5B76A

Crystal structure of moz double phd finger domain in complex with histone h3 crotonylation at k14
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
SLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRMPKGMWICQICRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
molecule keywords Histone acetyltransferase KAT6A
molecule tags Transferase
source organism Homo sapiens
total genus 26
structure length 120
sequence length 120
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b76A00
2YUCA 2YT5A 3ZVZB 1T1HA 2LV9A 1K2FA 2KREA 1WEQA 2YQMA 4IC3A 5B76A 1WGMA 2Y1NA 1WFKA 2LDRA 1F62A 2ECGA 3EB6A 2VP7A 4CA1A 2KR4A 4R8PK 3LRQA 3N9LA 2K1JA 5C11A 5TDRA 3LQJA 2JRJA 1BORA 2M1RA 2F6NA 5J3XA 3DQVR 2PNXA 2KIZA 3RTRB 2F6JA 2CT2A 1DVPA 1VYXA 5AITA 3N9NA 4L58A 2EGPA 5DKAA 3SOUA 1LDJB 2Y43A 4Q6FA 3ZVYA 2VNFA 4AYCB 4I7BA 5KH3A 2QJ0A 2MD7B 4LADB 4GNDA 4ZQLA 1WENA 2KE1A 4L7XA 4LK9A 3N9MA 2VJEB 5H1VA 2KFTA 4NN2A 5LKUA 3ZPV1 2LGGA 3VK6A 1WEPA 3U5OA 2L43A 2AN6A 4GB0A 5G05B 4TKPB 5LCWB 3IHPA 5KH9A 4F52B 5I3LA 5H1UA 2YQLA 2LXHC 1WEVA 1WEWA 2LGVA 3LQHA 5LKXA 5H1TA 4GNEA 1WILA 4UP0A 1MM3A 3FL2A 5FB0A 1N87A 2VJFB 2ECIA 2ECWA 3N9OA 2LGKA 4MVTA 4PTBA 2OXQC 2MNZA 4C9ZA 2MA6A 5JG6A 3ZPVE 4AYCA 1WEEA 1HYJA 3HCTA 3MHSA 4N4FA 2MIQA 1ZBDB 3O37A 4WZ0A 3M99A 3C5KA 2MA5A 2E6RA 2VJEA 2LGLA 4YATA 2KU3A 2L75A 4WZ3B 3SOWA 2VPBA 2MD8C 4UP5A 4UI9B 4R7EA 3KNVA 2KGGA 4MSXA 1IYMA 5B77A 3ASLA 1X4JA 2FUUA 3MHHA 2VJFA 4YBTA 2YYRA 1JM7B 2KWJA 3PURA 4A4CA 2YW8A 5TABA 1HYIA 1Z6UA 2YHOA 3T7LA 2LQ6A 2LXPC 2MNYA 1CHCA 4BBQA 5FERA 4YC9A 3O33A 2G43A 2YHNA 4LKAA 2UZGA 2NAAA 2EODA 2FUIA 3HTKC 3GL6A 4LLBA 4W4UA 1X4UA 3V43A 2CSZA 4GNFA 4A49A 2VPEA 2VPDA 4WA6A 3NG2A 4O64A 2CSYA 3O7AA 3HCUA 3I2DA 1U6GB 1VFYA 5B8DA 3PHDA 3L11A 5TBNA 2HDPA 2M85A 1JM7A 1WIMA 4AP4A 4ZDTA 5TDWA 4FIPA 2KGIA 3M62A 4I7CA 4FO9A 1WE9A 4B7YC 2RI7A 4V3KC 3T6RA 2YURA 1VD4A 4XI1A 5D1MB 4S3OB 1FBVA 2KWKA 2KWNA 2IDAA 4FK5A 5AIUA 2DX8A 2L5UA 4YAXA 2KYUA 4AUQB 3U5PA 4CCGX 4FJCA 2MUMA 3U5MA 1X4IA 2VPGA 1WEUA 5D1LB 2YSMA 4ZUXU 2K16A 5DINA 1RMDA 5B78A 2K17A 2E6SA 1E4UA 2LRIC 3HCSA 3KV6A 5H9MA 2H0DA 2CKLB 4YABA 2MT5A 3GV4A 1V87A 2LN0A 2FSAA 3N9PA 2L0BA 3SHBA 2Y1MA 2C2LA 4YBMA 3L1XA 4WZ2A 5EYAF 2M6MA 2RSDA 3SOXA 3O35A 5FEYA 5LKTA 2K4DA 3L1ZB 1WEOA 4I7DA 3M63A 3ZTGA 1Z60A 2M3HA 4LJNA 1MM2A 2QIZA 2ECNA 2ZETC 4N3WA 3C6WA 5G04B 2D8SA 2ECTA 1LDKC 2ECJA 2JMDA 3KV5A 5D1KB 2G45A 2JMIA 1WESA 2PUYA 4BHWA 3O34A 2CKLA 3PUQA 4P5OB 3U5NA 4IC2A 4V3LC 3KQIA 2XB1A 2H0DB 4AVXA 4B86C 1JOCA 2YSJA 5LKZA 2QICA 5KH7A 3EB5A 3RPGB 3RPGC 4PPEA 3O36A 2BAYA 5FB1A 3ZYQA 2ECVA 2I50A 2JMJA 2G6QA 2XEUA 4YADA 3ZNIA 2EA6A 2C2VS 4A0CD 4A4BA 4R2YA 1Z2QA 1FP0A 4S3OC 4X3GA 2L80A 3DPLR 5B75A 4YBSA 2KWOA 1WEMA 2HYED 3LQIA 3QZVA 1XWHA 2YU4A 4QF2A 2YREA 2F42A 5TRBA 5B79A 5C13A 4GNGA 5G0FA 3O70A 3N9QA 4QF3A 1G25A
chains in the Genus database with same CATH superfamily
2YUCA 2YT5A 3ZVZB 2KKXA 1T1HA 2LV9A 1K2FA 2KREA 1WEQA 2YQMA 4IC3A 5B76A 1WGMA 2Y1NA 1WFKA 2LDRA 1F62A 2ECGA 3FANA 2JM3A 4H9DA 3EB6A 2VP7A 4CA1A 2KR4A 4R8PK 3LRQA 3N9LA 2K1JA 5C11A 5TDRA 3LQJA 2JRJA 1BORA 2M1RA 2F6NA 5J3XA 3DQVR 2PNXA 2KIZA 2L7PA 3RTRB 2F6JA 2CT2A 1DVPA 1VYXA 5AITA 4OGEA 3N9NA 4L58A 2CONA 2EGPA 5DKAA 3SOUA 1LDJB 2Y43A 4Q6FA 3ZVYA 2VNFA 4AYCB 4I7BA 5KH3A 2QJ0A 2MD7B 4LADB 4GNDA 4ZQLA 1WENA 2M13A 2KE1A 4L7XA 4LK9A 3N9MA 2VJEB 5H1VA 2KFTA 4NN2A 5LKUA 2JUNA 3ZPV1 2LGGA 3VK6A 1WEPA 3U5OA 3E2DA 2L43A 2AN6A 2YVRA 4GB0A 5G05B 4TKPB 5LCWB 3IHPA 5KH9A 4F52B 5I3LA 5H1UA 2YQLA 2LXHC 1WEVA 1WEWA 2LGVA 3LQHA 5LKXA 5H1TA 4GNEA 1WILA 4UP0A 1MM3A 3FL2A 5FB0A 2EGMA 1N87A 2VJFB 2ECIA 2ECWA 3N9OA 2LGKA 3Q1DA 4MVTA 4PTBA 2LAUA 2OXQC 2MNZA 2CSVA 4C9ZA 2MA6A 3O47A 5JG6A 3ZPVE 4AYCA 1WEEA 1HYJA 3HCTA 3MHSA 4N4FA 2MIQA 1ZBDB 3O37A 4WZ0A 3M99A 3C5KA 2MA5A 2E6RA 2VJEA 2LGLA 4YATA 2FFWA 2KU3A 2L75A 4WZ3B 3SOWA 2VPBA 3PLWA 2MD8C 4UP5A 4Z0RA 4UI9B 4R7EA 3T9KA 3KNVA 3SUBA 2KGGA 4MSXA 1IYMA 5B77A 3ASLA 3H7HA 1X4JA 2FUUA 3MHHA 2VJFA 4YBTA 2B0OE 2YYRA 3DWDA 1JM7B 2KWJA 3PURA 4A4CA 2YW8A 3FJUB 5TABA 1HYIA 1Z6UA 2YHOA 3T7LA 2LQ6A 2D8UA 2LXPC 2MNYA 1CHCA 4BBQA 5FERA 3LDYA 4YC9A 3O33A 2G43A 2YHNA 4LKAA 2FD4A 2UZGA 2NAAA 2EODA 4Z0OA 2FUIA 3HTKC 2RR4A 3GL6A 4O62A 4LLBA 4W4UA 1X4UA 2MKEA 3V43A 2CSZA 4GNFA 4A49A 2VPEA 2VPDA 4WA6A 3NG2A 4O64A 2CSYA 3O7AA 2DJAA 3HCUA 3I2DA 1U6GB 1VFYA 5B8DA 3PHDA 3L11A 5TBNA 2HDPA 2M85A 1JM7A 1WIMA 4AP4A 4ZDTA 5TDWA 4FIPA 3FEHA 2KGIA 3M62A 4I7CA 3JUEA 4FO9A 1WE9A 4B7YC 2RI7A 4V3KC 2YURA 1VD4A 3T6RA 4XI1A 5D1MB 4S3OB 1FBVA 2KWKA 2KWNA 2IDAA 4FK5A 5AIUA 2DX8A 2L5UA 4YAXA 2KYUA 4AUQB 3U5PA 4CCGX 4FJCA 2MUMA 3U5MA 2IQJA 1X4IA 2XOZA 3DDTA 2VPGA 1WEUA 5D1LB 2YSMA 3FAOA 4ZUXU 5SVYA 5SVIB 2K16A 5DINA 1RMDA 5B78A 2K17A 2E6SA 1E4UA 2LRIC 3HCSA 3KV6A 5H9MA 2H0DA 2XOYA 2CKLB 4YABA 2MT5A 3GV4A 1V87A 2LN0A 2FSAA 3N9PA 2L0BA 3SHBA 3FM8C 2KKYA 2Y1MA 2C2LA 4YBMA 3L1XA 4WZ2A 5EYAF 2M6MA 2RSDA 2CRRA 3SOXA 3O35A 5FEYA 5LKTA 2K4DA 3L1ZB 1WEOA 4I7DA 3M63A 3ZTGA 1Z60A 2M3HA 4LJNA 1MM2A 2QIZA 2ECNA 2ZETC 4N3WA 3C6WA 2P57A 5K3QA 5G04B 5SVIA 2D8SA 2XP0A 2ECTA 1LDKC 3MDBC 2ECJA 2JMDA 3KDEC 3KV5A 5D1KB 2G45A 2JMIA 3LVRE 1WESA 2PUYA 4BHWA 2CRWA 3O34A 2XOCA 3PUQA 2CKLA 4P5OB 4F1PA 3U5NA 4IC2A 4V3LC 3KQIA 2XB1A 2H0DB 4AVXA 4B86C 1JOCA 2YSJA 3LVQE 5LKZA 2QICA 5KH7A 3EB5A 3RPGB 3RPGC 4PPEA 4OGCA 3O36A 2BAYA 5FB1A 3ZYQA 2ECVA 2I50A 2JMJA 2G6QA 3LJUX 2XEUA 1MBMA 4YADA 3ZNIA 2EXUA 2EA6A 2C2VS 4A0CD 4A4BA 4R2YA 1Z2QA 1FP0A 4QQ4A 4S3OC 4X3GA 2OWAA 2L80A 3DPLR 5B75A 4YBSA 2KWOA 1WEMA 2HYED 3LQIA 3QZVA 1XWHA 2YU4A 4QF2A 2YREA 2F42A 2DSMA 5TRBA 5B79A 5C13A 3M7KA 1DCQA 4GNGA 5SVXA 5G0FA 3O70A 3N9QA 4QF3A 1G25A 2E61A
chains in the Genus database with same CATH topology
2YUCA 2YT5A 3ZVZB 1T1HA 2LV9A 1K2FA 2KREA 1WEQA 2YQMA 4IC3A 5B76A 1WGMA 2Y1NA 1WFKA 2LDRA 1F62A 2ECGA 3EB6A 2VP7A 4CA1A 2KR4A 4R8PK 3LRQA 3N9LA 2K1JA 5C11A 5TDRA 3LQJA 2JRJA 1BORA 2M1RA 2F6NA 5J3XA 3DQVR 2PNXA 2KIZA 3RTRB 2F6JA 2CT2A 1DVPA 1VYXA 5AITA 3N9NA 4L58A 2EGPA 5DKAA 3SOUA 1LDJB 2Y43A 4Q6FA 3ZVYA 2VNFA 4AYCB 4I7BA 5KH3A 2QJ0A 2MD7B 4LADB 4GNDA 4ZQLA 1WENA 2KE1A 4L7XA 4LK9A 3N9MA 2VJEB 5H1VA 2KFTA 4NN2A 5LKUA 3ZPV1 2LGGA 3VK6A 1WEPA 3U5OA 2L43A 2AN6A 4GB0A 5G05B 4TKPB 5LCWB 3IHPA 5KH9A 4F52B 5I3LA 5H1UA 2YQLA 2LXHC 1WEVA 1WEWA 2LGVA 3LQHA 5LKXA 5H1TA 4GNEA 1WILA 4UP0A 1MM3A 3FL2A 5FB0A 1N87A 2VJFB 2ECIA 2ECWA 3N9OA 2LGKA 4MVTA 4PTBA 2OXQC 2MNZA 4C9ZA 2MA6A 5JG6A 3ZPVE 4AYCA 1WEEA 1HYJA 3HCTA 3MHSA 4N4FA 2MIQA 1ZBDB 3O37A 4WZ0A 3M99A 3C5KA 2MA5A 2E6RA 2VJEA 2LGLA 4YATA 2KU3A 2L75A 4WZ3B 3SOWA 2VPBA 2MD8C 4UP5A 4UI9B 4R7EA 3KNVA 2KGGA 4MSXA 1IYMA 5B77A 3ASLA 1X4JA 2FUUA 3MHHA 2VJFA 4YBTA 2YYRA 1JM7B 2KWJA 3PURA 4A4CA 2YW8A 5TABA 1HYIA 1Z6UA 2YHOA 3T7LA 2LQ6A 2LXPC 2MNYA 1CHCA 4BBQA 5FERA 4YC9A 3O33A 2G43A 2YHNA 4LKAA 2UZGA 2NAAA 2EODA 2FUIA 3HTKC 3GL6A 4LLBA 4W4UA 1X4UA 3V43A 2CSZA 4GNFA 4A49A 2VPEA 2VPDA 4WA6A 3NG2A 4O64A 2CSYA 3O7AA 3HCUA 3I2DA 1U6GB 1VFYA 5B8DA 3PHDA 3L11A 5TBNA 2HDPA 2M85A 1JM7A 1WIMA 4AP4A 4ZDTA 5TDWA 4FIPA 2KGIA 3M62A 4I7CA 4FO9A 1WE9A 4B7YC 2RI7A 4V3KC 3T6RA 2YURA 1VD4A 4XI1A 5D1MB 4S3OB 1FBVA 2KWKA 2KWNA 2IDAA 4FK5A 5AIUA 2DX8A 2L5UA 4YAXA 2KYUA 4AUQB 3U5PA 4CCGX 4FJCA 2MUMA 3U5MA 1X4IA 2VPGA 1WEUA 5D1LB 2YSMA 4ZUXU 2K16A 5DINA 1RMDA 5B78A 2K17A 2E6SA 1E4UA 2LRIC 3HCSA 3KV6A 5H9MA 2H0DA 2CKLB 4YABA 2MT5A 3GV4A 1V87A 2LN0A 2FSAA 3N9PA 2L0BA 3SHBA 2Y1MA 2C2LA 4YBMA 3L1XA 4WZ2A 5EYAF 2M6MA 2RSDA 3SOXA 3O35A 5FEYA 5LKTA 2K4DA 3L1ZB 1WEOA 4I7DA 3M63A 3ZTGA 1Z60A 2M3HA 4LJNA 1MM2A 2QIZA 2ECNA 2ZETC 4N3WA 3C6WA 5G04B 2D8SA 2ECTA 1LDKC 2ECJA 2JMDA 3KV5A 5D1KB 2G45A 2JMIA 1WESA 2PUYA 4BHWA 3O34A 2CKLA 3PUQA 4P5OB 3U5NA 4IC2A 4V3LC 3KQIA 2XB1A 2H0DB 4AVXA 4B86C 1JOCA 2YSJA 5LKZA 2QICA 5KH7A 3EB5A 3RPGB 3RPGC 4PPEA 3O36A 2BAYA 5FB1A 3ZYQA 2ECVA 2I50A 2JMJA 2G6QA 2XEUA 4YADA 3ZNIA 2EA6A 2C2VS 4A0CD 4A4BA 4R2YA 1Z2QA 1FP0A 4S3OC 4X3GA 2L80A 3DPLR 5B75A 4YBSA 2KWOA 1WEMA 2HYED 3LQIA 3QZVA 1XWHA 2YU4A 4QF2A 2YREA 2F42A 5TRBA 5B79A 5C13A 4GNGA 5G0FA 3O70A 3N9QA 4QF3A 1G25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YUC A;  2YT5 A;  3ZVZ B;  1T1H A;  2LV9 A;  1K2F A;  2KRE A;  1WEQ A;  2YQM A;  4IC3 A;  5B76 A;  1WGM A;  2Y1N A;  1WFK A;  2LDR A;  1F62 A;  2ECG A;  3EB6 A;  2VP7 A;  4CA1 A;  2KR4 A;  4R8P K;  3LRQ A;  3N9L A;  2K1J A;  5C11 A;  5TDR A;  3LQJ A;  2JRJ A;  1BOR A;  2M1R A;  2F6N A;  5J3X A;  3DQV R;  2PNX A;  2KIZ A;  3RTR B;  2F6J A;  2CT2 A;  1DVP A;  1VYX A;  5AIT A;  3N9N A;  4L58 A;  2EGP A;  5DKA A;  3SOU A;  1LDJ B;  2Y43 A;  4Q6F A;  3ZVY A;  2VNF A;  4AYC B;  4I7B A;  5KH3 A;  2QJ0 A;  2MD7 B;  4LAD B;  4GND A;  4ZQL A;  1WEN A;  2KE1 A;  4L7X A;  4LK9 A;  3N9M A;  2VJE B;  5H1V A;  2KFT A;  4NN2 A;  5LKU A;  3ZPV 1;  2LGG A;  3VK6 A;  1WEP A;  3U5O A;  2L43 A;  2AN6 A;  4GB0 A;  5G05 B;  4TKP B;  5LCW B;  3IHP A;  5KH9 A;  4F52 B;  5I3L A;  5H1U A;  2YQL A;  2LXH C;  1WEV A;  1WEW A;  2LGV A;  3LQH A;  5LKX A;  5H1T A;  4GNE A;  1WIL A;  4UP0 A;  1MM3 A;  3FL2 A;  5FB0 A;  1N87 A;  2VJF B;  2ECI A;  2ECW A;  3N9O A;  2LGK A;  4MVT A;  4PTB A;  2OXQ C;  2MNZ A;  4C9Z A;  2MA6 A;  5JG6 A;  3ZPV E;  4AYC A;  1WEE A;  1HYJ A;  3HCT A;  3MHS A;  4N4F A;  2MIQ A;  1ZBD B;  3O37 A;  4WZ0 A;  3M99 A;  3C5K A;  2MA5 A;  2E6R A;  2VJE A;  2LGL A;  4YAT A;  2KU3 A;  2L75 A;  4WZ3 B;  3SOW A;  2VPB A;  2MD8 C;  4UP5 A;  4UI9 B;  4R7E A;  3KNV A;  2KGG A;  4MSX A;  1IYM A;  5B77 A;  3ASL A;  1X4J A;  2FUU A;  3MHH A;  2VJF A;  4YBT A;  2YYR A;  1JM7 B;  2KWJ A;  3PUR A;  4A4C A;  2YW8 A;  5TAB A;  1HYI A;  1Z6U A;  2YHO A;  3T7L A;  2LQ6 A;  2LXP C;  2MNY A;  1CHC A;  4BBQ A;  5FER A;  4YC9 A;  3O33 A;  2G43 A;  2YHN A;  4LKA A;  2UZG A;  2NAA A;  2EOD A;  2FUI A;  3HTK C;  3GL6 A;  4LLB A;  4W4U A;  1X4U A;  3V43 A;  2CSZ A;  4GNF A;  4A49 A;  2VPE A;  2VPD A;  4WA6 A;  3NG2 A;  4O64 A;  2CSY A;  3O7A A;  3HCU A;  3I2D A;  1U6G B;  1VFY A;  5B8D A;  3PHD A;  3L11 A;  5TBN A;  2HDP A;  2M85 A;  1JM7 A;  1WIM A;  4AP4 A;  4ZDT A;  5TDW A;  4FIP A;  2KGI A;  3M62 A;  4I7C A;  4FO9 A;  1WE9 A;  4B7Y C;  2RI7 A;  4V3K C;  3T6R A;  2YUR A;  1VD4 A;  4XI1 A;  5D1M B;  4S3O B;  1FBV A;  2KWK A;  2KWN A;  2IDA A;  4FK5 A;  5AIU A;  2DX8 A;  2L5U A;  4YAX A;  2KYU A;  4AUQ B;  3U5P A;  4CCG X;  4FJC A;  2MUM A;  3U5M A;  1X4I A;  2VPG A;  1WEU A;  5D1L B;  2YSM A;  4ZUX U;  2K16 A;  5DIN A;  1RMD A;  5B78 A;  2K17 A;  2E6S A;  1E4U A;  2LRI C;  3HCS A;  3KV6 A;  5H9M A;  2H0D A;  2CKL B;  4YAB A;  2MT5 A;  3GV4 A;  1V87 A;  2LN0 A;  2FSA A;  3N9P A;  2L0B A;  3SHB A;  2Y1M A;  2C2L A;  4YBM A;  3L1X A;  4WZ2 A;  5EYA F;  2M6M A;  2RSD A;  3SOX A;  3O35 A;  5FEY A;  5LKT A;  2K4D A;  3L1Z B;  1WEO A;  4I7D A;  3M63 A;  3ZTG A;  1Z60 A;  2M3H A;  4LJN A;  1MM2 A;  2QIZ A;  2ECN A;  2ZET C;  4N3W A;  3C6W A;  5G04 B;  2D8S A;  2ECT A;  1LDK C;  2ECJ A;  2JMD A;  3KV5 A;  5D1K B;  2G45 A;  2JMI A;  1WES A;  2PUY A;  4BHW A;  3O34 A;  2CKL A;  3PUQ A;  4P5O B;  3U5N A;  4IC2 A;  4V3L C;  3KQI A;  2XB1 A;  2H0D B;  4AVX A;  4B86 C;  1JOC A;  2YSJ A;  5LKZ A;  2QIC A;  5KH7 A;  3EB5 A;  3RPG B;  3RPG C;  4PPE A;  3O36 A;  2BAY A;  5FB1 A;  3ZYQ A;  2ECV A;  2I50 A;  2JMJ A;  2G6Q A;  2XEU A;  4YAD A;  3ZNI A;  2EA6 A;  2C2V S;  4A0C D;  4A4B A;  4R2Y A;  1Z2Q A;  1FP0 A;  4S3O C;  4X3G A;  2L80 A;  3DPL R;  5B75 A;  4YBS A;  2KWO A;  1WEM A;  2HYE D;  3LQI A;  3QZV A;  1XWH A;  2YU4 A;  4QF2 A;  2YRE A;  2F42 A;  5TRB A;  5B79 A;  5C13 A;  4GNG A;  5G0F A;  3O70 A;  3N9Q A;  4QF3 A;  1G25 A; 
#chains in the Genus database with same CATH topology
 2YUC A;  2YT5 A;  3ZVZ B;  2KKX A;  1T1H A;  2LV9 A;  1K2F A;  2KRE A;  1WEQ A;  2YQM A;  4IC3 A;  5B76 A;  1WGM A;  2Y1N A;  1WFK A;  2LDR A;  1F62 A;  2ECG A;  3FAN A;  2JM3 A;  4H9D A;  3EB6 A;  2VP7 A;  4CA1 A;  2KR4 A;  4R8P K;  3LRQ A;  3N9L A;  2K1J A;  5C11 A;  5TDR A;  3LQJ A;  2JRJ A;  1BOR A;  2M1R A;  2F6N A;  5J3X A;  3DQV R;  2PNX A;  2KIZ A;  2L7P A;  3RTR B;  2F6J A;  2CT2 A;  1DVP A;  1VYX A;  5AIT A;  4OGE A;  3N9N A;  4L58 A;  2CON A;  2EGP A;  5DKA A;  3SOU A;  1LDJ B;  2Y43 A;  4Q6F A;  3ZVY A;  2VNF A;  4AYC B;  4I7B A;  5KH3 A;  2QJ0 A;  2MD7 B;  4LAD B;  4GND A;  4ZQL A;  1WEN A;  2M13 A;  2KE1 A;  4L7X A;  4LK9 A;  3N9M A;  2VJE B;  5H1V A;  2KFT A;  4NN2 A;  5LKU A;  2JUN A;  3ZPV 1;  2LGG A;  3VK6 A;  1WEP A;  3U5O A;  3E2D A;  2L43 A;  2AN6 A;  2YVR A;  4GB0 A;  5G05 B;  4TKP B;  5LCW B;  3IHP A;  5KH9 A;  4F52 B;  5I3L A;  5H1U A;  2YQL A;  2LXH C;  1WEV A;  1WEW A;  2LGV A;  3LQH A;  5LKX A;  5H1T A;  4GNE A;  1WIL A;  4UP0 A;  1MM3 A;  3FL2 A;  5FB0 A;  2EGM A;  1N87 A;  2VJF B;  2ECI A;  2ECW A;  3N9O A;  2LGK A;  3Q1D A;  4MVT A;  4PTB A;  2LAU A;  2OXQ C;  2MNZ A;  2CSV A;  4C9Z A;  2MA6 A;  3O47 A;  5JG6 A;  3ZPV E;  4AYC A;  1WEE A;  1HYJ A;  3HCT A;  3MHS A;  4N4F A;  2MIQ A;  1ZBD B;  3O37 A;  4WZ0 A;  3M99 A;  3C5K A;  2MA5 A;  2E6R A;  2VJE A;  2LGL A;  4YAT A;  2FFW A;  2KU3 A;  2L75 A;  4WZ3 B;  3SOW A;  2VPB A;  3PLW A;  2MD8 C;  4UP5 A;  4Z0R A;  4UI9 B;  4R7E A;  3T9K A;  3KNV A;  3SUB A;  2KGG A;  4MSX A;  1IYM A;  5B77 A;  3ASL A;  3H7H A;  1X4J A;  2FUU A;  3MHH A;  2VJF A;  4YBT A;  2B0O E;  2YYR A;  3DWD A;  1JM7 B;  2KWJ A;  3PUR A;  4A4C A;  2YW8 A;  3FJU B;  5TAB A;  1HYI A;  1Z6U A;  2YHO A;  3T7L A;  2LQ6 A;  2D8U A;  2LXP C;  2MNY A;  1CHC A;  4BBQ A;  5FER A;  3LDY A;  4YC9 A;  3O33 A;  2G43 A;  2YHN A;  4LKA A;  2FD4 A;  2UZG A;  2NAA A;  2EOD A;  4Z0O A;  2FUI A;  3HTK C;  2RR4 A;  3GL6 A;  4O62 A;  4LLB A;  4W4U A;  1X4U A;  2MKE A;  3V43 A;  2CSZ A;  4GNF A;  4A49 A;  2VPE A;  2VPD A;  4WA6 A;  3NG2 A;  4O64 A;  2CSY A;  3O7A A;  2DJA A;  3HCU A;  3I2D A;  1U6G B;  1VFY A;  5B8D A;  3PHD A;  3L11 A;  5TBN A;  2HDP A;  2M85 A;  1JM7 A;  1WIM A;  4AP4 A;  4ZDT A;  5TDW A;  4FIP A;  3FEH A;  2KGI A;  3M62 A;  4I7C A;  3JUE A;  4FO9 A;  1WE9 A;  4B7Y C;  2RI7 A;  4V3K C;  2YUR A;  1VD4 A;  3T6R A;  4XI1 A;  5D1M B;  4S3O B;  1FBV A;  2KWK A;  2KWN A;  2IDA A;  4FK5 A;  5AIU A;  2DX8 A;  2L5U A;  4YAX A;  2KYU A;  4AUQ B;  3U5P A;  4CCG X;  4FJC A;  2MUM A;  3U5M A;  2IQJ A;  1X4I A;  2XOZ A;  3DDT A;  2VPG A;  1WEU A;  5D1L B;  2YSM A;  3FAO A;  4ZUX U;  5SVY A;  5SVI B;  2K16 A;  5DIN A;  1RMD A;  5B78 A;  2K17 A;  2E6S A;  1E4U A;  2LRI C;  3HCS A;  3KV6 A;  5H9M A;  2H0D A;  2XOY A;  2CKL B;  4YAB A;  2MT5 A;  3GV4 A;  1V87 A;  2LN0 A;  2FSA A;  3N9P A;  2L0B A;  3SHB A;  3FM8 C;  2KKY A;  2Y1M A;  2C2L A;  4YBM A;  3L1X A;  4WZ2 A;  5EYA F;  2M6M A;  2RSD A;  2CRR A;  3SOX A;  3O35 A;  5FEY A;  5LKT A;  2K4D A;  3L1Z B;  1WEO A;  4I7D A;  3M63 A;  3ZTG A;  1Z60 A;  2M3H A;  4LJN A;  1MM2 A;  2QIZ A;  2ECN A;  2ZET C;  4N3W A;  3C6W A;  2P57 A;  5K3Q A;  5G04 B;  5SVI A;  2D8S A;  2XP0 A;  2ECT A;  1LDK C;  3MDB C;  2ECJ A;  2JMD A;  3KDE C;  3KV5 A;  5D1K B;  2G45 A;  2JMI A;  3LVR E;  1WES A;  2PUY A;  4BHW A;  2CRW A;  3O34 A;  2XOC A;  3PUQ A;  2CKL A;  4P5O B;  4F1P A;  3U5N A;  4IC2 A;  4V3L C;  3KQI A;  2XB1 A;  2H0D B;  4AVX A;  4B86 C;  1JOC A;  2YSJ A;  3LVQ E;  5LKZ A;  2QIC A;  5KH7 A;  3EB5 A;  3RPG B;  3RPG C;  4PPE A;  4OGC A;  3O36 A;  2BAY A;  5FB1 A;  3ZYQ A;  2ECV A;  2I50 A;  2JMJ A;  2G6Q A;  3LJU X;  2XEU A;  1MBM A;  4YAD A;  3ZNI A;  2EXU A;  2EA6 A;  2C2V S;  4A0C D;  4A4B A;  4R2Y A;  1Z2Q A;  1FP0 A;  4QQ4 A;  4S3O C;  4X3G A;  2OWA A;  2L80 A;  3DPL R;  5B75 A;  4YBS A;  2KWO A;  1WEM A;  2HYE D;  3LQI A;  3QZV A;  1XWH A;  2YU4 A;  4QF2 A;  2YRE A;  2F42 A;  2DSM A;  5TRB A;  5B79 A;  5C13 A;  3M7K A;  1DCQ A;  4GNG A;  5SVX A;  5G0F A;  3O70 A;  3N9Q A;  4QF3 A;  1G25 A;  2E61 A; 
#chains in the Genus database with same CATH homology
 2YUC A;  2YT5 A;  3ZVZ B;  1T1H A;  2LV9 A;  1K2F A;  2KRE A;  1WEQ A;  2YQM A;  4IC3 A;  5B76 A;  1WGM A;  2Y1N A;  1WFK A;  2LDR A;  1F62 A;  2ECG A;  3EB6 A;  2VP7 A;  4CA1 A;  2KR4 A;  4R8P K;  3LRQ A;  3N9L A;  2K1J A;  5C11 A;  5TDR A;  3LQJ A;  2JRJ A;  1BOR A;  2M1R A;  2F6N A;  5J3X A;  3DQV R;  2PNX A;  2KIZ A;  3RTR B;  2F6J A;  2CT2 A;  1DVP A;  1VYX A;  5AIT A;  3N9N A;  4L58 A;  2EGP A;  5DKA A;  3SOU A;  1LDJ B;  2Y43 A;  4Q6F A;  3ZVY A;  2VNF A;  4AYC B;  4I7B A;  5KH3 A;  2QJ0 A;  2MD7 B;  4LAD B;  4GND A;  4ZQL A;  1WEN A;  2KE1 A;  4L7X A;  4LK9 A;  3N9M A;  2VJE B;  5H1V A;  2KFT A;  4NN2 A;  5LKU A;  3ZPV 1;  2LGG A;  3VK6 A;  1WEP A;  3U5O A;  2L43 A;  2AN6 A;  4GB0 A;  5G05 B;  4TKP B;  5LCW B;  3IHP A;  5KH9 A;  4F52 B;  5I3L A;  5H1U A;  2YQL A;  2LXH C;  1WEV A;  1WEW A;  2LGV A;  3LQH A;  5LKX A;  5H1T A;  4GNE A;  1WIL A;  4UP0 A;  1MM3 A;  3FL2 A;  5FB0 A;  1N87 A;  2VJF B;  2ECI A;  2ECW A;  3N9O A;  2LGK A;  4MVT A;  4PTB A;  2OXQ C;  2MNZ A;  4C9Z A;  2MA6 A;  5JG6 A;  3ZPV E;  4AYC A;  1WEE A;  1HYJ A;  3HCT A;  3MHS A;  4N4F A;  2MIQ A;  1ZBD B;  3O37 A;  4WZ0 A;  3M99 A;  3C5K A;  2MA5 A;  2E6R A;  2VJE A;  2LGL A;  4YAT A;  2KU3 A;  2L75 A;  4WZ3 B;  3SOW A;  2VPB A;  2MD8 C;  4UP5 A;  4UI9 B;  4R7E A;  3KNV A;  2KGG A;  4MSX A;  1IYM A;  5B77 A;  3ASL A;  1X4J A;  2FUU A;  3MHH A;  2VJF A;  4YBT A;  2YYR A;  1JM7 B;  2KWJ A;  3PUR A;  4A4C A;  2YW8 A;  5TAB A;  1HYI A;  1Z6U A;  2YHO A;  3T7L A;  2LQ6 A;  2LXP C;  2MNY A;  1CHC A;  4BBQ A;  5FER A;  4YC9 A;  3O33 A;  2G43 A;  2YHN A;  4LKA A;  2UZG A;  2NAA A;  2EOD A;  2FUI A;  3HTK C;  3GL6 A;  4LLB A;  4W4U A;  1X4U A;  3V43 A;  2CSZ A;  4GNF A;  4A49 A;  2VPE A;  2VPD A;  4WA6 A;  3NG2 A;  4O64 A;  2CSY A;  3O7A A;  3HCU A;  3I2D A;  1U6G B;  1VFY A;  5B8D A;  3PHD A;  3L11 A;  5TBN A;  2HDP A;  2M85 A;  1JM7 A;  1WIM A;  4AP4 A;  4ZDT A;  5TDW A;  4FIP A;  2KGI A;  3M62 A;  4I7C A;  4FO9 A;  1WE9 A;  4B7Y C;  2RI7 A;  4V3K C;  3T6R A;  2YUR A;  1VD4 A;  4XI1 A;  5D1M B;  4S3O B;  1FBV A;  2KWK A;  2KWN A;  2IDA A;  4FK5 A;  5AIU A;  2DX8 A;  2L5U A;  4YAX A;  2KYU A;  4AUQ B;  3U5P A;  4CCG X;  4FJC A;  2MUM A;  3U5M A;  1X4I A;  2VPG A;  1WEU A;  5D1L B;  2YSM A;  4ZUX U;  2K16 A;  5DIN A;  1RMD A;  5B78 A;  2K17 A;  2E6S A;  1E4U A;  2LRI C;  3HCS A;  3KV6 A;  5H9M A;  2H0D A;  2CKL B;  4YAB A;  2MT5 A;  3GV4 A;  1V87 A;  2LN0 A;  2FSA A;  3N9P A;  2L0B A;  3SHB A;  2Y1M A;  2C2L A;  4YBM A;  3L1X A;  4WZ2 A;  5EYA F;  2M6M A;  2RSD A;  3SOX A;  3O35 A;  5FEY A;  5LKT A;  2K4D A;  3L1Z B;  1WEO A;  4I7D A;  3M63 A;  3ZTG A;  1Z60 A;  2M3H A;  4LJN A;  1MM2 A;  2QIZ A;  2ECN A;  2ZET C;  4N3W A;  3C6W A;  5G04 B;  2D8S A;  2ECT A;  1LDK C;  2ECJ A;  2JMD A;  3KV5 A;  5D1K B;  2G45 A;  2JMI A;  1WES A;  2PUY A;  4BHW A;  3O34 A;  2CKL A;  3PUQ A;  4P5O B;  3U5N A;  4IC2 A;  4V3L C;  3KQI A;  2XB1 A;  2H0D B;  4AVX A;  4B86 C;  1JOC A;  2YSJ A;  5LKZ A;  2QIC A;  5KH7 A;  3EB5 A;  3RPG B;  3RPG C;  4PPE A;  3O36 A;  2BAY A;  5FB1 A;  3ZYQ A;  2ECV A;  2I50 A;  2JMJ A;  2G6Q A;  2XEU A;  4YAD A;  3ZNI A;  2EA6 A;  2C2V S;  4A0C D;  4A4B A;  4R2Y A;  1Z2Q A;  1FP0 A;  4S3O C;  4X3G A;  2L80 A;  3DPL R;  5B75 A;  4YBS A;  2KWO A;  1WEM A;  2HYE D;  3LQI A;  3QZV A;  1XWH A;  2YU4 A;  4QF2 A;  2YRE A;  2F42 A;  5TRB A;  5B79 A;  5C13 A;  4GNG A;  5G0F A;  3O70 A;  3N9Q A;  4QF3 A;  1G25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...