTPH 4DKFL 3S4SG 1TVBB 5FB8B 1XGUA 4LRIA 5FHBH 4LPVA 1UQSB 1CFVL 2NY0D 5I1IL 2RBLA 3CDCA 3S35L 1CE1H 3CSYB 4FQPA 3RY4A 3LEVL 1F3JA 3OKEA 4A6YH 3DWTA 3MRGB 2BNQA 4L8SC 5GSRA 1PVHA 5I1DA 3CC5B 4FQHB 1QBAA 4K8RD 4F33B 3L7FA 4JB9L 1EO8L 1DBMH 2XTJB 3UXFA 4C59B 4WFFE 3FQUA 2J5LB 5TGBB 4CJ1A 3L5HA 3QDJA 5JW5B 2QHRL 2G2RB 3HPLA 2E8YA 1HSAA 3JV6B 4GAJL 3RVXD 2NYYC 2V7NA 1A6UL 5HGDB 1TFHA 1E0OB 3HFMH 1E6JH 3MCLL 5T1LA 4NO0B 2HFTA 3IKKA 3HMWH 1DVFC 1G7PA 1CLOL 4R3SB 3SKUD 2GITA 3WHE0 5JOEA 2X4PA 3X12A 5IHUL 1W72B 4WHYG 3QUXB 4Y4HD 3DHJA 4IRSD 3D25B 4U1JA 1BJ8A 3O2WL 3QR2A 1FL6A 5ICYB 1UA6L 2L7JA 4JJHA 4RGOH 5LAXB 4RDQG 1G6VK 5F6IB 1EVTC 1UVQB 2AEQL 1YMME 3C6LD 4ISVB 5ILTL 1DBKL 1CD9B 2Q87A 4OZGF 3VW3L 1UJ3B 3C09B 4X6BB 5HI5C 5FYLL 4RA3A 2Y7QB 1JK8A 3HN3A 4DW2H 2ZOKA 3QG7H 5SWSE 1A7QH 1QEWA 1XGUB 1E4XI 4NKQB 4KY1H 4I3RH 4XP9L 3WO4C 5LBSH 2HKFL 2VDML 3DX9A 3S3PA 1NLBH 4L4TE 3QXWA 1F3JB 2LU4A 3RWCA 3MSPA 4X5XA 3OKEB 5I8EA 3ZE0E 2BOCA 2A74A 2I9TB 3K7UA 5J4MA 5GSRB 5I1DB 1QG3A 1MVFA 3QQNA 5M94B 4P23C 3WUZA 4DEPB 5ANMA 5CJ5A 2X41A 1BIIA 4YBLB 5BOZG 3FQUB 2C1PA 2OZ4H 1AR2A 7CGTA 4L8SA 1X5KA 4PY7A 3QDJB 1EEYA 4R26L 1NFKA 4JVWA 4OIIH 4U6VH 5J9PA 3HPLB 1HSAB 3BSZL 2DDQH 2V7NB 2X4TB 2NW3A 4DTGL 5T1LB 4QGTA 1BF8A 4JFDE 3V6FA 1SVZA 1G7PB 4UT7H 2GITB 2X4PB 4ODHL 3X12B 4PJ7E 3RJQB 1W0VA 3D6GA 3OJDB 4KJWC 1J5OH 4U1JB 3DV6A 2J12B 1FL6B 1GGCL 5F44A 5C3LD 3VGAC 2QV2A 5EORL 1S5IH 4WFHD 1ITCA 3VA2C 1HNGA 4JN2A 2DYPA 2NY4C 4I2XE 5GRUL 4M7LL 1CDJA 1J18A 1KTLA 2IF7A 3FMGH 2Y5TA 4EEEA 2DMBA 4JAMA 1P4IH 1IGYA 1JK8B 4TSAH 3X3FL 2ZOKB 4ZS6C 5F96L 1QEWB 5C07E 4YO0B 5C0RL 4PJFA 3EZ8A 3O4OB 1F5WA 3PGDA 2BSSB 5JHLL 4KHTH 2EDJA 5ESVA 3DX9B 2VWEC 2I5YL 4GRWE 3TT1H 2ENYA 4X5XB 3UP1A 2BOCB 4S1QH 2A74B 1CDHA 4G6AD 3S9DB 1CGWA 3GZKA 4DZBA 4LSQH 5T3ZH 4KVCH 4I0CC 4OV6F 3LPFA 4PJXA 4NRZA 1HKLH 5ANMB 1BIIB 3ZSSA 5TE4L 2C1PB 3TN0C 5JO5B 2OI9A 3SKOA 5TPWL 1JI1A 4L8SB 3FQTA 3MLYL 4PY7B 1A7NL 1EEYB 2E9BA 4DQOH 4NUGL 4HWEL 1KFAH 4JPIB 2PYEE 1NCBL 4PJIB 4PRPE 4K7PH 3GNMH 1D5XB 3U6RA 4MB5A 2NW3B 4E5XB 2DQTL 3V6FB 4D9LH 2AXJA 1QA9A 4EQ2A 1HKFA 4QHLA 2ADGA 1RI8A 1AE6L 2BFVL 5EBLB 3D39D 3SGKA 1NUFA 1W0VB 1NFIB 2F53E 3IAQA 2AK1L 4FFYH 4HUVA 4UT9L 5C9JA 4I3GA 2F5BH 1DVFB 5C0CD 3ZE0F 2NXYD 2OR9H 4X5LA 4L4VA 4PRIE 4PUBH 4JN2B 1I7ZB 5GRZA 2DYPB 4G5ZH 5JZ7C 1KTLB 3L3JA 5HHPA 3IFNH 5C09D 4JAMB 3QEQE 1FGVL 4S0TD 5HHOA 1QLRA 1IGYB 2HTKD 2YXMA 1IAOA 4KK5D 3MLUH 3NCJL 4EJ1C 5ENWA 3O8XC 3L3GA 4HQQH 4PJFB 5IFAL 2BVTA 2VXSL 3D2UD 1RUPH 4HXAH 4L8BA 4FFZH 3PGDB 3RY6C 3BPCB 3PP4L 3T65A 1LO4L 2H1PH 4K94L 4FQJH 4RFOH 1YEHH 2A9ML 2QTEA 4JVPA 2GJZA 4QRSA 1QSFD 2A2QT 1OVZA 2JB6A 3CDGA 3WO4B 4H1LA 1G9MC 1AFVL 5I75C 3PP3H 5IJKC 1K8IA 1FO0A 4PJXB 1EMTH 3ZKQD 4PJ7F 5J8OA 1T66C 1WIUA 2XN9A 2YD1A 4G8GA 3GBNH 3SKOB 1R5VB 3RIFF 3FQTB 1XR9A 1IJ9A 3L1OH 3W11C 4NYLA 3DUSA 4P23B 4LFHD 1MCKA 2DLFL 2P42B 3KHOA 3S88L 3LPGA 3PF2A 1NMBL 3IAGC 2P47B 3U6RB 4XMLH 2WQRA 3TN0A 4TNVK 3ZTNH 4Y2DC 4KRPC 1X4ZA 3NVQA 4JO3H 4ZO8A 4NGHL 1QA9B 4JO4L 4QHLB 1S9YA 3QIBC 5D9SA 4JPVL 3QUZC 2OQJB 3WCYA 3BKJL 4NCDA 4YE4L 1HILA 1BAFH 4B53A 1PW3A 4HUVB 5C9JB 3F7VA 4GRWF 1B2WH 3BX7C 2EC8A 3MLWH 2Z31C 4L4VB 3CVIH 3I9GL 2XACC 4LEOA 5DUPH 7FABH 4Q9RL 2YA2A 1ED3B 1U58A 1WT5C 3CU7A 3KR3L 5HHPB 3T4YA 3OAUH 4Y0GA 3HI1A 4C56E 5HHOB 1QLRB 4GAYA 3VGAB 1IAOB 5IB3A 1DN2A 3MLVH 3QUMA 5ENWB 3TC9A 3L3GB 5D2LA 3VWJD 4MWFA 2JCCA 2NLJA 2NY4B 2AKRA 1KJ2H 4RBPH 5DJYA 3LS4H 2EH8H 4L8BB 2D7OA 3T65B 3ZYZA 5HDBE 4XNZC 4BK4A 5ADPH 4KPHH 4HMDA 3VXMD 2GJZB 2R0KH 3O8XA 2B7DT 4QRSB 5C0JA 3UYOD 3CDGB 2IPTH 4H1LB 3FT2A 3RY6A 1AD9A 1K8IB 1FO0B 5C2BH 1WV7T 2ZUXA 3UTTD 5HHME 2XN9B 4GMSL 1XMWA 1XR9B 1EZVX 3QXVA 1ZA3A 1MCPL 4NYLB 3NIDE 5IJKA 3DUSB 2C7UB 1YEGL 5T1MA 4DJMA 3Q6FA 2YPLD 5DHYA 1QBLH 3CVHA 5C2UB 3JZ7A 2LAGB 4M5YL 3TN0B 5JW4Q 3ARDD 5I19H 5IB1A 4TPRH 1S9YB 1KUMA 4DFHA 1CTNA 1KN4H 2JB5H 2KL6A 1HILB 3G6JA 1EGJH 2GIYA 3F7VB 5BS0A 4JG1H 5FUZH 4LVHC 4LRNH 3WUWA 1EA9C 4LEOB 3G5ZA 2ZG1A 3QUZA 1U58B 2JKXA 4FQXC 4J3SA 2E7HA 5EZJB 2BVYA 3T4YB 4UT6H 3HI1B 1NDGB 2DF3A 3N9GL 3RWJA 1TDQA 5CSGA 3TPUA 5TDNA 4GAYB 5IB3B 3ILPB 4PJ5D 3QUMB 1J12A 3SHSA 3VDBA 5D2LB 2VKXA 4MWFB 2O5YL 4CRPA 2AKRB 3EYSH 5DJYB 2BZDA 4JFHE 1WT5A 4LMQE 3QPQC 3NCYP 2EO1A 4N9OB 1YUHA 1Q38A 3CFJA 3G5YA 3O8XB 5HBBA 5C0JB 1TTFA 1PEZA 2HLAA 3FT2B 2MWCA 1IC7L 5MEPB 4NBXB 1WAAA 1R3JA 1CFQA 5T3XE 4Y8AA 3EOTL 2N7BA 1SEQL 5INDA 3PWPA 4PTTA 3UC0H 1ZA3B 5I75B 2ZJSH 4UDTA 1DE4A 4M00A 1ES0A 1BWWA 3S4SB 4K7PX 2ZUTA 3RGVD 3G6AA 3P0YH 5T1MB 1PZ5A 3Q6FB 5DHYB 1ZLUK 4NO3A 3CVHB 2WSKA 2CK0L 4H88H 4XPBL 5BO1H 3CSPA 2N4IA 2UWEE 5F97E 2Z0BA 4F7EA 5IB1B 4FS0A 2WUCH 3V4VH 1DTUA 1EFQA 4F37K 2FX8L 3RY5A 5CWSA 1U9KA 4FQQA 1MRFL 4Y2DB 4B0MM 5GS0H 4KRPB 5HDBF 5DEFA 4IOFD 3G6JB 4K71C 2WLYA 4OQTA 5BS0B 2X9WA 3V4UL 3WUWB 1YNTA 3QIBB 3G5ZB 4XP1L 3QUZB 3JWOH 2EXYD 2WP3O 3LKQA 2D2OA 5HHXL 3RWJB 4JGMA 3TPUB 4R0LC 5TDNB 2VXQH 3MUY1 2Z31B 5CGYC 5E5MB 3CMOH 1PG7W 4EN3D 4HUXA 1M71B 5HGGS 5CAYB 5E08H 3NIDF 1LO0H 4FQXA 2NX5A 3WS6C 4WDIB 4ZDHA 4RA0C 1KCVL 5GRXG 3B3IA 3CFJB 2IFGA 3G5YB 1K85A 4JPWL 3VXRB 2QLVB 4HAGA 2HLAB 2RCSL 1KENH 1ZKAA 4IJ3C 5EU3B 4M3KB 3T09A 1CLZL 4PP2A 1NCAL 4FFVC 1SY6A 4XNZB 3HG1D 4MHHG 4GQ9H 3NGBC 3GM0A 3UJTH 2IBBA 4LSVH 1R3JB 1CFQB 5FFLA 2Q76A 5INDB 3PWPB 4PTTB 3MGOB 1IGIL 3O4LD 1N7MH 4PRHD 4UDTB 1DE4B 5HYSG 1ES0B 4JM2F 3G6AB 1M6OA 3ZDYE 1PZ5B 5HGHA 1VEMA 4NO3B 3UTQA 4DOHE 3MV7D 2DQCH 2GY5A 4JRYD 2NY3D 4L5FH 3CLEH 2P44B 1FP5A 2GY7B 3E8UL 4F7EB 2DBLH 3FONA 5CWSB 4N0FA 4IRJD 2OJZL 3UZVB 5ISZE 2AJVL 2P49B 2Z92A 5DEFB 3LHPH 3K4ZA 3H2WA 4G6KH 3LY6A 1X4XA 1I9RL 1NGPL 3GMRA 4GXUN 4PV9A 1YNTB 4N0RA 2VDLH 2FATL 3MACL 2PCPB 3MXWH 3LKQB 1P6AB 3C08L 3QJHA 4LVHB 1IVLA 4KJPD 1A7RL 3VFTA 1RHHA 1UKTA 4HUXB 1UH3A 3LMJL 1NFDA 1U8OA 4FQXB 2NX5B 4K8RL 2ZSVB 1X5LA 4G6JH 1LO2H 4R0LA 4LLWA 4ZDHB 3FL7A 4MS8C 4JZNA 5DJDA 1F6LL 1M7XA 2BVUA 4Z76A 2YD5A 3WXWL 2WIMA 4Q7DA 4AEIH 5E8NA 1Z0MA 5C0AA 5JA8B 2UWEF 1MCOH 3W2DL 4PP2B 2MNUA 3Q5YA 3WS6A 4DUWA 4S2SA 5AZ2L 4AG4H 1A6TA 2Q76B 3QH3A 2IQAA 5ICZA 3MA7A 3F58L 1AR1C 2Y6SD 1MFCL 1YNLL 2R29H 1YJDL 2B39A 4XCEA 3UJIH 4A6YA 4WHCA 5HGHB 3T04D 4FA8A 2ICWA 3WEXA 2PTVA 5DZNA 3UTQB 4BQ9A 1RUAL 5J6GA 3HZKA 4XPGL 5AAMA 5C7XH 3RTQC 2AV1B 1E4WL 2RB8A 3CFDA 2AEPH 2RQ8A 1ORSA 3ZKNC 3NPZB 1GZPB 2OK0L 4MB3A 2R0WH 2VDOL 2D31B 3FONB 3TZVD 4JHAL 4GO6B 2EDWA 5HDOA 3QCVH 5IM7A 4JRXA 4LEXH 3MJGX 1RJCA 2Z92B 2IQ9H 3QPXH 1CGUA 3H9SA 3FB5A 3GMRB 3QHZL 4H26A 5E2VL 1H3PL 2NY6D 4PV9B 1MY7A 1FQ9C 3EFDL 1H3TA 1P4BL 5DVKA 3I6GA 3QJHB 5GZNC 4K71B 4PGDA 2HFFA 4NN6B 1TITA 3N85H 3MNVA 3IDJA 3PJSB 1CG9A 1LP9A 3TH3T 2VYRE 3SDDC 1RHHB 4TNWK 3VFTB 3RDTD 2KZWA 4KRNA 2R0ZL 1U8OB 1OAKL 3RKDC 4HWBL 4O2EA 3VA6A 1FZOB 2E9JA 2HYMA 4R0LB 4LLWB 3X3GH 4WGVB 2WWMC 3HRPA 4K3EH 4JZNB 8FABA 2BNRA 2IAND 2Q7YA 4BFBD 4WW1B 5H8DA 1FRGH 5E8NB 5C0AB 3NZHH 1JWSA 1T1XA 4NZTL 1HCFX 2PETA 2BJML 4XPFL 4PLJD 4S2SB 4MS8A 4PJ8C 1A6TB 1NCWH 2CMRH 4U0QB 3QH3B 2IQAB 5DURB 5ICZB 4IJ3B 2EIBA 5K93A 1OQXA 2MHAA 5DVOA 4KMTL 4EI5D 6FABH 4OD2A 3NGBB 4LCWD 2D7TH 4A6YB 2WBWB 4LLQA 4AENA 3L6FA 3WEXB 1MAML 5J6GB 3HZKB 5DRNA 3QSKB 3BZEA 3CFDB 5HYJE 1ORSB 1TLKA 5C0FA 3TBSB 4WV1A 3EO1A 4GLRI 3GSRA 2IH1B 4ZOAA 3L3HA 1J7VR 2DB8A 3G5XA 5IM7B 4JRXB 1N8ZA 3BDYH 3RTQA 4TSCH 1I1YA 5D7LE 1MHEB 5D7SL 1OAUL 3H9SB 5MP6L 3T2NH 4XAWL 3FB5B 4ONGL 4H26B 1N4XL 4XBEL 3EOBA 1KG0A 3DETD 3ZDZE 1MJ8L 4ZUTA 4G80A 3I6GB 5I1KL 4YWGL 3RAJH 2HFFB 3MNVB 1MCQA 5KSAD 1LP9B 3GO1H 1RAMA 2F8VA 4XVSH 1UKSA 1FVDA 3UZEA 3I75A 4RMWA 3CXHK 4O2EB 3V9FA 2RJMA 4YDKL 3FCTA 5BRZE 3KPOA 1B0GA 2DQEL 3KYAA 4UUJA 8FABB 1RD6A 2BNRB 2Q7YB 2GJ6D 2NR6C 5SV4A 3C5ZD 4P2OC 5DWUL 3SCMD 1T1XB 4GOSA 2EDOA 1OHQA 5D2NE 3BT2L 1U8NB 3FOMA 4HIIB 2F19L 5DA4A 5TF0A 1JZ5A 1T80A 4NM8H 3WD5L 2PN5A 3DSNA 3S36L 5F7KC 4JQIH 4R4FL 3QIUD 3WIHA 2MHAB 3I50L 5C0BA 4BQBA 4OD2B 5JIIA 4H0HB 2H41A 1YEKH 3KYMA 4KI1A 4LLQB 2A38A 4PJ8A 4F57H 4UNVA 3L6FB 5ETUA 3A6OA 5EC1A 2J6EH 4FQLL 3MCKB 3FFDB 4GAFB 5DRNB 2ZCKH 1J0IA 3P4MA 4R7DA 5CJQL 3J8F7 2UY6A 5C0FB 4ZFOL 5H2BA 3TFKC 3GSRB 3EJYD 4JG0L 3L3HB 2AV7A 3V6OC 2D3VA 2EE3A 3G5XB 3P9LB 1N8ZB 4WY7L 1C7TA 3RTQB 5JMRA 1I1YB 5JXED 4R8WH 1DLHB 1KC5H 3SKNA 3EOBB 1F3DJ 3QIWC 1F4XH 3C9NB 1HINL 2V7HA 4V3DB 4JHWH 1BPVA 3L3IA 1MNUL 4ZUTB 3RX8A 4G80B 1AXTH 1C5BL 1J86A 1CVSC 4R4BA 4M1DL 4JFQA 1XR8A 4NBZB 2W0LA 2ICWJ 4WFFD 3O2VH 1FVDB 3I75B 3B5TA 4ZO7A 4RWHA 2K1MA 4WI4A 4XVJH 1ZLVK 4KGLA 5GIRA 1JFQH 1ZLSH 3KPOB 4UUJB 4YK4C 5HYEA 5LG1A 3SDDB 3F6LA 3PQYA 3DXAA 1UWEL 4TNVF 3O2DL 4KWUA 4WO4A 3NOIA 4CVWA 2W0FA 4TVPE 1DQLL 4EIZC 5GJSH 2V6HA 3FOMB 1Q94A 3WLWD 4L3EA 3BZDA 3T0XA 3RVWD 1R3LA 2ZKHL 4NZRL 5DMKA 5JW4M 5CILH 4ZO6A 3VXNA 4OM1L 5CINH 4HG4K 1IMHC 4P2OA 5IVXE 1CT8A 3D18A 1HHKA 1A2YA 1XGPA 5GGTL 1MJ7L 3ZHKA 4XBGA 3ZDZF 4WCYL 5F8RC 1AI1L 3QCTL 3KYMB 3ARED 4PJ8B 1XGTA 5ETUB 4LVOC 1YMMD 1LO3H 3GRWL 3EO9L 3MRNA 5EC1B 3OR7A 4ORZC 5BZWA 1S7UA 3P4MB 4R7DB 3GDBA 4M5ZH 3S37H 5H2BB 3OB0K 5SWSD 2Q8AL 5I66A 2AV7B 4FG6C 5HI4C 2B20A 3OHXA 2BVQB 1EEZA 4M6AA 1KN2L 5FHAL 5KS9B 3SKNB 3TFKA 2WW8A 4L4TD 5IQ7H 2YUWA 2ZWLT 4X9BA 3WKML 2LE9A 1J10A 2V7HB 2JJWA 1G7JA 4L3AA 3V6OA 3P30H 3L3IB 2HRPH 3JV0A 4Z95H 1ORQA 4R4BB 2FO1A 2WBJD 4JFQB 4TRPL 5E56A 1T7VA 1XR8B 2YPVL 4OI9A 3V6ZA 2X1WL 3QIWA 2W60A 3WO3B 5FK9A 2HP4A 4X4MA 1C16A 3QBTB 3RVVD 5BJTB 2I60H 3ZKSD 5DMJB 1S5HA 4QRQA 4R2GD 3T0EE 1I1CA 1IM9D 2QKIA 3R4DA 1FN4B 3FN0L 4JQVC 5GIRB 3ETBF 4G7YL 3C6SB 3CX5K 4N1CA 4RRPA 4JFDD 2W0FB 1EFXD 1WCBA 1FL5A 1G7MA 3SO5A 1Q94B 4ZSOE 4L3EB 1R3LB 4X6CA 2BOBA 2M8XA 5DMKB 5DR5L 1HWHB 3VXNB 4LNVA 2HTLD 2FGZA 4P46C 4P2OB 4NZDA 4QRPA 3RJDA 2PXYD 3D18B 1BQHG 1HHKB 1T7ZA 1A2YB 4YXLL 5HVFB 1BBJA 2O5XH 4L29A 4XBGB 4M4RA 4R90L 1XGTB 5JUEH 1MIEH 1MI5A 3DI2B 3MRNB 1KPUA 5BZWB 4K2UH 5GGRY 3C60D 2X4SA 1BJ1H 1CXEA 1LNUA 1BD2E 2V2XA 1AO7A 1QYGH 5I66B 2D0FA 3UTSE 3OKLB 1JHTA 5C07D 1IT9H 4Y4HC 2YA1A 1Q1JH 1H3VA 5DVLA 3BN3B 4MDJB 4NFCA 4PB0L 1X6LA 3MLRL 2ZG2A 5JORA 1R5WA 4NPYB 1G7JB 5GS0C 2AK4E 1NUGA 2VL5A 1ORQB 4M1CD 1SJVA 1HYSD 3V6ZB 4HKXB 5GJTL 5KANI 3DVGB 3OB8A 3QIWB 2W60B 5FK9B 1C16B 1QFPA 3JWOC 4HS3A 2GHWB 2I25N 1SEBA 1S5HB 3NCYS 4LBEB 5IVXF 4PJGA 1NMAL 4QRQB 1CR9H 4U6YA 1LEIA 2QKIB 1CZ8L 5IVOA 2XTLA 2PYED 3V5DB 4MJ2A 4I5BA 4PRPD 4GRMA 4EOWH 4Z7WA 2XWTA 2Y23A 4OCRL 1WCBB 1FL5B 1G7MB 4DK6A 1NAKL 2R56H 1KBGL 3NTCL 5K59E 5C0NC 4KK6C 4X6CB 3WKNA 1HXMA 2BOBB 3HAEA 4HH9A 4YK4B 1ETZA 4F37F 4I3SL 1RIHH 1KJ2B 3O45A 3BOVA 4WTWA 1Z2KA 4NCC2 2IMNA 4QRPB 2F53D 1XT5A 2CDGA 1PY4A 1BBJB 2Y4SA 2XQYK 4L29B 4HLJA 4PRID 5I1EL 2GK0A 1HNFA 5I15H 1CFBA 2HFGL 3EJZC 1KPUB 4P46A 4OF8A 2P4AB 4P5TD 12E8L 2YA0A 1L0YA 3QEQD 2C1OB 4P9MH 5KZCB 4RFEA 1LNUB 3DLQR 43CAA 2V2XB 3FJTA 5HPOA 1YPZE 1JHTB 4LVOB 5HTSA 3IRZA 2E7CA 1FVCA 3B9KD 3E6FA 1QFWM 5DQ9A 4PB9L 3UAJC 4G7VH 5JORB 1R5WB 3U4AA 4PR5A 1JPSH 4Y4HA 3E1F1 2FH8A 4C54A 2VL5B 4ZOBA 2VC2L 4NC1C 1N59A 2WUBL 1F4YH 3HRZA 4NFBA 4YFDB 1SEBB 5LJYH 3C6LA 3FQRA 5CJBA 3RWFA 3ZMRA 1I7RA 4U6YB 4LSRL 1LEIB 1RMFH 4OGYL 1GSMA 3D0VB 3P9MA 5EU5A 4HCRH 1FCGA 1N3NA 3FRUA 5C6PB 1BFVH 4I5BB 4NNPH 4AIZA 3WFCH 4XP5H 4Z7WB 3O6ML 4LGRB 1NKOA 5I8OH 1JNNH 4OCYL 1Q9KB 3K3QA 4X6DA 3JUYA 1HXMB 4HH9B 2VZUA 1ETZB 4ZD3L 4P59H 4QOKA 2YOCA 3O45B 1MFEL 2DWDA 3AS2A 1O7VA 2X7LA 4BH8A 1CBVL 1YQVL 5FYJE 3MZTA 5DGQA 3MV9A 5E7FA 5I17A 3BE1L 3QRGL 3M17A 2FDBP 1K3IA 4FQ1L 4JM4L 2GK0B 5JOFA 4FFWD 3JWDL 4RGMC 4P46B 3CK0L 1L7IH 4OTXH 4DGVL 5I1CL 4C56D 1G9NL 5D70L 4RFEB 4RMQA 43CAB 5I8CA 4N9GB 3E6FB 1FVCB 1MF2H 5DQ9B 5E6ID 3PGFL 3SGEH 3RUGA 4MLSA 4O2CA 3BKYL 4Y2OA 2NXYC 5DHVH 5GGSY 5L8JB 2OL3H 2C9AA 4PR5B 1TJIH 2AJ3A 3ORJA 4Y4HB 4HJ0D 1T22A 5K59F 2VDQH 5GISH 4ZFFA 3ARPA 2HTKC 3TYGL 3FAWA 1R3IL 3EYUH 3HRZB 4WEUD 5HHMD 2OR8A 2IAMD 3C6LB 3FQRB 3VXUB 1A3QA 3RWFB 5CKAA 1I7RB 3U7YH 3T0VA 2Q20A 1KJ3L 3KXFE 4Z6AT 2Q8BH 3P9MB 5EU5B 3S96B 4MVBD 3FRUB 3RPKA 1DDHA 4Y5XC 3CH8A 4LLVA 1OY3B 4AIZB 3IDYC 4HIJA 2L7UA 4WFGE 4H5SA 4X6DB 4K7FA 4O4YL 1YPZF 4ODVL 4J2XA 4QOKB 2DWDB 3QQ9D 2X7LB 3VD5A 4BH8B 1TCRA 1WWBX 1P7KA 5LQBH 1CDIA 1RULH 3HC3L 3MV9B 4J23A 4CGTA 4ZPTA 2HT4C 3M17B 3DV4A 4W68A 5CBAA 2BY0A 4JM2D 2R1XA 5JOFB 3U9PL 32C2A 4IDJL 4YEFA 2DJ4A 4DCQA 3IKCA 5D71H 3B4NA 1QACA 3BVNA 3U9UB 1EPFA 1I1AC 4KC3B 5I8CB 4TNWF 5FM4A 4X83A 4CVZA 5KG9A 2FD6H 3UDWC 4JFHD 2CGRH 1JZ6A 4RMVA 3RUGB 2V9QA 4K9EL 4O2CB 1JHKH 4NDMA 4OZIA 1X5HA 1BHGA 3D39A 1T22B 1E6JL 1I9JL 1KCUH 3GMNA 3QDGE 4ZFFB 5IGXH 4HV8A 3HMWL 2Z8WC 4MNGA 3VGFA 1FDLH 1A1NA 1RZKH 5T3XD 1JIBA 3DECA 4OFKA 1ZS8A 1XIWD 4YFLF 5C09A 2B5IC 2W07A 5JXAH 1KTKE 5FYKE 3GBMH 5TJWK 3EYQD 2MCPL 1DDHB 3SJVE 4LSDA 5FGRA 3VE0A 3D2UA 4HIJB 3DNKA 3K81A 3O3UN 5EPMA 4H5SB 3QFJA 4G6MH 1DUZA 3BW9A 3QO1A 4FHBD 2XKNA 4Y5XA 1A7QL 2W0KA 4PGCA 1P4LA 2A6KA 1TCRB 4I3RL 1MCJA 3S34L 1P7KB 2P5EE 1UWGL 3MLTB 5CBAB 2KPNA 1NLBL 4UINH 2R1XB 3WIFA 4DCQB 4J12A 1QTYT 4DAGH 2CO6B 2H26A 4YNYA 1PKQE 1OM3H 3BVNB 1IGFL 2E7LC 4OLWH 1KULA 1YEIH 4OD1H 3O6KH 2DQFA 4F7CA 5KG9B 3LKPA 4RGMB 5GGQH 3IDIA 2OZ4L 2APWA 4XC1L 4TQEL 4LQFH 3PXHA 5E70A 1ZWIA 1A6VH 4HS8H 1JGUH 3FQWA 4NDMB 4OZIB 2NY5L 1IC4H 1I1AA 4IHOA 1YEDA 5DD0H 1JI2A 3BP5A 5DMGD 3D39B 2DDQL 1KNOA 1TPXC 2FYYA 3UDWA 4KU1A 3V5KA 3HC0A 1MFDL 3GMNB 2OP4H 4HV8B 4MNGB 5FAAA 5TE7H 3DPBA 2NXYB 4ENEC 1K6QH 1WBXA 3TCLA 3EGSB 4JDVA 5BOPA 3VFRA 1J1XH 1ZS8B 4DVRL 2O5ZL 2XRAH 3U1SH 1J5OL 5C09B 1CICD 2WIIA 4TN9A 3J7HA 1DQDL 4HEME 1RK1A 3GK8L 1P7QD 1CFSB 1H5BC 2ATKB 4WI6A 4RAUA 3VE0B 3AY4C 4P99A 2ZUUA 4QRRD 4HC1H 3D2UB 1ODAA 4RWYL 3FMGL 5EPMB 3CFEA 4LHUD 3QFJB 1DUZB 1U3HC 3BW9B 1S3KL 3QO1B 5DQDL 1N6QH 5IBUG 2XKNB 3DGGA 1INQB 4DWHA 4Y5XB 5GGUA 4PGCB 2A6KB 5ISZD 1FGNL 3IDYB 4R4NC 1G7LA 2BXZA 1T2QL 5D7KE 4KHTL 3RGVC 3MRHA 2Y5EA 1C08A 1KTDA 4KUCF 2J8UE 3TT1L 2OMNA 3UTTA 3WIFB 4GKNA 5GS1C 2H26B 4YNYB 2AJUH 4PBWD 5T3ZL 5J7CC 5BMFL 3LQZA 3TVMC 2WV3A 2DQFB 4LLMA 3LKPB 5DDHA 5L8KB 3IDIB 2BVEA 1QRNE 3PGCA 5DO2D 4IOFC 3MJ6A 1ZWIB 5FXCH 1RFDH 4P9HL 2E7LA 3FQWB 5EIIB 1KFAL 1I1AB 4IHOB 2H9GB 5AUMA 3O3AA 3BP5B 2Q7NA 2G9HA 2J6EA 2O26U 1J8HE 4WW2A 3UJJL 2OMBA 3GNML 1KNOB 1YY9C 2FYYB 5J3HD 2EXYC 1XF2A 3V5KB 3P0VH 2LV4A 3HC0B 3TH4T 1I9EA 2ZSWA 1WK0A 1S9XA 1N6UA 1OAQH 3C2SA 4TUJA 1WBXB 3TCLB 4EN3C 2AXGA 4MMZC 3VFRB 5IFHH 3ILQD 4MNQA 2E5EA 3BKCH 3QWRD 4LASL 2IJ0C 2WIIB 4FFYL 5H37H 4Q6IC 3RVUD 5L8LB 1RK1B 3U83A 4N0UA 2CPCA 4PUBL 1T7WA 4B7LA 4OKVA 4RAUB 4GS7C 1KEGL 5F7FA 1NCCL 1V8HA 2B5IB 3IFNL 3D85A 3DGGB 2UUDK 4KRLB 5TF1H 1HXYA 4YEEA 1R3KA 3QNYA 2Y25A 3HNVL 1G7LB 1TZGL 3MRHB 3JV4A 1N5YH 1C08B 1KTDB 2VXTH 1YEHL 2Y72A 4M6OH 4ELMF 3FQXA 1A6PA 2Z93B 3O6FD 4POZD 2APXA 3I2CH 3UTTB 4GKNB 4KZDH 4CMMA 1MCEA 4PY8I 1M7IA 3RGVA 2DL2A 3O81A 1CL7I 3BQUD 4WI7A 3LQZB 4QY8B 1GVIA 4ZUSA 1M05A 2Z8RA 1YEFH 4XWOD 5CJXC 5D1XD 5DDHB 5GS1A 4IRJC 2R23B 4ZQKA 3PGCB 2HLFC 3L1OL 5ERWA 4EUPH 3ZDXE 3IDUA 4QF1A 1F6FB 4PY8J 2J8OA 2QEJA 3O3AB 4IOIA 2R4RL 2HMIC 1XF2B 5LXGL 3JWNC 2ZSWB 3AUVA 4J7RA 1S9XB 3SDXB 4KJPC 2AXHA 3VJ6A 4MD0A 4TUJB 4RNRA 4JN1H 3WJLC 2AXGB 4MZ3A 3THMH 3ZT5A 5F7DA 1TPXB 4CUCA 1T5WA 3QHFH 1P2CA 2EKJA 4MNQB 3KWWA 1TIUA 1ZHNB 1EO7A 3QP3A 1KV3A 2J8UF 1B2WL 1MFAL 4OBRA 3MLWL 3ZKXC 2B1AL 4JFOA 4EN3A 5LVEA 4NHUA 4OKVB 1TJHH 4S1RL 3HUJE 4X6FA 4GBXD 5HYJD 1T6VN 3UROR 3R0MA 1DQTA 1C5CH 4Q6IA 3D85B 3SKJH 1T83C 1T21A 5JHDE 1HXYB 2DTML 3S3JA 3QNYB 1INEH 3E0GA 1AH1A 5D7LD 2MQ0A 4M9PA 1F11A 3HG1A 1U3HB 2HVJB 3JV4B 4G3YH 5T1DL 3LV3B 1RIUH 2GEEA 2AABL 1ZGLP 3FQXB 2R0KL 4QCIA 3GJFH 4CMMB 3OGCA 2IPTL 3O4LA 1M7IB 4QYOA 4FQCH 4M6MH 1MFBL 3RGVB 1F8TL 1JPTL 5L6YL 4ZUSB 4CKVX 1M05B 1KELH 2AGJH 5GS1B 4NZUL 4ZQKB 1LO5A 3MV7A 2DQGH 1QKZH 4JRYA 5ERWB 2CUMA 1UCTA 4QF1B 4A2MA 5D5ME 5J11C 2FHFA 4LOUD 5BRZD 3ECBA 4IOIB 4XCNA 3TVMB 4NQVA 2NY6C 1ZHKA 3RNQA 5CJXA 4LPTA 1TNNA 3FHQA 3OBAA 5J56B 1BECA 4IRJA 3NAAH 1RQ5A 2ZP0T 3GI9H 3VJ6B 2BVOA 1PLGH 3KLSA 4MD0B 5I19L 3T0AA 4RNRB 4M93C 4I9WE 3ULVH 3GSQA 2AQ2A 3SDAC 2CRZA 1UCBH 2BHZA 1BLNA 1CD1A 5F7DB 1T5WB 4S1DD 5EU7C 3KWWB 3FN9A 4U2ZA 4GKZA 1QSEE 1EGJL 3MYJA 5JTWA 3O9WC 3U36A 4LRNL 5CUSL 5C8JA 4JFOB 3WJLA 4EN3B 4NHUB 1MWAL 2VDNL 2VUOA 4NQUA 4Y1AA 5FUCE 4X6FB 5IESH 5F1IA 4Q6IB 2P45B 4P0DA 5DRXA 4FZ8H 1UZ6E 4YX2H 1RURH 1T21B 3PE9A 4FFEX 5B22A 1Y0LA 2RFXA 2GTWA 4GS7B 1FORH 3ZDXF 3UPRA 4NP4L 4Y16D 4OV5A 5IROC 3AM8C 3E6HA 3HG1B 1OOAA 1MY5A 3OKYA 5E99H 1T83A 4NJ9H 3CFIC 4XXCC 2VLJB 1IAIM 4PLOB 4QCIB 3HC4H 3RA7H 4H0GA 4ZFGH 3OGCB 3HB3C 4HKBA 3BDBA 5F8QC 3NA9L 2X42A 3CPLB 5DZOA 1FNSH 1NGQL 4EDWH 1ROWA 1LO5B 3MV7B 1I85C 2VZVA 2BC4A 5I6XC 3ECBB 4E0RA 3Q3GA 3P0YL 4XCNB 4NQVB 1ZHKB 5ESQA 4WJ5A 3HUJF 2ED8A 4MXWL 4NKMA 3RNQB 4TUOA 2BVPA 3ARUA 4IRJB 5CCKH 3KYKL 4H88L 5HVHC 1SJEA 5BO1L 3BKMH 4P3WA 5I73C 4AEFA 4TVPD 3T4AB 1U8IA 4KZEH 1Z5LA 3H9YA 2BVOB 5KSAC 3KPRE 2WUCL 4TSBH 1Y6MR 3V52H 1BLNB 1OAYH 4WFEE 4Q9CA 5A1AA 4JQXC 4LLYA 2BDNH 4GKZB 3MYJB 2HH0L 4OUUA 3M45A 4GG6A 3IFPA 3U36B 5C8JB 1FHGA 1GGBH 3C5ZC 1EHAA 3JWOL 4Y1AB 3FB6A 3ZHLA 5F1IB 3HE7D 1KYOJ 3O9WA 2PKDA 3ZKXB 3VGDA 3B9AA 3LQAL 2IANA 4YHZH 3BMWA 3JV5A 2AW2A 5EH1A 1Y0LB 2RFXB 1OP5K 2GTWB 1GGIH 2VR5A 4M4PA 2EIZA 1LO0L 5D5MF 5DJ0B 1G0DA 3N0PB 4OV5B 1P1ZB 2PO6D 3E6HB 1QFWH 1AQKH 5B39G 2Y9RT 3K74B 3IU3B 4Y4FD 1KENL 1ZSDA 15C8L 5IROA 3AM8A 4GW5B 3EJYC 5IMLA 1S7TA 4JANA 5A3ID 4XXCA 2AJYH 3VCLA 4JY6A 5E2TH 1NAMH 5JXEC 3T0ED 1N7ML 2BC4B 4OQ1A 4E0RB 3Q3GB 4MMXC 3FZUD 4KKNA 4S11A 5ESQB 4WJ5B 4NKMB 4TUOB 2BVPB 2F74A 2V2WA 4QWWD 1HH9A 1SJEB 1I85A 1UZ6F 2VXVL 1U8IB 3CLEL 5J11B 5GZOD 2BHUA 1L9MA 2AQ1A 2NY6B 35C8L 1AIFA 5JIPA 4M48H 2C4FT 1H8NA 1GC1L 4JKPL 4RCAA 1MQKH 3I6LE 2Y36L 4GG6B 1RZKC 3IFPB 5KSAA 4LU5H 1X5FA 3QDME 4M93B 3SDAB 4FTVB 2VDLL 1JYNA 5F7EH 3NMEA 4QNPE 3FB6B 3T0DA 1IARB 4JQXA 4L1HA 3KPSA 1MLBA 3ULSB 3RVWC 1BD2D 1EERB 4PD4J 3O9WB 3UTSD 2IANB 3WSQL 2GJ6A 1WSS