5B5WA

Crystal structure of mob1-lats1 ntr domain complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
175
structure length
172
Chain Sequence
GNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for autoinhibition and its relief of MOB1 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein/apotosis
molecule keywords MOB kinase activator 1B
total genus 51
structure length 172
sequence length 175
ec nomenclature
pdb deposition date 2016-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5b5wA00
2HJNA 5B5VA 5B5WA 4LQSB 4JIZA 4LQQB 4J1VA 5BRMA 5B6BA 5BRKA 1PI1A 1R3BA
chains in the Genus database with same CATH superfamily
3HWCA 2HJNA 4V25A 1X8ZA 2ZDYA 4L3XA 1LVCA 3MDDA 3Q23A 1SC5A 2BU2A 1R2JA 1XFWA 1IS2A 1FS9A 2PG0A 2ZKJA 3AFEA 1Y8OA 4H7QA 4HKSA 5B6BA 5K3IA 4MPCA 2Q8GA 4P13A 3TZ5A 3RKHA 4L1FA 2RFQA 5M4MA 4FF3A 1EGEA 1SK6A 2FONA 2ZAFA 3II9A 3C46A 2YYGA 4M9AA 5BRMA 2ZO5A 3Q24A 2YGWA 2YYMA 3MXLA 4KS9A 4LQSB 1RJ4A 4AKHA 1JM6A 2FP2A 3MPIA 3TZ4A 1EGCA 1UDYA 2CJ5A 4H85A 3VKHA 1UKWA 2OR0A 2VF1A 4H81A 2OT4A 4OO2A 4Q5CA 2DDHA 2R02A 2CJ6A 4Q5BA 3EONA 1XG2B 1RJ1A 4G97A 3UU9A 2E81A 3X29A 1XFZA 2BU7A 2FP1A 3FCJA 4KCFA 4O5MA 1X91A 4FZ4A 3NF4A 3MKHA 4ZYJA 3C3LA 1S26A 3B96A 3D9EA 2YYIA 1PI1A 3TZ2A 3EOMA 4MPNA 2R03A 3LG1A 4FF1A 2R0MA 2PO4A 1FS8A 2REHA 5B5WA 4Q17A 4N5FA 4KTOA 5K3HA 1OAHA 1GKXA 3P4TA 2OJQA 3OWAA 1GJVA 4AKIA 4U83A 4E01A 3BNFA 3FO3A 1K8TA 2XS1A 4JEKA 4HKRA 2IX6A 3F29A 5M4KA 4P79A 2AZEA 4G5EA 3CRKA 2YYKA 2XS8A 5K3JA 2DVLA 2Z1QA 4KSFA 1Y8PA 1K93A 2C12A 1GU6A 4W9UA 3UBRA 2A1TA 2VIGA 3SWOA 1Y0VA 3CRLA 1BUCA 3D9DA 3M9VA 3BNGA 4QICA 4JIZA 2Q8FA 3TORA 3BNHA 1Y8NA 3MDEA 4RM7A 3SF6A 3R7KA 3TZ0A 4DZYA 2YYJA 4E00A 1PK0A 3GNCA 2QR4A 4WJYA 4ZXVA 2JBTA 5J71A 2OEXA 2F6LA 3BNJA 3GM6A 4X28C 5M4NA 4L3YA 4V26A 1RX0A 1XFUA 2E80A 3TTBA 3CE2A 4KSAA 5BRKA 2R05A 2UXWA 3D2RA 3KMLA 1GKZA 2BU8A 2RDZA 2Q8IA 2E0AA 4L3ZA 4MPEA 2BTZA 3D1IA 3PFDA 3D9FA 4JIOA 2JBSA 4E02A 1K90A 4MP2A 5M4PA 3S7WA 2IX5A 1SIQA 3GQTA 2PNRA 2EBFX 2C0UA 1W07A 3D6BA 4F0XA 1T9GA 3D9GA 3X0XA 2Q8HA 4MP7A 5GJVE 2R0NA 5J6AA 1FS7A 4FF4A 2EBHX 4X28A 4LQQB 4DOYA 4Q1OA 2CJ7A 2VR0A 3LGQA 1XFVA 1R3BA 3MMOA 2CX9A 4NXLA 3L1TA 3N0RA 4IV6A 5B5VA 2EC5A 2CJ4A 4AI6A 4J1VA 1WS9A 3SCEA 4AKGA 2GBBA 1X90A 1XFXA 5K3GA 2AO2A 1SIRA 2ZDXA 3C2PA 1XFYA 5GJWE 1JQIA 2YYLA 3SXQA 4Q4UA 3VADA 2BU6A 3OWMA 2XQRB 2JBRA 1QDBA 4XVXA 1U8VA 2LFWA 3Q0AA 2WBIA 2JIFA 3X0YA 2OEVA 3MPJA 1IVHA 2BU5A 4L38A 4Q0TA 2EBAA 2J7AA 1RP3A 3Q22A 1EGDA 4HR3A 4FF2A 4IRNA 2CJ8A 3AFFA 3OIBA 2RF7A 3VKGA 2D29A
chains in the Genus database with same CATH topology
2HJNA 5B5VA 5B5WA 4LQSB 4JIZA 4LQQB 4J1VA 5BRMA 5B6BA 5BRKA 1PI1A 1R3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJN A;  5B5V A;  5B5W A;  4LQS B;  4JIZ A;  4LQQ B;  4J1V A;  5BRM A;  5B6B A;  5BRK A;  1PI1 A;  1R3B A; 
#chains in the Genus database with same CATH topology
 3HWC A;  2HJN A;  4V25 A;  1X8Z A;  2ZDY A;  4L3X A;  1LVC A;  3MDD A;  3Q23 A;  1SC5 A;  2BU2 A;  1R2J A;  1XFW A;  1IS2 A;  1FS9 A;  2PG0 A;  2ZKJ A;  3AFE A;  1Y8O A;  4H7Q A;  4HKS A;  5B6B A;  5K3I A;  4MPC A;  2Q8G A;  4P13 A;  3TZ5 A;  3RKH A;  4L1F A;  2RFQ A;  5M4M A;  4FF3 A;  1EGE A;  1SK6 A;  2FON A;  2ZAF A;  3II9 A;  3C46 A;  2YYG A;  4M9A A;  5BRM A;  2ZO5 A;  3Q24 A;  2YGW A;  2YYM A;  3MXL A;  4KS9 A;  4LQS B;  1RJ4 A;  4AKH A;  1JM6 A;  2FP2 A;  3MPI A;  3TZ4 A;  1EGC A;  1UDY A;  2CJ5 A;  4H85 A;  3VKH A;  1UKW A;  2OR0 A;  2VF1 A;  4H81 A;  2OT4 A;  4OO2 A;  4Q5C A;  2DDH A;  2R02 A;  2CJ6 A;  4Q5B A;  3EON A;  1XG2 B;  1RJ1 A;  4G97 A;  3UU9 A;  2E81 A;  3X29 A;  1XFZ A;  2BU7 A;  2FP1 A;  3FCJ A;  4KCF A;  4O5M A;  1X91 A;  4FZ4 A;  3NF4 A;  3MKH A;  4ZYJ A;  3C3L A;  1S26 A;  3B96 A;  3D9E A;  2YYI A;  1PI1 A;  3TZ2 A;  3EOM A;  4MPN A;  2R03 A;  3LG1 A;  4FF1 A;  2R0M A;  2PO4 A;  1FS8 A;  2REH A;  5B5W A;  4Q17 A;  4N5F A;  4KTO A;  5K3H A;  1OAH A;  1GKX A;  3P4T A;  2OJQ A;  3OWA A;  1GJV A;  4AKI A;  4U83 A;  4E01 A;  3BNF A;  3FO3 A;  1K8T A;  2XS1 A;  4JEK A;  4HKR A;  2IX6 A;  3F29 A;  5M4K A;  4P79 A;  2AZE A;  4G5E A;  3CRK A;  2YYK A;  2XS8 A;  5K3J A;  2DVL A;  2Z1Q A;  4KSF A;  1Y8P A;  1K93 A;  2C12 A;  1GU6 A;  4W9U A;  3UBR A;  2A1T A;  2VIG A;  3SWO A;  1Y0V A;  3CRL A;  1BUC A;  3D9D A;  3M9V A;  3BNG A;  4QIC A;  4JIZ A;  2Q8F A;  3TOR A;  3BNH A;  1Y8N A;  3MDE A;  4RM7 A;  3SF6 A;  3R7K A;  3TZ0 A;  4DZY A;  2YYJ A;  4E00 A;  1PK0 A;  3GNC A;  2QR4 A;  4WJY A;  4ZXV A;  2JBT A;  5J71 A;  2OEX A;  2F6L A;  3BNJ A;  3GM6 A;  4X28 C;  5M4N A;  4L3Y A;  4V26 A;  1RX0 A;  1XFU A;  2E80 A;  3TTB A;  3CE2 A;  4KSA A;  5BRK A;  2R05 A;  2UXW A;  3D2R A;  3KML A;  1GKZ A;  2BU8 A;  2RDZ A;  2Q8I A;  2E0A A;  4L3Z A;  4MPE A;  2BTZ A;  3D1I A;  3PFD A;  3D9F A;  4JIO A;  2JBS A;  4E02 A;  1K90 A;  4MP2 A;  5M4P A;  3S7W A;  2IX5 A;  1SIQ A;  3GQT A;  2PNR A;  2EBF X;  2C0U A;  1W07 A;  3D6B A;  4F0X A;  1T9G A;  3D9G A;  3X0X A;  2Q8H A;  4MP7 A;  5GJV E;  2R0N A;  5J6A A;  1FS7 A;  4FF4 A;  2EBH X;  4X28 A;  4LQQ B;  4DOY A;  4Q1O A;  2CJ7 A;  2VR0 A;  3LGQ A;  1XFV A;  1R3B A;  3MMO A;  2CX9 A;  4NXL A;  3L1T A;  3N0R A;  4IV6 A;  5B5V A;  2EC5 A;  2CJ4 A;  4AI6 A;  4J1V A;  1WS9 A;  3SCE A;  4AKG A;  2GBB A;  1X90 A;  1XFX A;  5K3G A;  2AO2 A;  1SIR A;  2ZDX A;  3C2P A;  1XFY A;  5GJW E;  1JQI A;  2YYL A;  3SXQ A;  4Q4U A;  3VAD A;  2BU6 A;  3OWM A;  2XQR B;  2JBR A;  1QDB A;  4XVX A;  1U8V A;  2LFW A;  3Q0A A;  2WBI A;  2JIF A;  3X0Y A;  2OEV A;  3MPJ A;  1IVH A;  2BU5 A;  4L38 A;  4Q0T A;  2EBA A;  2J7A A;  1RP3 A;  3Q22 A;  1EGD A;  4HR3 A;  4FF2 A;  4IRN A;  2CJ8 A;  3AFF A;  3OIB A;  2RF7 A;  3VKG A;  2D29 A; 
#chains in the Genus database with same CATH homology
 2HJN A;  5B5V A;  5B5W A;  4LQS B;  4JIZ A;  4LQQ B;  4J1V A;  5BRM A;  5B6B A;  5BRK A;  1PI1 A;  1R3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...