5B6BA

Complex of lats1 and phosphomimetic mob1b
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
191
structure length
182
Chain Sequence
SHQYELLKHAENLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for autoinhibition and its relief of MOB1 in the Hippo pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Metal binding protein/signaling protein
molecule keywords MOB kinase activator 1B
total genus 56
structure length 182
sequence length 191
chains with identical sequence B, D, F, H, K, M, O
ec nomenclature
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03637 Mob1_phocein Mob1/phocein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.140.30 Mainly Alpha Up-down Bundle Butyryl-CoA Dehydrogenase, subunit A; domain 3 MOB kinase activator 5b6bA00
1R3BA 5BRMA 5BRKA 4JIZA 2HJNA 5B5VA 5B5WA 4J1VA 1PI1A 4LQSB 4LQQB 5B6BA
chains in the Genus database with same CATH superfamily
1T9GA 5K3IA 3X0XA 1UDYA 1FS8A 3SWOA 3SXQA 3GM6A 4O5MA 5M4PA 3TZ2A 2CJ6A 2DVLA 2CX9A 2C0UA 4L3YA 1U8VA 3SF6A 1XFZA 2Q8HA 2DDHA 3KMLA 3TORA 3LGQA 3C3LA 3VKHA 3BNGA 3Q22A 4H7QA 1X8ZA 2JBRA 3L1TA 4AKHA 4ZXVA 4V26A 3FO3A 2F6LA 3D1IA 4OO2A 1UKWA 4FZ4A 3RKHA 4E01A 3OWMA 4H85A 4F0XA 2ZDXA 4KSAA 3UU9A 2YYGA 1XFXA 2ZDYA 1K8TA 2YYLA 3MXLA 2E81A 4G97A 4JIZA 4L3ZA 3R7KA 3D6BA 3Q0AA 3BNFA 5K3HA 1BUCA 4MP7A 1GKXA 3GNCA 3D2RA 5M4NA 4E00A 3FCJA 2VR0A 4H81A 3AFFA 1X90A 3OIBA 4P13A 1FS7A 5B5VA 2Z1QA 1XFWA 3D9GA 3MMOA 4LQSB 4Q4UA 3HWCA 2VIGA 1S26A 1SC5A 4HR3A 1QDBA 1GU6A 2HJNA 2R05A 4MP2A 5B5WA 1GKZA 2Q8FA 2BTZA 1PI1A 4QICA 4W9UA 4XVXA 3MPIA 2UXWA 2FP2A 3CRKA 3MDEA 4HKSA 3F29A 4LQQB 2EC5A 1IS2A 2AZEA 2PNRA 1GJVA 2XS1A 2RF7A 3II9A 4P79A 1SIQA 4KS9A 2WBIA 1Y0VA 3X29A 2IX5A 2RDZA 3CE2A 1R3BA 2AO2A 2YYIA 5B6BA 1EGEA 2E0AA 4KTOA 3S7WA 4FF4A 2ZKJA 2FONA 2R03A 2R0NA 4L1FA 3GQTA 1R2JA 1RJ4A 2EBHX 1SIRA 3C46A 4FF3A 2PG0A 3B96A 3BNJA 2YYMA 4DOYA 1Y8NA 4N5FA 1JQIA 2BU7A 1RJ1A 4V25A 2BU5A 3Q24A 2VF1A 4AKIA 4X28C 2EBFX 4IRNA 3VADA 1X91A 2CJ5A 1RP3A 3N0RA 4Q17A 3CRLA 2Q8GA 3BNHA 4Q0TA 3AFEA 2BU2A 1Y8OA 1K90A 1IVHA 4WJYA 3X0YA 3D9DA 5BRMA 2REHA 4ZYJA 2J7AA 1JM6A 4KSFA 2ZAFA 5J71A 2XQRB 2CJ4A 2JBSA 1Y8PA 2A1TA 2YYJA 3MKHA 3TZ5A 2YGWA 4IV6A 4MPNA 4E02A 4L3XA 1LVCA 2R02A 1XG2B 4FF2A 4Q5BA 2BU8A 4RM7A 2FP1A 2R0MA 4U83A 4HKRA 1FS9A 3UBRA 1WS9A 2OR0A 3MPJA 2BU6A 4G5EA 4DZYA 2QR4A 2OT4A 2JBTA 2E80A 4J1VA 2YYKA 3SCEA 3TTBA 5J6AA 3C2PA 1SK6A 1PK0A 4KCFA 4AKGA 1W07A 2OEXA 5K3GA 2PO4A 3NF4A 1K93A 1XFUA 4JIOA 2OJQA 3D9EA 3LG1A 2LFWA 4JEKA 2C12A 2ZO5A 5BRKA 4AI6A 2CJ7A 5GJWE 1XFYA 2OEVA 1XFVA 4Q5CA 2D29A 4FF1A 5M4MA 2EBAA 2JIFA 2Q8IA 3EOMA 2CJ8A 3M9VA 3P4TA 4NXLA 5K3JA 1RX0A 3Q23A 3VKGA 4L38A 4MPCA 4MPEA 2XS8A 5M4KA 4M9AA 1OAHA 3D9FA 1EGDA 3EONA 5GJVE 3TZ0A 3TZ4A 4X28A 1EGCA 3OWAA 2GBBA 2RFQA 3PFDA 4Q1OA 2IX6A 3MDDA
chains in the Genus database with same CATH topology
1R3BA 5BRMA 5BRKA 4JIZA 2HJNA 5B5VA 5B5WA 4J1VA 1PI1A 4LQSB 4LQQB 5B6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R3B A;  5BRM A;  5BRK A;  4JIZ A;  2HJN A;  5B5V A;  5B5W A;  4J1V A;  1PI1 A;  4LQS B;  4LQQ B;  5B6B A; 
#chains in the Genus database with same CATH topology
 1T9G A;  5K3I A;  3X0X A;  1UDY A;  1FS8 A;  3SWO A;  3SXQ A;  3GM6 A;  4O5M A;  5M4P A;  3TZ2 A;  2CJ6 A;  2DVL A;  2CX9 A;  2C0U A;  4L3Y A;  1U8V A;  3SF6 A;  1XFZ A;  2Q8H A;  2DDH A;  3KML A;  3TOR A;  3LGQ A;  3C3L A;  3VKH A;  3BNG A;  3Q22 A;  4H7Q A;  1X8Z A;  2JBR A;  3L1T A;  4AKH A;  4ZXV A;  4V26 A;  3FO3 A;  2F6L A;  3D1I A;  4OO2 A;  1UKW A;  4FZ4 A;  3RKH A;  4E01 A;  3OWM A;  4H85 A;  4F0X A;  2ZDX A;  4KSA A;  3UU9 A;  2YYG A;  1XFX A;  2ZDY A;  1K8T A;  2YYL A;  3MXL A;  2E81 A;  4G97 A;  4JIZ A;  4L3Z A;  3R7K A;  3D6B A;  3Q0A A;  3BNF A;  5K3H A;  1BUC A;  4MP7 A;  1GKX A;  3GNC A;  3D2R A;  5M4N A;  4E00 A;  3FCJ A;  2VR0 A;  4H81 A;  3AFF A;  1X90 A;  3OIB A;  4P13 A;  1FS7 A;  5B5V A;  2Z1Q A;  1XFW A;  3D9G A;  3MMO A;  4LQS B;  4Q4U A;  3HWC A;  2VIG A;  1S26 A;  1SC5 A;  4HR3 A;  1QDB A;  1GU6 A;  2HJN A;  2R05 A;  4MP2 A;  5B5W A;  1GKZ A;  2Q8F A;  2BTZ A;  1PI1 A;  4QIC A;  4W9U A;  4XVX A;  3MPI A;  2UXW A;  2FP2 A;  3CRK A;  3MDE A;  4HKS A;  3F29 A;  4LQQ B;  2EC5 A;  1IS2 A;  2AZE A;  2PNR A;  1GJV A;  2XS1 A;  2RF7 A;  3II9 A;  4P79 A;  1SIQ A;  4KS9 A;  2WBI A;  1Y0V A;  3X29 A;  2IX5 A;  2RDZ A;  3CE2 A;  1R3B A;  2AO2 A;  2YYI A;  5B6B A;  1EGE A;  2E0A A;  4KTO A;  3S7W A;  4FF4 A;  2ZKJ A;  2FON A;  2R03 A;  2R0N A;  4L1F A;  3GQT A;  1R2J A;  1RJ4 A;  2EBH X;  1SIR A;  3C46 A;  4FF3 A;  2PG0 A;  3B96 A;  3BNJ A;  2YYM A;  4DOY A;  1Y8N A;  4N5F A;  1JQI A;  2BU7 A;  1RJ1 A;  4V25 A;  2BU5 A;  3Q24 A;  2VF1 A;  4AKI A;  4X28 C;  2EBF X;  4IRN A;  3VAD A;  1X91 A;  2CJ5 A;  1RP3 A;  3N0R A;  4Q17 A;  3CRL A;  2Q8G A;  3BNH A;  4Q0T A;  3AFE A;  2BU2 A;  1Y8O A;  1K90 A;  1IVH A;  4WJY A;  3X0Y A;  3D9D A;  5BRM A;  2REH A;  4ZYJ A;  2J7A A;  1JM6 A;  4KSF A;  2ZAF A;  5J71 A;  2XQR B;  2CJ4 A;  2JBS A;  1Y8P A;  2A1T A;  2YYJ A;  3MKH A;  3TZ5 A;  2YGW A;  4IV6 A;  4MPN A;  4E02 A;  4L3X A;  1LVC A;  2R02 A;  1XG2 B;  4FF2 A;  4Q5B A;  2BU8 A;  4RM7 A;  2FP1 A;  2R0M A;  4U83 A;  4HKR A;  1FS9 A;  3UBR A;  1WS9 A;  2OR0 A;  3MPJ A;  2BU6 A;  4G5E A;  4DZY A;  2QR4 A;  2OT4 A;  2JBT A;  2E80 A;  4J1V A;  2YYK A;  3SCE A;  3TTB A;  5J6A A;  3C2P A;  1SK6 A;  1PK0 A;  4KCF A;  4AKG A;  1W07 A;  2OEX A;  5K3G A;  2PO4 A;  3NF4 A;  1K93 A;  1XFU A;  4JIO A;  2OJQ A;  3D9E A;  3LG1 A;  2LFW A;  4JEK A;  2C12 A;  2ZO5 A;  5BRK A;  4AI6 A;  2CJ7 A;  5GJW E;  1XFY A;  2OEV A;  1XFV A;  4Q5C A;  2D29 A;  4FF1 A;  5M4M A;  2EBA A;  2JIF A;  2Q8I A;  3EOM A;  2CJ8 A;  3M9V A;  3P4T A;  4NXL A;  5K3J A;  1RX0 A;  3Q23 A;  3VKG A;  4L38 A;  4MPC A;  4MPE A;  2XS8 A;  5M4K A;  4M9A A;  1OAH A;  3D9F A;  1EGD A;  3EON A;  5GJV E;  3TZ0 A;  3TZ4 A;  4X28 A;  1EGC A;  3OWA A;  2GBB A;  2RFQ A;  3PFD A;  4Q1O A;  2IX6 A;  3MDD A; 
#chains in the Genus database with same CATH homology
 1R3B A;  5BRM A;  5BRK A;  4JIZ A;  2HJN A;  5B5V A;  5B5W A;  4J1V A;  1PI1 A;  4LQS B;  4LQQ B;  5B6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...