5B79A

Crystal structure of dpf2 double phd finger
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
118
structure length
118
Chain Sequence
SNNYCDFCLGDSKINKKTGQPEELVSCSDCGRSGHPSCLQFTPVMMAAVKTYRWQCIECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPSMSEPPEGSWSCHLCLDLLKEKASIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
pubmed doi rcsb
molecule keywords Zinc finger protein ubi-d4
molecule tags Metal binding protein
source organism Homo sapiens
total genus 31
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2016-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b79A00
2CSYA 5B78A 1JOCA 3ZVYA 3LRQA 5LCWB 3N9LA 2BAYA 3RTRB 5JG6A 2LGKA 2XB1A 1T1HA 4FIPA 2VPEA 2FUUA 2LN0A 3NG2A 2VJEB 2K17A 5FEYA 3N9OA 4L58A 1WILA 5EYAF 5TBNA 3M63A 1V87A 2YU4A 1U6GB 3MHHA 4IC2A 4TKPB 2Y1MA 2HYED 2KREA 4YATA 2YHOA 2MNZA 5H1UA 4B86C 5H1VA 5KH3A 3ZVZB 3L1ZB 3U5MA 2F6NA 4AP4A 2HDPA 4S3OB 2RSDA 5FB0A 4WZ2A 4GNEA 2ECTA 2KGIA 2VJFB 1K2FA 3HCUA 3PURA 3KQIA 2LXHC 3I2DA 4LJNA 2M3HA 2IDAA 4IC3A 5G04B 5TABA 5B79A 4A4CA 3FL2A 2Y1NA 4UI9B 4WZ0A 1WEUA 2MNYA 5LKUA 2LGLA 4LADB 4V3LC 5TDRA 4ZDTA 4PTBA 1WEWA 3SOWA 2PNXA 4FJCA 5DKAA 5B76A 3ZTGA 5TRBA 1Z60A 2CKLA 5KH7A 5LKXA 2L80A 1MM3A 2LQ6A 2ECVA 2EODA 3DQVR 3N9NA 4MVTA 1XWHA 1WEVA 4O64A 4YABA 1VFYA 4I7CA 2K16A 5G05B 3QZVA 2KWOA 4YBTA 3SOXA 2L43A 2NAAA 5B75A 2LV9A 4QF3A 2JMDA 2YSMA 2VPBA 4A4BA 1F62A 3RPGC 2DX8A 2EA6A 2XEUA 3ZPV1 4YADA 3O34A 4B7YC 1WIMA 1VD4A 1WEPA 2VPDA 1WEQA 5B77A 2E6RA 3SHBA 1JM7B 3MHSA 3O70A 2KR4A 2G6QA 4AVXA 3O37A 3LQJA 4CCGX 3M62A 5AIUA 2LDRA 3O33A 3T6RA 1WESA 3O36A 5B8DA 2YSJA 2VJEA 3N9QA 4MSXA 2KWKA 3DPLR 4A49A 4YAXA 3SOUA 2VNFA 5C13A 1HYIA 2KYUA 1DVPA 4N4FA 3U5NA 5D1MB 2ECNA 4R7EA 1X4UA 2H0DA 3PUQA 1WENA 4P5OB 2MD8C 4ZUXU 3N9MA 4N3WA 1MM2A 2LGGA 1RMDA 5FERA 1LDKC 2M6MA 1X4JA 2YREA 3L11A 2KWJA 2JMIA 4S3OC 4YBSA 5DINA 1WEMA 1WEOA 1BORA 2YQMA 2ECWA 2RI7A 2VJFA 4AUQB 1FBVA 3PHDA 3KV5A 5H9MA 2K1JA 2KGGA 3EB6A 4FO9A 2Y43A 5LKZA 3M99A 1IYMA 2G45A 4BHWA 2EGPA 2KFTA 2ZETC 4UP5A 2M1RA 2LXPC 3VK6A 3U5PA 2C2VS 4L7XA 2KE1A 4Q6FA 2CSZA 1N87A 4AYCA 5D1LB 5LKTA 2LGVA 4C9ZA 2VPGA 1WE9A 3RPGB 1WFKA 2ECIA 3KNVA 4CA1A 1WEEA 5H1TA 2MA6A 2F42A 2JMJA 4LLBA 1FP0A 3C6WA 2YYRA 5J3XA 2YQLA 2QIZA 2JRJA 4FK5A 2L5UA 2KWNA 3C5KA 3L1XA 3LQHA 4GB0A 4XI1A 4WZ3B 3KV6A 5I3LA 1WGMA 2F6JA 2ECJA 2KIZA 4NN2A 2G43A 4YBMA 4WA6A 3LQIA 2L75A 1JM7A 3ZPVE 2H0DB 3GL6A 3T7LA 4W4UA 2CT2A 1ZBDB 4QF2A 2LRIC 4PPEA 2QJ0A 2YURA 3ZYQA 4R2YA 2MT5A 4GNGA 2ECGA 4LKAA 4F52B 5AITA 3O35A 2MUMA 3HTKC 2I50A 2M85A 2QICA 1E4UA 3ZNIA 2AN6A 2UZGA 3V43A 5C11A 1G25A 1LDJB 3O7AA 2C2LA 4LK9A 4YC9A 1Z2QA 5D1KB 4BBQA 5G0FA 2K4DA 4X3GA 4ZQLA 5TDWA 5FB1A 1X4IA 4R8PK 2MIQA 2YUCA 4GNDA 2CKLB 2PUYA 4I7BA 3HCTA 3GV4A 2E6SA 1HYJA 3U5OA 4GNFA 2MA5A 2KU3A 4V3KC 2OXQC 5KH9A 2VP7A 3HCSA 2MD7B 2L0BA 1Z6UA 2YW8A 2D8SA 4AYCB 2YT5A 3ASLA 3IHPA 4UP0A 1CHCA 3EB5A 2YHNA 2FSAA 3N9PA 2FUIA 4I7DA 1VYXA 4A0CD
chains in the Genus database with same CATH superfamily
2CSYA 5B78A 1JOCA 3ZVYA 3LRQA 5LCWB 3N9LA 2BAYA 3RTRB 5JG6A 3T9KA 2LGKA 2XB1A 2LAUA 1T1HA 1MBMA 2VPEA 4FIPA 3LJUX 2FUUA 2LN0A 2CRWA 3NG2A 2JUNA 2VJEB 3DDTA 2B0OE 2K17A 2XOYA 5FEYA 3N9OA 4L58A 1WILA 5EYAF 5TBNA 3M63A 1V87A 2YU4A 1U6GB 3MHHA 2CSVA 4IC2A 4TKPB 2Y1MA 2HYED 2E61A 2KREA 3Q1DA 4YATA 2YHOA 5SVXA 2MNZA 3FM8C 4B86C 5H1UA 5H1VA 5KH3A 3ZVZB 3L1ZB 3U5MA 2F6NA 4AP4A 2HDPA 4S3OB 2RSDA 5FB0A 4WZ2A 4GNEA 2ECTA 2KGIA 3FANA 2VJFB 1K2FA 3HCUA 3PURA 3KQIA 2LXHC 3I2DA 5SVIA 4LJNA 2M3HA 2IDAA 4IC3A 5G04B 5TABA 5B79A 4A4CA 3FL2A 2Y1NA 4UI9B 4WZ0A 1WEUA 2MNYA 5LKUA 2LGLA 4LADB 4V3LC 2P57A 5TDRA 4ZDTA 4PTBA 1WEWA 2CRRA 3SOWA 5SVYA 2PNXA 4FJCA 5DKAA 5B76A 3E2DA 3ZTGA 5TRBA 1Z60A 2CKLA 5KH7A 5LKXA 2FFWA 3M7KA 2L80A 1MM3A 2LQ6A 2XP0A 1DCQA 2ECVA 2EODA 3DQVR 3N9NA 4MVTA 1XWHA 1WEVA 4O64A 4YABA 1VFYA 4I7CA 2K16A 5G05B 3QZVA 2KWOA 4YBTA 3SOXA 2L43A 2NAAA 5B75A 3SUBA 2LV9A 4QF3A 2JMDA 2YSMA 2L7PA 2VPBA 4A4BA 1F62A 3RPGC 2DX8A 2DSMA 2EA6A 2XEUA 3PLWA 3FJUB 3ZPV1 4YADA 3O34A 4B7YC 1WIMA 1VD4A 1WEPA 2VPDA 1WEQA 3KDEC 4F1PA 5B77A 2E6RA 3SHBA 1JM7B 2KKXA 3MHSA 3O70A 2KR4A 2G6QA 4AVXA 3O47A 3O37A 3LQJA 4CCGX 3M62A 5AIUA 2LDRA 3O33A 3T6RA 1WESA 3O36A 5B8DA 2YSJA 2VJEA 3N9QA 3MDBC 4MSXA 2KWKA 3DPLR 4A49A 4YAXA 3SOUA 2VNFA 5C13A 1HYIA 2YVRA 2KYUA 1DVPA 4N4FA 3U5NA 5D1MB 2ECNA 4R7EA 1X4UA 2H0DA 3PUQA 1WENA 4P5OB 5SVIB 2MD8C 4ZUXU 3N9MA 4N3WA 1MM2A 2LGGA 1RMDA 5FERA 2MKEA 1LDKC 2M6MA 1X4JA 2YREA 3L11A 2KWJA 2D8UA 2JMIA 3LVRE 4S3OC 4YBSA 4OGEA 5DINA 1WEMA 1WEOA 1BORA 2YQMA 2ECWA 2RI7A 2VJFA 4AUQB 1FBVA 3PHDA 3KV5A 2XOCA 5H9MA 2K1JA 2M13A 2FD4A 2KGGA 3EB6A 4FO9A 2Y43A 3LVQE 5LKZA 2IQJA 3M99A 1IYMA 2G45A 4BHWA 2EGPA 2KFTA 2ZETC 4UP5A 2M1RA 2LXPC 3VK6A 3U5PA 4O62A 2C2VS 2CONA 4L7XA 2KE1A 4Q6FA 2CSZA 1N87A 4AYCA 5D1LB 5LKTA 2LGVA 4C9ZA 2VPGA 1WE9A 3RPGB 1WFKA 2ECIA 2RR4A 3KNVA 4CA1A 1WEEA 5H1TA 2OWAA 4OGCA 2MA6A 2F42A 2JMJA 5K3QA 4LLBA 1FP0A 3C6WA 2YYRA 5J3XA 2YQLA 2QIZA 2JRJA 4FK5A 2L5UA 2KWNA 3C5KA 3L1XA 3LQHA 4GB0A 4XI1A 4WZ3B 3KV6A 5I3LA 1WGMA 2F6JA 2ECJA 2KIZA 4NN2A 2G43A 4YBMA 2KKYA 4WA6A 3LQIA 2DJAA 2L75A 1JM7A 3ZPVE 2H0DB 3GL6A 3T7LA 3LDYA 4W4UA 2CT2A 1ZBDB 4QF2A 2LRIC 4PPEA 2QJ0A 2YURA 3ZYQA 4R2YA 2MT5A 4GNGA 2ECGA 4LKAA 4Z0RA 4F52B 5AITA 3O35A 2MUMA 3HTKC 2I50A 2M85A 2QICA 1E4UA 3ZNIA 2AN6A 2UZGA 3FAOA 3V43A 1VYXA 5C11A 1G25A 1LDJB 3O7AA 2C2LA 4LK9A 4YC9A 1Z2QA 5D1KB 4BBQA 5G0FA 2K4DA 4X3GA 4ZQLA 5TDWA 3FEHA 4Z0OA 5FB1A 1X4IA 4R8PK 2JM3A 2MIQA 2YUCA 4GNDA 2CKLB 2PUYA 4I7BA 3HCTA 3GV4A 2E6SA 1HYJA 3U5OA 4GNFA 2MA5A 2KU3A 4V3KC 2OXQC 5KH9A 2VP7A 3HCSA 2MD7B 2L0BA 4QQ4A 2XOZA 1Z6UA 2YW8A 2D8SA 4AYCB 2YT5A 3ASLA 3IHPA 4UP0A 4H9DA 1CHCA 3EB5A 3H7HA 3JUEA 3DWDA 2YHNA 2FSAA 3N9PA 2EGMA 2FUIA 4I7DA 2EXUA 4A0CD
chains in the Genus database with same CATH topology
2CSYA 5B78A 1JOCA 3ZVYA 3LRQA 5LCWB 3N9LA 2BAYA 3RTRB 5JG6A 2LGKA 2XB1A 1T1HA 4FIPA 2VPEA 2FUUA 2LN0A 3NG2A 2VJEB 2K17A 5FEYA 3N9OA 4L58A 1WILA 5EYAF 5TBNA 3M63A 1V87A 2YU4A 1U6GB 3MHHA 4IC2A 4TKPB 2Y1MA 2HYED 2KREA 4YATA 2YHOA 2MNZA 5H1UA 4B86C 5H1VA 5KH3A 3ZVZB 3L1ZB 3U5MA 2F6NA 4AP4A 2HDPA 4S3OB 2RSDA 5FB0A 4WZ2A 4GNEA 2ECTA 2KGIA 2VJFB 1K2FA 3HCUA 3PURA 3KQIA 2LXHC 3I2DA 4LJNA 2M3HA 2IDAA 4IC3A 5G04B 5TABA 5B79A 4A4CA 3FL2A 2Y1NA 4UI9B 4WZ0A 1WEUA 2MNYA 5LKUA 2LGLA 4LADB 4V3LC 5TDRA 4ZDTA 4PTBA 1WEWA 3SOWA 2PNXA 4FJCA 5DKAA 5B76A 3ZTGA 5TRBA 1Z60A 2CKLA 5KH7A 5LKXA 2L80A 1MM3A 2LQ6A 2ECVA 2EODA 3DQVR 3N9NA 4MVTA 1XWHA 1WEVA 4O64A 4YABA 1VFYA 4I7CA 2K16A 5G05B 3QZVA 2KWOA 4YBTA 3SOXA 2L43A 2NAAA 5B75A 2LV9A 4QF3A 2JMDA 2YSMA 2VPBA 4A4BA 1F62A 3RPGC 2DX8A 2EA6A 2XEUA 3ZPV1 4YADA 3O34A 4B7YC 1WIMA 1VD4A 1WEPA 2VPDA 1WEQA 5B77A 2E6RA 3SHBA 1JM7B 3MHSA 3O70A 2KR4A 2G6QA 4AVXA 3O37A 3LQJA 4CCGX 3M62A 5AIUA 2LDRA 3O33A 3T6RA 1WESA 3O36A 5B8DA 2YSJA 2VJEA 3N9QA 4MSXA 2KWKA 3DPLR 4A49A 4YAXA 3SOUA 2VNFA 5C13A 1HYIA 2KYUA 1DVPA 4N4FA 3U5NA 5D1MB 2ECNA 4R7EA 1X4UA 2H0DA 3PUQA 1WENA 4P5OB 2MD8C 4ZUXU 3N9MA 4N3WA 1MM2A 2LGGA 1RMDA 5FERA 1LDKC 2M6MA 1X4JA 2YREA 3L11A 2KWJA 2JMIA 4S3OC 4YBSA 5DINA 1WEMA 1WEOA 1BORA 2YQMA 2ECWA 2RI7A 2VJFA 4AUQB 1FBVA 3PHDA 3KV5A 5H9MA 2K1JA 2KGGA 3EB6A 4FO9A 2Y43A 5LKZA 3M99A 1IYMA 2G45A 4BHWA 2EGPA 2KFTA 2ZETC 4UP5A 2M1RA 2LXPC 3VK6A 3U5PA 2C2VS 4L7XA 2KE1A 4Q6FA 2CSZA 1N87A 4AYCA 5D1LB 5LKTA 2LGVA 4C9ZA 2VPGA 1WE9A 3RPGB 1WFKA 2ECIA 3KNVA 4CA1A 1WEEA 5H1TA 2MA6A 2F42A 2JMJA 4LLBA 1FP0A 3C6WA 2YYRA 5J3XA 2YQLA 2QIZA 2JRJA 4FK5A 2L5UA 2KWNA 3C5KA 3L1XA 3LQHA 4GB0A 4XI1A 4WZ3B 3KV6A 5I3LA 1WGMA 2F6JA 2ECJA 2KIZA 4NN2A 2G43A 4YBMA 4WA6A 3LQIA 2L75A 1JM7A 3ZPVE 2H0DB 3GL6A 3T7LA 4W4UA 2CT2A 1ZBDB 4QF2A 2LRIC 4PPEA 2QJ0A 2YURA 3ZYQA 4R2YA 2MT5A 4GNGA 2ECGA 4LKAA 4F52B 5AITA 3O35A 2MUMA 3HTKC 2I50A 2M85A 2QICA 1E4UA 3ZNIA 2AN6A 2UZGA 3V43A 5C11A 1G25A 1LDJB 3O7AA 2C2LA 4LK9A 4YC9A 1Z2QA 5D1KB 4BBQA 5G0FA 2K4DA 4X3GA 4ZQLA 5TDWA 5FB1A 1X4IA 4R8PK 2MIQA 2YUCA 4GNDA 2CKLB 2PUYA 4I7BA 3HCTA 3GV4A 2E6SA 1HYJA 3U5OA 4GNFA 2MA5A 2KU3A 4V3KC 2OXQC 5KH9A 2VP7A 3HCSA 2MD7B 2L0BA 1Z6UA 2YW8A 2D8SA 4AYCB 2YT5A 3ASLA 3IHPA 4UP0A 1CHCA 3EB5A 2YHNA 2FSAA 3N9PA 2FUIA 4I7DA 1VYXA 4A0CD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CSY A;  5B78 A;  1JOC A;  3ZVY A;  3LRQ A;  5LCW B;  3N9L A;  2BAY A;  3RTR B;  5JG6 A;  2LGK A;  2XB1 A;  1T1H A;  4FIP A;  2VPE A;  2FUU A;  2LN0 A;  3NG2 A;  2VJE B;  2K17 A;  5FEY A;  3N9O A;  4L58 A;  1WIL A;  5EYA F;  5TBN A;  3M63 A;  1V87 A;  2YU4 A;  1U6G B;  3MHH A;  4IC2 A;  4TKP B;  2Y1M A;  2HYE D;  2KRE A;  4YAT A;  2YHO A;  2MNZ A;  5H1U A;  4B86 C;  5H1V A;  5KH3 A;  3ZVZ B;  3L1Z B;  3U5M A;  2F6N A;  4AP4 A;  2HDP A;  4S3O B;  2RSD A;  5FB0 A;  4WZ2 A;  4GNE A;  2ECT A;  2KGI A;  2VJF B;  1K2F A;  3HCU A;  3PUR A;  3KQI A;  2LXH C;  3I2D A;  4LJN A;  2M3H A;  2IDA A;  4IC3 A;  5G04 B;  5TAB A;  5B79 A;  4A4C A;  3FL2 A;  2Y1N A;  4UI9 B;  4WZ0 A;  1WEU A;  2MNY A;  5LKU A;  2LGL A;  4LAD B;  4V3L C;  5TDR A;  4ZDT A;  4PTB A;  1WEW A;  3SOW A;  2PNX A;  4FJC A;  5DKA A;  5B76 A;  3ZTG A;  5TRB A;  1Z60 A;  2CKL A;  5KH7 A;  5LKX A;  2L80 A;  1MM3 A;  2LQ6 A;  2ECV A;  2EOD A;  3DQV R;  3N9N A;  4MVT A;  1XWH A;  1WEV A;  4O64 A;  4YAB A;  1VFY A;  4I7C A;  2K16 A;  5G05 B;  3QZV A;  2KWO A;  4YBT A;  3SOX A;  2L43 A;  2NAA A;  5B75 A;  2LV9 A;  4QF3 A;  2JMD A;  2YSM A;  2VPB A;  4A4B A;  1F62 A;  3RPG C;  2DX8 A;  2EA6 A;  2XEU A;  3ZPV 1;  4YAD A;  3O34 A;  4B7Y C;  1WIM A;  1VD4 A;  1WEP A;  2VPD A;  1WEQ A;  5B77 A;  2E6R A;  3SHB A;  1JM7 B;  3MHS A;  3O70 A;  2KR4 A;  2G6Q A;  4AVX A;  3O37 A;  3LQJ A;  4CCG X;  3M62 A;  5AIU A;  2LDR A;  3O33 A;  3T6R A;  1WES A;  3O36 A;  5B8D A;  2YSJ A;  2VJE A;  3N9Q A;  4MSX A;  2KWK A;  3DPL R;  4A49 A;  4YAX A;  3SOU A;  2VNF A;  5C13 A;  1HYI A;  2KYU A;  1DVP A;  4N4F A;  3U5N A;  5D1M B;  2ECN A;  4R7E A;  1X4U A;  2H0D A;  3PUQ A;  1WEN A;  4P5O B;  2MD8 C;  4ZUX U;  3N9M A;  4N3W A;  1MM2 A;  2LGG A;  1RMD A;  5FER A;  1LDK C;  2M6M A;  1X4J A;  2YRE A;  3L11 A;  2KWJ A;  2JMI A;  4S3O C;  4YBS A;  5DIN A;  1WEM A;  1WEO A;  1BOR A;  2YQM A;  2ECW A;  2RI7 A;  2VJF A;  4AUQ B;  1FBV A;  3PHD A;  3KV5 A;  5H9M A;  2K1J A;  2KGG A;  3EB6 A;  4FO9 A;  2Y43 A;  5LKZ A;  3M99 A;  1IYM A;  2G45 A;  4BHW A;  2EGP A;  2KFT A;  2ZET C;  4UP5 A;  2M1R A;  2LXP C;  3VK6 A;  3U5P A;  2C2V S;  4L7X A;  2KE1 A;  4Q6F A;  2CSZ A;  1N87 A;  4AYC A;  5D1L B;  5LKT A;  2LGV A;  4C9Z A;  2VPG A;  1WE9 A;  3RPG B;  1WFK A;  2ECI A;  3KNV A;  4CA1 A;  1WEE A;  5H1T A;  2MA6 A;  2F42 A;  2JMJ A;  4LLB A;  1FP0 A;  3C6W A;  2YYR A;  5J3X A;  2YQL A;  2QIZ A;  2JRJ A;  4FK5 A;  2L5U A;  2KWN A;  3C5K A;  3L1X A;  3LQH A;  4GB0 A;  4XI1 A;  4WZ3 B;  3KV6 A;  5I3L A;  1WGM A;  2F6J A;  2ECJ A;  2KIZ A;  4NN2 A;  2G43 A;  4YBM A;  4WA6 A;  3LQI A;  2L75 A;  1JM7 A;  3ZPV E;  2H0D B;  3GL6 A;  3T7L A;  4W4U A;  2CT2 A;  1ZBD B;  4QF2 A;  2LRI C;  4PPE A;  2QJ0 A;  2YUR A;  3ZYQ A;  4R2Y A;  2MT5 A;  4GNG A;  2ECG A;  4LKA A;  4F52 B;  5AIT A;  3O35 A;  2MUM A;  3HTK C;  2I50 A;  2M85 A;  2QIC A;  1E4U A;  3ZNI A;  2AN6 A;  2UZG A;  3V43 A;  5C11 A;  1G25 A;  1LDJ B;  3O7A A;  2C2L A;  4LK9 A;  4YC9 A;  1Z2Q A;  5D1K B;  4BBQ A;  5G0F A;  2K4D A;  4X3G A;  4ZQL A;  5TDW A;  5FB1 A;  1X4I A;  4R8P K;  2MIQ A;  2YUC A;  4GND A;  2CKL B;  2PUY A;  4I7B A;  3HCT A;  3GV4 A;  2E6S A;  1HYJ A;  3U5O A;  4GNF A;  2MA5 A;  2KU3 A;  4V3K C;  2OXQ C;  5KH9 A;  2VP7 A;  3HCS A;  2MD7 B;  2L0B A;  1Z6U A;  2YW8 A;  2D8S A;  4AYC B;  2YT5 A;  3ASL A;  3IHP A;  4UP0 A;  1CHC A;  3EB5 A;  2YHN A;  2FSA A;  3N9P A;  2FUI A;  4I7D A;  1VYX A;  4A0C D; 
#chains in the Genus database with same CATH topology
 2CSY A;  5B78 A;  1JOC A;  3ZVY A;  3LRQ A;  5LCW B;  3N9L A;  2BAY A;  3RTR B;  5JG6 A;  3T9K A;  2LGK A;  2XB1 A;  2LAU A;  1T1H A;  1MBM A;  2VPE A;  4FIP A;  3LJU X;  2FUU A;  2LN0 A;  2CRW A;  3NG2 A;  2JUN A;  2VJE B;  3DDT A;  2B0O E;  2K17 A;  2XOY A;  5FEY A;  3N9O A;  4L58 A;  1WIL A;  5EYA F;  5TBN A;  3M63 A;  1V87 A;  2YU4 A;  1U6G B;  3MHH A;  2CSV A;  4IC2 A;  4TKP B;  2Y1M A;  2HYE D;  2E61 A;  2KRE A;  3Q1D A;  4YAT A;  2YHO A;  5SVX A;  2MNZ A;  3FM8 C;  4B86 C;  5H1U A;  5H1V A;  5KH3 A;  3ZVZ B;  3L1Z B;  3U5M A;  2F6N A;  4AP4 A;  2HDP A;  4S3O B;  2RSD A;  5FB0 A;  4WZ2 A;  4GNE A;  2ECT A;  2KGI A;  3FAN A;  2VJF B;  1K2F A;  3HCU A;  3PUR A;  3KQI A;  2LXH C;  3I2D A;  5SVI A;  4LJN A;  2M3H A;  2IDA A;  4IC3 A;  5G04 B;  5TAB A;  5B79 A;  4A4C A;  3FL2 A;  2Y1N A;  4UI9 B;  4WZ0 A;  1WEU A;  2MNY A;  5LKU A;  2LGL A;  4LAD B;  4V3L C;  2P57 A;  5TDR A;  4ZDT A;  4PTB A;  1WEW A;  2CRR A;  3SOW A;  5SVY A;  2PNX A;  4FJC A;  5DKA A;  5B76 A;  3E2D A;  3ZTG A;  5TRB A;  1Z60 A;  2CKL A;  5KH7 A;  5LKX A;  2FFW A;  3M7K A;  2L80 A;  1MM3 A;  2LQ6 A;  2XP0 A;  1DCQ A;  2ECV A;  2EOD A;  3DQV R;  3N9N A;  4MVT A;  1XWH A;  1WEV A;  4O64 A;  4YAB A;  1VFY A;  4I7C A;  2K16 A;  5G05 B;  3QZV A;  2KWO A;  4YBT A;  3SOX A;  2L43 A;  2NAA A;  5B75 A;  3SUB A;  2LV9 A;  4QF3 A;  2JMD A;  2YSM A;  2L7P A;  2VPB A;  4A4B A;  1F62 A;  3RPG C;  2DX8 A;  2DSM A;  2EA6 A;  2XEU A;  3PLW A;  3FJU B;  3ZPV 1;  4YAD A;  3O34 A;  4B7Y C;  1WIM A;  1VD4 A;  1WEP A;  2VPD A;  1WEQ A;  3KDE C;  4F1P A;  5B77 A;  2E6R A;  3SHB A;  1JM7 B;  2KKX A;  3MHS A;  3O70 A;  2KR4 A;  2G6Q A;  4AVX A;  3O47 A;  3O37 A;  3LQJ A;  4CCG X;  3M62 A;  5AIU A;  2LDR A;  3O33 A;  3T6R A;  1WES A;  3O36 A;  5B8D A;  2YSJ A;  2VJE A;  3N9Q A;  3MDB C;  4MSX A;  2KWK A;  3DPL R;  4A49 A;  4YAX A;  3SOU A;  2VNF A;  5C13 A;  1HYI A;  2YVR A;  2KYU A;  1DVP A;  4N4F A;  3U5N A;  5D1M B;  2ECN A;  4R7E A;  1X4U A;  2H0D A;  3PUQ A;  1WEN A;  4P5O B;  5SVI B;  2MD8 C;  4ZUX U;  3N9M A;  4N3W A;  1MM2 A;  2LGG A;  1RMD A;  5FER A;  2MKE A;  1LDK C;  2M6M A;  1X4J A;  2YRE A;  3L11 A;  2KWJ A;  2D8U A;  2JMI A;  3LVR E;  4S3O C;  4YBS A;  4OGE A;  5DIN A;  1WEM A;  1WEO A;  1BOR A;  2YQM A;  2ECW A;  2RI7 A;  2VJF A;  4AUQ B;  1FBV A;  3PHD A;  3KV5 A;  2XOC A;  5H9M A;  2K1J A;  2M13 A;  2FD4 A;  2KGG A;  3EB6 A;  4FO9 A;  2Y43 A;  3LVQ E;  5LKZ A;  2IQJ A;  3M99 A;  1IYM A;  2G45 A;  4BHW A;  2EGP A;  2KFT A;  2ZET C;  4UP5 A;  2M1R A;  2LXP C;  3VK6 A;  3U5P A;  4O62 A;  2C2V S;  2CON A;  4L7X A;  2KE1 A;  4Q6F A;  2CSZ A;  1N87 A;  4AYC A;  5D1L B;  5LKT A;  2LGV A;  4C9Z A;  2VPG A;  1WE9 A;  3RPG B;  1WFK A;  2ECI A;  2RR4 A;  3KNV A;  4CA1 A;  1WEE A;  5H1T A;  2OWA A;  4OGC A;  2MA6 A;  2F42 A;  2JMJ A;  5K3Q A;  4LLB A;  1FP0 A;  3C6W A;  2YYR A;  5J3X A;  2YQL A;  2QIZ A;  2JRJ A;  4FK5 A;  2L5U A;  2KWN A;  3C5K A;  3L1X A;  3LQH A;  4GB0 A;  4XI1 A;  4WZ3 B;  3KV6 A;  5I3L A;  1WGM A;  2F6J A;  2ECJ A;  2KIZ A;  4NN2 A;  2G43 A;  4YBM A;  2KKY A;  4WA6 A;  3LQI A;  2DJA A;  2L75 A;  1JM7 A;  3ZPV E;  2H0D B;  3GL6 A;  3T7L A;  3LDY A;  4W4U A;  2CT2 A;  1ZBD B;  4QF2 A;  2LRI C;  4PPE A;  2QJ0 A;  2YUR A;  3ZYQ A;  4R2Y A;  2MT5 A;  4GNG A;  2ECG A;  4LKA A;  4Z0R A;  4F52 B;  5AIT A;  3O35 A;  2MUM A;  3HTK C;  2I50 A;  2M85 A;  2QIC A;  1E4U A;  3ZNI A;  2AN6 A;  2UZG A;  3FAO A;  3V43 A;  1VYX A;  5C11 A;  1G25 A;  1LDJ B;  3O7A A;  2C2L A;  4LK9 A;  4YC9 A;  1Z2Q A;  5D1K B;  4BBQ A;  5G0F A;  2K4D A;  4X3G A;  4ZQL A;  5TDW A;  3FEH A;  4Z0O A;  5FB1 A;  1X4I A;  4R8P K;  2JM3 A;  2MIQ A;  2YUC A;  4GND A;  2CKL B;  2PUY A;  4I7B A;  3HCT A;  3GV4 A;  2E6S A;  1HYJ A;  3U5O A;  4GNF A;  2MA5 A;  2KU3 A;  4V3K C;  2OXQ C;  5KH9 A;  2VP7 A;  3HCS A;  2MD7 B;  2L0B A;  4QQ4 A;  2XOZ A;  1Z6U A;  2YW8 A;  2D8S A;  4AYC B;  2YT5 A;  3ASL A;  3IHP A;  4UP0 A;  4H9D A;  1CHC A;  3EB5 A;  3H7H A;  3JUE A;  3DWD A;  2YHN A;  2FSA A;  3N9P A;  2EGM A;  2FUI A;  4I7D A;  2EXU A;  4A0C D; 
#chains in the Genus database with same CATH homology
 2CSY A;  5B78 A;  1JOC A;  3ZVY A;  3LRQ A;  5LCW B;  3N9L A;  2BAY A;  3RTR B;  5JG6 A;  2LGK A;  2XB1 A;  1T1H A;  4FIP A;  2VPE A;  2FUU A;  2LN0 A;  3NG2 A;  2VJE B;  2K17 A;  5FEY A;  3N9O A;  4L58 A;  1WIL A;  5EYA F;  5TBN A;  3M63 A;  1V87 A;  2YU4 A;  1U6G B;  3MHH A;  4IC2 A;  4TKP B;  2Y1M A;  2HYE D;  2KRE A;  4YAT A;  2YHO A;  2MNZ A;  5H1U A;  4B86 C;  5H1V A;  5KH3 A;  3ZVZ B;  3L1Z B;  3U5M A;  2F6N A;  4AP4 A;  2HDP A;  4S3O B;  2RSD A;  5FB0 A;  4WZ2 A;  4GNE A;  2ECT A;  2KGI A;  2VJF B;  1K2F A;  3HCU A;  3PUR A;  3KQI A;  2LXH C;  3I2D A;  4LJN A;  2M3H A;  2IDA A;  4IC3 A;  5G04 B;  5TAB A;  5B79 A;  4A4C A;  3FL2 A;  2Y1N A;  4UI9 B;  4WZ0 A;  1WEU A;  2MNY A;  5LKU A;  2LGL A;  4LAD B;  4V3L C;  5TDR A;  4ZDT A;  4PTB A;  1WEW A;  3SOW A;  2PNX A;  4FJC A;  5DKA A;  5B76 A;  3ZTG A;  5TRB A;  1Z60 A;  2CKL A;  5KH7 A;  5LKX A;  2L80 A;  1MM3 A;  2LQ6 A;  2ECV A;  2EOD A;  3DQV R;  3N9N A;  4MVT A;  1XWH A;  1WEV A;  4O64 A;  4YAB A;  1VFY A;  4I7C A;  2K16 A;  5G05 B;  3QZV A;  2KWO A;  4YBT A;  3SOX A;  2L43 A;  2NAA A;  5B75 A;  2LV9 A;  4QF3 A;  2JMD A;  2YSM A;  2VPB A;  4A4B A;  1F62 A;  3RPG C;  2DX8 A;  2EA6 A;  2XEU A;  3ZPV 1;  4YAD A;  3O34 A;  4B7Y C;  1WIM A;  1VD4 A;  1WEP A;  2VPD A;  1WEQ A;  5B77 A;  2E6R A;  3SHB A;  1JM7 B;  3MHS A;  3O70 A;  2KR4 A;  2G6Q A;  4AVX A;  3O37 A;  3LQJ A;  4CCG X;  3M62 A;  5AIU A;  2LDR A;  3O33 A;  3T6R A;  1WES A;  3O36 A;  5B8D A;  2YSJ A;  2VJE A;  3N9Q A;  4MSX A;  2KWK A;  3DPL R;  4A49 A;  4YAX A;  3SOU A;  2VNF A;  5C13 A;  1HYI A;  2KYU A;  1DVP A;  4N4F A;  3U5N A;  5D1M B;  2ECN A;  4R7E A;  1X4U A;  2H0D A;  3PUQ A;  1WEN A;  4P5O B;  2MD8 C;  4ZUX U;  3N9M A;  4N3W A;  1MM2 A;  2LGG A;  1RMD A;  5FER A;  1LDK C;  2M6M A;  1X4J A;  2YRE A;  3L11 A;  2KWJ A;  2JMI A;  4S3O C;  4YBS A;  5DIN A;  1WEM A;  1WEO A;  1BOR A;  2YQM A;  2ECW A;  2RI7 A;  2VJF A;  4AUQ B;  1FBV A;  3PHD A;  3KV5 A;  5H9M A;  2K1J A;  2KGG A;  3EB6 A;  4FO9 A;  2Y43 A;  5LKZ A;  3M99 A;  1IYM A;  2G45 A;  4BHW A;  2EGP A;  2KFT A;  2ZET C;  4UP5 A;  2M1R A;  2LXP C;  3VK6 A;  3U5P A;  2C2V S;  4L7X A;  2KE1 A;  4Q6F A;  2CSZ A;  1N87 A;  4AYC A;  5D1L B;  5LKT A;  2LGV A;  4C9Z A;  2VPG A;  1WE9 A;  3RPG B;  1WFK A;  2ECI A;  3KNV A;  4CA1 A;  1WEE A;  5H1T A;  2MA6 A;  2F42 A;  2JMJ A;  4LLB A;  1FP0 A;  3C6W A;  2YYR A;  5J3X A;  2YQL A;  2QIZ A;  2JRJ A;  4FK5 A;  2L5U A;  2KWN A;  3C5K A;  3L1X A;  3LQH A;  4GB0 A;  4XI1 A;  4WZ3 B;  3KV6 A;  5I3L A;  1WGM A;  2F6J A;  2ECJ A;  2KIZ A;  4NN2 A;  2G43 A;  4YBM A;  4WA6 A;  3LQI A;  2L75 A;  1JM7 A;  3ZPV E;  2H0D B;  3GL6 A;  3T7L A;  4W4U A;  2CT2 A;  1ZBD B;  4QF2 A;  2LRI C;  4PPE A;  2QJ0 A;  2YUR A;  3ZYQ A;  4R2Y A;  2MT5 A;  4GNG A;  2ECG A;  4LKA A;  4F52 B;  5AIT A;  3O35 A;  2MUM A;  3HTK C;  2I50 A;  2M85 A;  2QIC A;  1E4U A;  3ZNI A;  2AN6 A;  2UZG A;  3V43 A;  5C11 A;  1G25 A;  1LDJ B;  3O7A A;  2C2L A;  4LK9 A;  4YC9 A;  1Z2Q A;  5D1K B;  4BBQ A;  5G0F A;  2K4D A;  4X3G A;  4ZQL A;  5TDW A;  5FB1 A;  1X4I A;  4R8P K;  2MIQ A;  2YUC A;  4GND A;  2CKL B;  2PUY A;  4I7B A;  3HCT A;  3GV4 A;  2E6S A;  1HYJ A;  3U5O A;  4GNF A;  2MA5 A;  2KU3 A;  4V3K C;  2OXQ C;  5KH9 A;  2VP7 A;  3HCS A;  2MD7 B;  2L0B A;  1Z6U A;  2YW8 A;  2D8S A;  4AYC B;  2YT5 A;  3ASL A;  3IHP A;  4UP0 A;  1CHC A;  3EB5 A;  2YHN A;  2FSA A;  3N9P A;  2FUI A;  4I7D A;  1VYX A;  4A0C D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...