5B5HA

Hydrophobic ice-binding site confer hyperactivity on antifreeze protein from a snow mold fungus
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
223
structure length
223
Chain Sequence
AGPTAVPLGTAGNYAILASAGVSTVPQSVITGAVGLSPAAATFLTGFSLTMSSTGTFSTSTQVTGQLTAADYGTPTPSILTTAIGDMGTAYVNAATRSGPNFLEIYTGALGGKILPPGLYKWTSPVGASADFTIIGTSTDTWIFQIAGTLGLAAGKKIILAGGAQAKNIVWVVAGAVSIEAGAKFEGVILAKTAVTLKTGSSLNGRILSQTAVALQKATVVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antifreeze protein
molecule keywords Antifreeze protein
publication title Hydrophobic ice-binding sites confer hyperactivity of an antifreeze protein from a snow mold fungus.
pubmed doi rcsb
source organism Typhula ishikariensis
total genus 83
structure length 223
sequence length 223
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11999 DUF3494 Protein of unknown function (DUF3494)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...