5B8DA

Crystal structure of a low occupancy fragment candidate (n-(4-methyl-1,3-thiazol-2-yl)propanamide) bound adjacent to the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
99
structure length
99
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
molecule keywords Histone deacetylase 6
molecule tags Hydrolase
source organism Homo sapiens
total genus 32
structure length 99
sequence length 99
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5b8dA00
1WEPA 1JOCA 2BAYA 2YURA 5G0FA 3N9PA 3N9QA 1RMDA 2KREA 3KV5A 4YATA 2YHNA 4WZ0A 4IC2A 2VPGA 1V87A 3HCSA 4GNFA 1DVPA 1VFYA 3ASLA 3MHSA 4GNEA 4FJCA 3RTRB 1LDJB 3C6WA 2CKLB 2VJEB 2LN0A 3L11A 4QF3A 2RSDA 3O70A 1JM7A 4N4FA 4LADB 1WGMA 3I2DA 2EA6A 4FIPA 2G43A 2XB1A 2XEUA 2M3HA 5B76A 3LQIA 2L5UA 2YQLA 2KGGA 3O7AA 2C2VS 2M1RA 2YHOA 3SOXA 5B77A 3DQVR 2YSMA 2VPEA 2C2LA 4GB0A 2NAAA 3RPGC 3PHDA 2KWNA 4LLBA 5H1TA 2DX8A 2ECJA 2VJFA 5LKXA 2MD8C 2KWKA 4P5OB 5J3XA 5H1UA 2FUUA 4YC9A 4AVXA 4XI1A 3LRQA 3T6RA 1Z2QA 4L7XA 1T1HA 4AP4A 2KU3A 2IDAA 3HCUA 4X3GA 4LJNA 3KNVA 4A49A 2OXQC 2MA6A 1WEOA 2PUYA 1MM2A 4O64A 3GV4A 1WEUA 2LGKA 2K1JA 3SOWA 4S3OB 4V3LC 5AIUA 2MIQA 2JRJA 2MT5A 1CHCA 5B78A 4CCGX 3ZPV1 3N9MA 1WEWA 2ZETC 4N3WA 2MD7B 4GNDA 4UP5A 1U6GB 4A4BA 2EGPA 5KH7A 4W4UA 4FK5A 2LGGA 5FEYA 4R2YA 2G45A 2VJEA 5TBNA 5LCWB 4YADA 3QZVA 1VD4A 2CSYA 2FUIA 2YREA 2Y1MA 1HYJA 1WIMA 2FSAA 3ZPVE 5H1VA 1E4UA 3ZYQA 4FO9A 2MNYA 2L75A 3U5PA 5G05B 2MA5A 2RI7A 2M6MA 2H0DB 3DPLR 3HTKC 2KWOA 3ZVZB 3LQHA 1WENA 5TDRA 1LDKC 3T7LA 2CSZA 2L80A 2E6SA 2HDPA 3O34A 2F6NA 4GNGA 4I7DA 4Q6FA 2K4DA 3M99A 4AYCB 4F52B 3U5MA 1WEQA 2F6JA 4I7CA 3ZTGA 5DKAA 4ZQLA 3O37A 2QIZA 5TABA 5LKZA 3O35A 2VP7A 2MUMA 3SOUA 4PPEA 1ZBDB 2CT2A 2D8SA 4BHWA 2ECWA 4UI9B 2K16A 1WEVA 2ECTA 2L0BA 3ZVYA 4WZ3B 1F62A 1WEMA 2VPDA 2Y1NA 2HYED 2LGVA 5LKUA 4B86C 4LKAA 2UZGA 4IC3A 3FL2A 2YUCA 4C9ZA 3N9OA 3N9NA 3EB5A 5B75A 1FBVA 4LK9A 2QICA 4PTBA 2LXHC 4MSXA 5FB0A 4YAXA 2M85A 1WFKA 5AITA 5KH9A 2AN6A 2JMJA 3L1ZB 5D1KB 2PNXA 1X4UA 2H0DA 5C11A 2CKLA 5G04B 1HYIA 1Z60A 2KYUA 3N9LA 4YBTA 2LDRA 4YBMA 4TKPB 4WZ2A 5EYAF 2MNZA 5I3LA 5TDWA 1N87A 1VYXA 2YYRA 4B7YC 3U5NA 2KE1A 1XWHA 1Z6UA 3SHBA 1X4IA 4AYCA 5LKTA 2G6QA 5B8DA 2ECGA 3O33A 5B79A 2YW8A 2YQMA 3U5OA 5DINA 5JG6A 4BBQA 4CA1A 3EB6A 4A4CA 2ECIA 3PURA 3KV6A 5FERA 3KQIA 3M63A 1X4JA 3RPGB 2ECVA 3GL6A 1MM3A 2YU4A 4WA6A 3IHPA 5D1LB 2KR4A 2VNFA 4ZDTA 4MVTA 3O36A 5TRBA 4QF2A 3LQJA 2YT5A 2LXPC 4L58A 2I50A 3ZNIA 3NG2A 5KH3A 1WILA 1BORA 3L1XA 3VK6A 3V43A 2LV9A 1WEEA 1JM7B 4A0CD 3HCTA 1WE9A 2VPBA 4R7EA 2ECNA 5FB1A 5C13A 2F42A 4YBSA 4NN2A 4ZUXU 1G25A 3C5KA 2JMIA 2QJ0A 4I7BA 2YSJA 4YABA 2KIZA 2EODA 2E6RA 4UP0A 2L43A 3PUQA 2LRIC 2Y43A 4AUQB 2KFTA 4R8PK 1WESA 2KGIA 4V3KC 3MHHA 1FP0A 5H9MA 2VJFB 2K17A 2LGLA 2LQ6A 1K2FA 5D1MB 2KWJA 1IYMA 3M62A 2JMDA 4S3OC
chains in the Genus database with same CATH superfamily
1WEPA 1JOCA 2BAYA 2YURA 5G0FA 2EXUA 3N9PA 3N9QA 1RMDA 2M13A 2KREA 3KV5A 4YATA 3DWDA 2YHNA 4WZ0A 4IC2A 2VPGA 1V87A 3HCSA 4GNFA 1DVPA 1VFYA 3ASLA 3FJUB 3MHSA 2JUNA 4GNEA 4H9DA 2CRRA 4FJCA 3RTRB 1LDJB 3C6WA 2CKLB 3E2DA 2IQJA 2VJEB 2LN0A 3L11A 4QF3A 2RSDA 2KKXA 3O70A 1JM7A 4N4FA 4LADB 1DCQA 1WGMA 3I2DA 2DJAA 2EA6A 4FIPA 2G43A 2XB1A 2XEUA 2M3HA 5B76A 3LQIA 2L5UA 2YQLA 3FM8C 2KGGA 3O7AA 5K3QA 2C2VS 2M1RA 2YHOA 3SOXA 5B77A 3DQVR 2YSMA 4Z0RA 2VPEA 2C2LA 3FAOA 4GB0A 2NAAA 3RPGC 3PHDA 2KWNA 4LLBA 5H1TA 2DX8A 2ECJA 2VJFA 5LKXA 2MD8C 2KWKA 4P5OB 5J3XA 5H1UA 2FUUA 4YC9A 4AVXA 4XI1A 3LRQA 3T6RA 1Z2QA 4L7XA 3PLWA 1T1HA 4AP4A 2YVRA 2KU3A 2IDAA 3HCUA 4X3GA 4LJNA 3KNVA 4A49A 2OXQC 2MA6A 1WEOA 2PUYA 1MM2A 4O64A 3GV4A 1WEUA 2LGKA 2K1JA 3SOWA 4S3OB 4V3LC 5AIUA 2MIQA 2JRJA 2MT5A 2KKYA 1CHCA 5B78A 4CCGX 3ZPV1 2OWAA 1WEWA 2ZETC 3N9MA 3M7KA 4OGEA 4N3WA 2MD7B 4GNDA 4UP5A 1U6GB 4A4BA 3LVQE 2EGPA 5KH7A 4W4UA 4FK5A 2LGGA 5FEYA 4R2YA 2G45A 2VJEA 3LJUX 5TBNA 3SUBA 5LCWB 4YADA 3QZVA 1VD4A 2CSYA 2FUIA 2XOCA 2YREA 2Y1MA 1HYJA 1WIMA 2FSAA 3ZPVE 5H1VA 1E4UA 3ZYQA 2P57A 4FO9A 2MNYA 2L75A 2CONA 5G05B 3U5PA 1MBMA 2MA5A 2RI7A 2M6MA 2H0DB 3DPLR 3HTKC 2KWOA 3ZVZB 3LQHA 3MDBC 5SVIA 1WENA 5TDRA 2DSMA 3LDYA 1LDKC 3T7LA 2CSZA 2L80A 2E6SA 2HDPA 2LAUA 3O34A 2F6NA 4GNGA 4I7DA 4Q6FA 2K4DA 3M99A 4AYCB 2CRWA 3FEHA 4F52B 3U5MA 1WEQA 2F6JA 4I7CA 3ZTGA 3DDTA 5DKAA 4ZQLA 3O37A 2QIZA 5TABA 5LKZA 4F1PA 2XOYA 3O35A 2VP7A 2MUMA 3SOUA 4PPEA 1ZBDB 2CT2A 2D8SA 4BHWA 2ECWA 4UI9B 2K16A 1WEVA 2ECTA 2L0BA 3ZVYA 4WZ3B 1F62A 1WEMA 2VPDA 2Y1NA 2HYED 2LGVA 5LKUA 3JUEA 4B86C 4LKAA 2UZGA 4IC3A 3FL2A 2YUCA 4C9ZA 3N9OA 3N9NA 4OGCA 3EB5A 5B75A 1FBVA 4LK9A 2QICA 4PTBA 2LXHC 2MKEA 4MSXA 5FB0A 4YAXA 2M85A 1WFKA 3T9KA 5SVYA 5AITA 3FANA 5KH9A 2AN6A 2JMJA 3L1ZB 5D1KB 2PNXA 1X4UA 2H0DA 5C11A 2CKLA 5G04B 1HYIA 1Z60A 2KYUA 3N9LA 4YBTA 2LDRA 4YBMA 4TKPB 4WZ2A 5EYAF 2MNZA 5I3LA 5TDWA 1N87A 1VYXA 2YYRA 4B7YC 3U5NA 2KE1A 1XWHA 1Z6UA 2XP0A 3SHBA 2D8UA 1X4IA 4AYCA 5LKTA 2G6QA 5B8DA 2ECGA 3O33A 5B79A 2YW8A 2YQMA 2RR4A 3O47A 3U5OA 5DINA 5JG6A 2B0OE 3LVRE 4BBQA 4CA1A 3EB6A 4A4CA 2ECIA 3PURA 3KV6A 3KDEC 4Z0OA 2JM3A 5FERA 3KQIA 3M63A 1X4JA 3RPGB 2ECVA 3H7HA 2E61A 3GL6A 1MM3A 2YU4A 4WA6A 3IHPA 5D1LB 2KR4A 2VNFA 4ZDTA 4MVTA 3O36A 5TRBA 4QF2A 3LQJA 2YT5A 2LXPC 4L58A 2I50A 3ZNIA 3NG2A 5KH3A 1WILA 1BORA 2EGMA 3L1XA 3VK6A 3V43A 2L7PA 2LV9A 1WEEA 5SVIB 1JM7B 4A0CD 3HCTA 1WE9A 2VPBA 4QQ4A 4R7EA 2ECNA 5FB1A 5C13A 2F42A 4O62A 4YBSA 4NN2A 4ZUXU 1G25A 3C5KA 2JMIA 2QJ0A 4I7BA 2YSJA 4YABA 2FD4A 2KIZA 2CSVA 2EODA 2E6RA 4UP0A 2L43A 3PUQA 2LRIC 2Y43A 4AUQB 2KFTA 2FFWA 2XOZA 4R8PK 3Q1DA 1WESA 2KGIA 4V3KC 3MHHA 1FP0A 5H9MA 2VJFB 2K17A 5SVXA 2LGLA 2LQ6A 1K2FA 5D1MB 2KWJA 1IYMA 3M62A 2JMDA 4S3OC
chains in the Genus database with same CATH topology
1WEPA 1JOCA 2BAYA 2YURA 5G0FA 3N9PA 3N9QA 1RMDA 2KREA 3KV5A 4YATA 2YHNA 4WZ0A 4IC2A 2VPGA 1V87A 3HCSA 4GNFA 1DVPA 1VFYA 3ASLA 3MHSA 4GNEA 4FJCA 3RTRB 1LDJB 3C6WA 2CKLB 2VJEB 2LN0A 3L11A 4QF3A 2RSDA 3O70A 1JM7A 4N4FA 4LADB 1WGMA 3I2DA 2EA6A 4FIPA 2G43A 2XB1A 2XEUA 2M3HA 5B76A 3LQIA 2L5UA 2YQLA 2KGGA 3O7AA 2C2VS 2M1RA 2YHOA 3SOXA 5B77A 3DQVR 2YSMA 2VPEA 2C2LA 4GB0A 2NAAA 3RPGC 3PHDA 2KWNA 4LLBA 5H1TA 2DX8A 2ECJA 2VJFA 5LKXA 2MD8C 2KWKA 4P5OB 5J3XA 5H1UA 2FUUA 4YC9A 4AVXA 4XI1A 3LRQA 3T6RA 1Z2QA 4L7XA 1T1HA 4AP4A 2KU3A 2IDAA 3HCUA 4X3GA 4LJNA 3KNVA 4A49A 2OXQC 2MA6A 1WEOA 2PUYA 1MM2A 4O64A 3GV4A 1WEUA 2LGKA 2K1JA 3SOWA 4S3OB 4V3LC 5AIUA 2MIQA 2JRJA 2MT5A 1CHCA 5B78A 4CCGX 3ZPV1 3N9MA 1WEWA 2ZETC 4N3WA 2MD7B 4GNDA 4UP5A 1U6GB 4A4BA 2EGPA 5KH7A 4W4UA 4FK5A 2LGGA 5FEYA 4R2YA 2G45A 2VJEA 5TBNA 5LCWB 4YADA 3QZVA 1VD4A 2CSYA 2FUIA 2YREA 2Y1MA 1HYJA 1WIMA 2FSAA 3ZPVE 5H1VA 1E4UA 3ZYQA 4FO9A 2MNYA 2L75A 3U5PA 5G05B 2MA5A 2RI7A 2M6MA 2H0DB 3DPLR 3HTKC 2KWOA 3ZVZB 3LQHA 1WENA 5TDRA 1LDKC 3T7LA 2CSZA 2L80A 2E6SA 2HDPA 3O34A 2F6NA 4GNGA 4I7DA 4Q6FA 2K4DA 3M99A 4AYCB 4F52B 3U5MA 1WEQA 2F6JA 4I7CA 3ZTGA 5DKAA 4ZQLA 3O37A 2QIZA 5TABA 5LKZA 3O35A 2VP7A 2MUMA 3SOUA 4PPEA 1ZBDB 2CT2A 2D8SA 4BHWA 2ECWA 4UI9B 2K16A 1WEVA 2ECTA 2L0BA 3ZVYA 4WZ3B 1F62A 1WEMA 2VPDA 2Y1NA 2HYED 2LGVA 5LKUA 4B86C 4LKAA 2UZGA 4IC3A 3FL2A 2YUCA 4C9ZA 3N9OA 3N9NA 3EB5A 5B75A 1FBVA 4LK9A 2QICA 4PTBA 2LXHC 4MSXA 5FB0A 4YAXA 2M85A 1WFKA 5AITA 5KH9A 2AN6A 2JMJA 3L1ZB 5D1KB 2PNXA 1X4UA 2H0DA 5C11A 2CKLA 5G04B 1HYIA 1Z60A 2KYUA 3N9LA 4YBTA 2LDRA 4YBMA 4TKPB 4WZ2A 5EYAF 2MNZA 5I3LA 5TDWA 1N87A 1VYXA 2YYRA 4B7YC 3U5NA 2KE1A 1XWHA 1Z6UA 3SHBA 1X4IA 4AYCA 5LKTA 2G6QA 5B8DA 2ECGA 3O33A 5B79A 2YW8A 2YQMA 3U5OA 5DINA 5JG6A 4BBQA 4CA1A 3EB6A 4A4CA 2ECIA 3PURA 3KV6A 5FERA 3KQIA 3M63A 1X4JA 3RPGB 2ECVA 3GL6A 1MM3A 2YU4A 4WA6A 3IHPA 5D1LB 2KR4A 2VNFA 4ZDTA 4MVTA 3O36A 5TRBA 4QF2A 3LQJA 2YT5A 2LXPC 4L58A 2I50A 3ZNIA 3NG2A 5KH3A 1WILA 1BORA 3L1XA 3VK6A 3V43A 2LV9A 1WEEA 1JM7B 4A0CD 3HCTA 1WE9A 2VPBA 4R7EA 2ECNA 5FB1A 5C13A 2F42A 4YBSA 4NN2A 4ZUXU 1G25A 3C5KA 2JMIA 2QJ0A 4I7BA 2YSJA 4YABA 2KIZA 2EODA 2E6RA 4UP0A 2L43A 3PUQA 2LRIC 2Y43A 4AUQB 2KFTA 4R8PK 1WESA 2KGIA 4V3KC 3MHHA 1FP0A 5H9MA 2VJFB 2K17A 2LGLA 2LQ6A 1K2FA 5D1MB 2KWJA 1IYMA 3M62A 2JMDA 4S3OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WEP A;  1JOC A;  2BAY A;  2YUR A;  5G0F A;  3N9P A;  3N9Q A;  1RMD A;  2KRE A;  3KV5 A;  4YAT A;  2YHN A;  4WZ0 A;  4IC2 A;  2VPG A;  1V87 A;  3HCS A;  4GNF A;  1DVP A;  1VFY A;  3ASL A;  3MHS A;  4GNE A;  4FJC A;  3RTR B;  1LDJ B;  3C6W A;  2CKL B;  2VJE B;  2LN0 A;  3L11 A;  4QF3 A;  2RSD A;  3O70 A;  1JM7 A;  4N4F A;  4LAD B;  1WGM A;  3I2D A;  2EA6 A;  4FIP A;  2G43 A;  2XB1 A;  2XEU A;  2M3H A;  5B76 A;  3LQI A;  2L5U A;  2YQL A;  2KGG A;  3O7A A;  2C2V S;  2M1R A;  2YHO A;  3SOX A;  5B77 A;  3DQV R;  2YSM A;  2VPE A;  2C2L A;  4GB0 A;  2NAA A;  3RPG C;  3PHD A;  2KWN A;  4LLB A;  5H1T A;  2DX8 A;  2ECJ A;  2VJF A;  5LKX A;  2MD8 C;  2KWK A;  4P5O B;  5J3X A;  5H1U A;  2FUU A;  4YC9 A;  4AVX A;  4XI1 A;  3LRQ A;  3T6R A;  1Z2Q A;  4L7X A;  1T1H A;  4AP4 A;  2KU3 A;  2IDA A;  3HCU A;  4X3G A;  4LJN A;  3KNV A;  4A49 A;  2OXQ C;  2MA6 A;  1WEO A;  2PUY A;  1MM2 A;  4O64 A;  3GV4 A;  1WEU A;  2LGK A;  2K1J A;  3SOW A;  4S3O B;  4V3L C;  5AIU A;  2MIQ A;  2JRJ A;  2MT5 A;  1CHC A;  5B78 A;  4CCG X;  3ZPV 1;  3N9M A;  1WEW A;  2ZET C;  4N3W A;  2MD7 B;  4GND A;  4UP5 A;  1U6G B;  4A4B A;  2EGP A;  5KH7 A;  4W4U A;  4FK5 A;  2LGG A;  5FEY A;  4R2Y A;  2G45 A;  2VJE A;  5TBN A;  5LCW B;  4YAD A;  3QZV A;  1VD4 A;  2CSY A;  2FUI A;  2YRE A;  2Y1M A;  1HYJ A;  1WIM A;  2FSA A;  3ZPV E;  5H1V A;  1E4U A;  3ZYQ A;  4FO9 A;  2MNY A;  2L75 A;  3U5P A;  5G05 B;  2MA5 A;  2RI7 A;  2M6M A;  2H0D B;  3DPL R;  3HTK C;  2KWO A;  3ZVZ B;  3LQH A;  1WEN A;  5TDR A;  1LDK C;  3T7L A;  2CSZ A;  2L80 A;  2E6S A;  2HDP A;  3O34 A;  2F6N A;  4GNG A;  4I7D A;  4Q6F A;  2K4D A;  3M99 A;  4AYC B;  4F52 B;  3U5M A;  1WEQ A;  2F6J A;  4I7C A;  3ZTG A;  5DKA A;  4ZQL A;  3O37 A;  2QIZ A;  5TAB A;  5LKZ A;  3O35 A;  2VP7 A;  2MUM A;  3SOU A;  4PPE A;  1ZBD B;  2CT2 A;  2D8S A;  4BHW A;  2ECW A;  4UI9 B;  2K16 A;  1WEV A;  2ECT A;  2L0B A;  3ZVY A;  4WZ3 B;  1F62 A;  1WEM A;  2VPD A;  2Y1N A;  2HYE D;  2LGV A;  5LKU A;  4B86 C;  4LKA A;  2UZG A;  4IC3 A;  3FL2 A;  2YUC A;  4C9Z A;  3N9O A;  3N9N A;  3EB5 A;  5B75 A;  1FBV A;  4LK9 A;  2QIC A;  4PTB A;  2LXH C;  4MSX A;  5FB0 A;  4YAX A;  2M85 A;  1WFK A;  5AIT A;  5KH9 A;  2AN6 A;  2JMJ A;  3L1Z B;  5D1K B;  2PNX A;  1X4U A;  2H0D A;  5C11 A;  2CKL A;  5G04 B;  1HYI A;  1Z60 A;  2KYU A;  3N9L A;  4YBT A;  2LDR A;  4YBM A;  4TKP B;  4WZ2 A;  5EYA F;  2MNZ A;  5I3L A;  5TDW A;  1N87 A;  1VYX A;  2YYR A;  4B7Y C;  3U5N A;  2KE1 A;  1XWH A;  1Z6U A;  3SHB A;  1X4I A;  4AYC A;  5LKT A;  2G6Q A;  5B8D A;  2ECG A;  3O33 A;  5B79 A;  2YW8 A;  2YQM A;  3U5O A;  5DIN A;  5JG6 A;  4BBQ A;  4CA1 A;  3EB6 A;  4A4C A;  2ECI A;  3PUR A;  3KV6 A;  5FER A;  3KQI A;  3M63 A;  1X4J A;  3RPG B;  2ECV A;  3GL6 A;  1MM3 A;  2YU4 A;  4WA6 A;  3IHP A;  5D1L B;  2KR4 A;  2VNF A;  4ZDT A;  4MVT A;  3O36 A;  5TRB A;  4QF2 A;  3LQJ A;  2YT5 A;  2LXP C;  4L58 A;  2I50 A;  3ZNI A;  3NG2 A;  5KH3 A;  1WIL A;  1BOR A;  3L1X A;  3VK6 A;  3V43 A;  2LV9 A;  1WEE A;  1JM7 B;  4A0C D;  3HCT A;  1WE9 A;  2VPB A;  4R7E A;  2ECN A;  5FB1 A;  5C13 A;  2F42 A;  4YBS A;  4NN2 A;  4ZUX U;  1G25 A;  3C5K A;  2JMI A;  2QJ0 A;  4I7B A;  2YSJ A;  4YAB A;  2KIZ A;  2EOD A;  2E6R A;  4UP0 A;  2L43 A;  3PUQ A;  2LRI C;  2Y43 A;  4AUQ B;  2KFT A;  4R8P K;  1WES A;  2KGI A;  4V3K C;  3MHH A;  1FP0 A;  5H9M A;  2VJF B;  2K17 A;  2LGL A;  2LQ6 A;  1K2F A;  5D1M B;  2KWJ A;  1IYM A;  3M62 A;  2JMD A;  4S3O C; 
#chains in the Genus database with same CATH topology
 1WEP A;  1JOC A;  2BAY A;  2YUR A;  5G0F A;  2EXU A;  3N9P A;  3N9Q A;  1RMD A;  2M13 A;  2KRE A;  3KV5 A;  4YAT A;  3DWD A;  2YHN A;  4WZ0 A;  4IC2 A;  2VPG A;  1V87 A;  3HCS A;  4GNF A;  1DVP A;  1VFY A;  3ASL A;  3FJU B;  3MHS A;  2JUN A;  4GNE A;  4H9D A;  2CRR A;  4FJC A;  3RTR B;  1LDJ B;  3C6W A;  2CKL B;  3E2D A;  2IQJ A;  2VJE B;  2LN0 A;  3L11 A;  4QF3 A;  2RSD A;  2KKX A;  3O70 A;  1JM7 A;  4N4F A;  4LAD B;  1DCQ A;  1WGM A;  3I2D A;  2DJA A;  2EA6 A;  4FIP A;  2G43 A;  2XB1 A;  2XEU A;  2M3H A;  5B76 A;  3LQI A;  2L5U A;  2YQL A;  3FM8 C;  2KGG A;  3O7A A;  5K3Q A;  2C2V S;  2M1R A;  2YHO A;  3SOX A;  5B77 A;  3DQV R;  2YSM A;  4Z0R A;  2VPE A;  2C2L A;  3FAO A;  4GB0 A;  2NAA A;  3RPG C;  3PHD A;  2KWN A;  4LLB A;  5H1T A;  2DX8 A;  2ECJ A;  2VJF A;  5LKX A;  2MD8 C;  2KWK A;  4P5O B;  5J3X A;  5H1U A;  2FUU A;  4YC9 A;  4AVX A;  4XI1 A;  3LRQ A;  3T6R A;  1Z2Q A;  4L7X A;  3PLW A;  1T1H A;  4AP4 A;  2YVR A;  2KU3 A;  2IDA A;  3HCU A;  4X3G A;  4LJN A;  3KNV A;  4A49 A;  2OXQ C;  2MA6 A;  1WEO A;  2PUY A;  1MM2 A;  4O64 A;  3GV4 A;  1WEU A;  2LGK A;  2K1J A;  3SOW A;  4S3O B;  4V3L C;  5AIU A;  2MIQ A;  2JRJ A;  2MT5 A;  2KKY A;  1CHC A;  5B78 A;  4CCG X;  3ZPV 1;  2OWA A;  1WEW A;  2ZET C;  3N9M A;  3M7K A;  4OGE A;  4N3W A;  2MD7 B;  4GND A;  4UP5 A;  1U6G B;  4A4B A;  3LVQ E;  2EGP A;  5KH7 A;  4W4U A;  4FK5 A;  2LGG A;  5FEY A;  4R2Y A;  2G45 A;  2VJE A;  3LJU X;  5TBN A;  3SUB A;  5LCW B;  4YAD A;  3QZV A;  1VD4 A;  2CSY A;  2FUI A;  2XOC A;  2YRE A;  2Y1M A;  1HYJ A;  1WIM A;  2FSA A;  3ZPV E;  5H1V A;  1E4U A;  3ZYQ A;  2P57 A;  4FO9 A;  2MNY A;  2L75 A;  2CON A;  5G05 B;  3U5P A;  1MBM A;  2MA5 A;  2RI7 A;  2M6M A;  2H0D B;  3DPL R;  3HTK C;  2KWO A;  3ZVZ B;  3LQH A;  3MDB C;  5SVI A;  1WEN A;  5TDR A;  2DSM A;  3LDY A;  1LDK C;  3T7L A;  2CSZ A;  2L80 A;  2E6S A;  2HDP A;  2LAU A;  3O34 A;  2F6N A;  4GNG A;  4I7D A;  4Q6F A;  2K4D A;  3M99 A;  4AYC B;  2CRW A;  3FEH A;  4F52 B;  3U5M A;  1WEQ A;  2F6J A;  4I7C A;  3ZTG A;  3DDT A;  5DKA A;  4ZQL A;  3O37 A;  2QIZ A;  5TAB A;  5LKZ A;  4F1P A;  2XOY A;  3O35 A;  2VP7 A;  2MUM A;  3SOU A;  4PPE A;  1ZBD B;  2CT2 A;  2D8S A;  4BHW A;  2ECW A;  4UI9 B;  2K16 A;  1WEV A;  2ECT A;  2L0B A;  3ZVY A;  4WZ3 B;  1F62 A;  1WEM A;  2VPD A;  2Y1N A;  2HYE D;  2LGV A;  5LKU A;  3JUE A;  4B86 C;  4LKA A;  2UZG A;  4IC3 A;  3FL2 A;  2YUC A;  4C9Z A;  3N9O A;  3N9N A;  4OGC A;  3EB5 A;  5B75 A;  1FBV A;  4LK9 A;  2QIC A;  4PTB A;  2LXH C;  2MKE A;  4MSX A;  5FB0 A;  4YAX A;  2M85 A;  1WFK A;  3T9K A;  5SVY A;  5AIT A;  3FAN A;  5KH9 A;  2AN6 A;  2JMJ A;  3L1Z B;  5D1K B;  2PNX A;  1X4U A;  2H0D A;  5C11 A;  2CKL A;  5G04 B;  1HYI A;  1Z60 A;  2KYU A;  3N9L A;  4YBT A;  2LDR A;  4YBM A;  4TKP B;  4WZ2 A;  5EYA F;  2MNZ A;  5I3L A;  5TDW A;  1N87 A;  1VYX A;  2YYR A;  4B7Y C;  3U5N A;  2KE1 A;  1XWH A;  1Z6U A;  2XP0 A;  3SHB A;  2D8U A;  1X4I A;  4AYC A;  5LKT A;  2G6Q A;  5B8D A;  2ECG A;  3O33 A;  5B79 A;  2YW8 A;  2YQM A;  2RR4 A;  3O47 A;  3U5O A;  5DIN A;  5JG6 A;  2B0O E;  3LVR E;  4BBQ A;  4CA1 A;  3EB6 A;  4A4C A;  2ECI A;  3PUR A;  3KV6 A;  3KDE C;  4Z0O A;  2JM3 A;  5FER A;  3KQI A;  3M63 A;  1X4J A;  3RPG B;  2ECV A;  3H7H A;  2E61 A;  3GL6 A;  1MM3 A;  2YU4 A;  4WA6 A;  3IHP A;  5D1L B;  2KR4 A;  2VNF A;  4ZDT A;  4MVT A;  3O36 A;  5TRB A;  4QF2 A;  3LQJ A;  2YT5 A;  2LXP C;  4L58 A;  2I50 A;  3ZNI A;  3NG2 A;  5KH3 A;  1WIL A;  1BOR A;  2EGM A;  3L1X A;  3VK6 A;  3V43 A;  2L7P A;  2LV9 A;  1WEE A;  5SVI B;  1JM7 B;  4A0C D;  3HCT A;  1WE9 A;  2VPB A;  4QQ4 A;  4R7E A;  2ECN A;  5FB1 A;  5C13 A;  2F42 A;  4O62 A;  4YBS A;  4NN2 A;  4ZUX U;  1G25 A;  3C5K A;  2JMI A;  2QJ0 A;  4I7B A;  2YSJ A;  4YAB A;  2FD4 A;  2KIZ A;  2CSV A;  2EOD A;  2E6R A;  4UP0 A;  2L43 A;  3PUQ A;  2LRI C;  2Y43 A;  4AUQ B;  2KFT A;  2FFW A;  2XOZ A;  4R8P K;  3Q1D A;  1WES A;  2KGI A;  4V3K C;  3MHH A;  1FP0 A;  5H9M A;  2VJF B;  2K17 A;  5SVX A;  2LGL A;  2LQ6 A;  1K2F A;  5D1M B;  2KWJ A;  1IYM A;  3M62 A;  2JMD A;  4S3O C; 
#chains in the Genus database with same CATH homology
 1WEP A;  1JOC A;  2BAY A;  2YUR A;  5G0F A;  3N9P A;  3N9Q A;  1RMD A;  2KRE A;  3KV5 A;  4YAT A;  2YHN A;  4WZ0 A;  4IC2 A;  2VPG A;  1V87 A;  3HCS A;  4GNF A;  1DVP A;  1VFY A;  3ASL A;  3MHS A;  4GNE A;  4FJC A;  3RTR B;  1LDJ B;  3C6W A;  2CKL B;  2VJE B;  2LN0 A;  3L11 A;  4QF3 A;  2RSD A;  3O70 A;  1JM7 A;  4N4F A;  4LAD B;  1WGM A;  3I2D A;  2EA6 A;  4FIP A;  2G43 A;  2XB1 A;  2XEU A;  2M3H A;  5B76 A;  3LQI A;  2L5U A;  2YQL A;  2KGG A;  3O7A A;  2C2V S;  2M1R A;  2YHO A;  3SOX A;  5B77 A;  3DQV R;  2YSM A;  2VPE A;  2C2L A;  4GB0 A;  2NAA A;  3RPG C;  3PHD A;  2KWN A;  4LLB A;  5H1T A;  2DX8 A;  2ECJ A;  2VJF A;  5LKX A;  2MD8 C;  2KWK A;  4P5O B;  5J3X A;  5H1U A;  2FUU A;  4YC9 A;  4AVX A;  4XI1 A;  3LRQ A;  3T6R A;  1Z2Q A;  4L7X A;  1T1H A;  4AP4 A;  2KU3 A;  2IDA A;  3HCU A;  4X3G A;  4LJN A;  3KNV A;  4A49 A;  2OXQ C;  2MA6 A;  1WEO A;  2PUY A;  1MM2 A;  4O64 A;  3GV4 A;  1WEU A;  2LGK A;  2K1J A;  3SOW A;  4S3O B;  4V3L C;  5AIU A;  2MIQ A;  2JRJ A;  2MT5 A;  1CHC A;  5B78 A;  4CCG X;  3ZPV 1;  3N9M A;  1WEW A;  2ZET C;  4N3W A;  2MD7 B;  4GND A;  4UP5 A;  1U6G B;  4A4B A;  2EGP A;  5KH7 A;  4W4U A;  4FK5 A;  2LGG A;  5FEY A;  4R2Y A;  2G45 A;  2VJE A;  5TBN A;  5LCW B;  4YAD A;  3QZV A;  1VD4 A;  2CSY A;  2FUI A;  2YRE A;  2Y1M A;  1HYJ A;  1WIM A;  2FSA A;  3ZPV E;  5H1V A;  1E4U A;  3ZYQ A;  4FO9 A;  2MNY A;  2L75 A;  3U5P A;  5G05 B;  2MA5 A;  2RI7 A;  2M6M A;  2H0D B;  3DPL R;  3HTK C;  2KWO A;  3ZVZ B;  3LQH A;  1WEN A;  5TDR A;  1LDK C;  3T7L A;  2CSZ A;  2L80 A;  2E6S A;  2HDP A;  3O34 A;  2F6N A;  4GNG A;  4I7D A;  4Q6F A;  2K4D A;  3M99 A;  4AYC B;  4F52 B;  3U5M A;  1WEQ A;  2F6J A;  4I7C A;  3ZTG A;  5DKA A;  4ZQL A;  3O37 A;  2QIZ A;  5TAB A;  5LKZ A;  3O35 A;  2VP7 A;  2MUM A;  3SOU A;  4PPE A;  1ZBD B;  2CT2 A;  2D8S A;  4BHW A;  2ECW A;  4UI9 B;  2K16 A;  1WEV A;  2ECT A;  2L0B A;  3ZVY A;  4WZ3 B;  1F62 A;  1WEM A;  2VPD A;  2Y1N A;  2HYE D;  2LGV A;  5LKU A;  4B86 C;  4LKA A;  2UZG A;  4IC3 A;  3FL2 A;  2YUC A;  4C9Z A;  3N9O A;  3N9N A;  3EB5 A;  5B75 A;  1FBV A;  4LK9 A;  2QIC A;  4PTB A;  2LXH C;  4MSX A;  5FB0 A;  4YAX A;  2M85 A;  1WFK A;  5AIT A;  5KH9 A;  2AN6 A;  2JMJ A;  3L1Z B;  5D1K B;  2PNX A;  1X4U A;  2H0D A;  5C11 A;  2CKL A;  5G04 B;  1HYI A;  1Z60 A;  2KYU A;  3N9L A;  4YBT A;  2LDR A;  4YBM A;  4TKP B;  4WZ2 A;  5EYA F;  2MNZ A;  5I3L A;  5TDW A;  1N87 A;  1VYX A;  2YYR A;  4B7Y C;  3U5N A;  2KE1 A;  1XWH A;  1Z6U A;  3SHB A;  1X4I A;  4AYC A;  5LKT A;  2G6Q A;  5B8D A;  2ECG A;  3O33 A;  5B79 A;  2YW8 A;  2YQM A;  3U5O A;  5DIN A;  5JG6 A;  4BBQ A;  4CA1 A;  3EB6 A;  4A4C A;  2ECI A;  3PUR A;  3KV6 A;  5FER A;  3KQI A;  3M63 A;  1X4J A;  3RPG B;  2ECV A;  3GL6 A;  1MM3 A;  2YU4 A;  4WA6 A;  3IHP A;  5D1L B;  2KR4 A;  2VNF A;  4ZDT A;  4MVT A;  3O36 A;  5TRB A;  4QF2 A;  3LQJ A;  2YT5 A;  2LXP C;  4L58 A;  2I50 A;  3ZNI A;  3NG2 A;  5KH3 A;  1WIL A;  1BOR A;  3L1X A;  3VK6 A;  3V43 A;  2LV9 A;  1WEE A;  1JM7 B;  4A0C D;  3HCT A;  1WE9 A;  2VPB A;  4R7E A;  2ECN A;  5FB1 A;  5C13 A;  2F42 A;  4YBS A;  4NN2 A;  4ZUX U;  1G25 A;  3C5K A;  2JMI A;  2QJ0 A;  4I7B A;  2YSJ A;  4YAB A;  2KIZ A;  2EOD A;  2E6R A;  4UP0 A;  2L43 A;  3PUQ A;  2LRI C;  2Y43 A;  4AUQ B;  2KFT A;  4R8P K;  1WES A;  2KGI A;  4V3K C;  3MHH A;  1FP0 A;  5H9M A;  2VJF B;  2K17 A;  2LGL A;  2LQ6 A;  1K2F A;  5D1M B;  2KWJ A;  1IYM A;  3M62 A;  2JMD A;  4S3O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...