5BO4A

Structure of socs2:elongin c:elongin b from dmso-treated crystals
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
168
structure length
153
Chain Sequence
MQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIIVKSKLKQFDSVVHLIDYYVQMCKHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serendipitous SAD Solution for DMSO-Soaked SOCS2-ElonginC-ElonginB Crystals Using Covalently Incorporated Dimethylarsenic: Insights into Substrate Receptor Conformational Flexibility in Cullin RING Ligases.
pubmed doi rcsb
molecule keywords Suppressor of cytokine signaling 2
molecule tags Signaling protein
source organism Homo sapiens
total genus 40
structure length 153
sequence length 168
chains with identical sequence D, G, J, M, P
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
A PF07525 SOCS_box SOCS box
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.750.20 Mainly Alpha Orthogonal Bundle Elongin C; Chain C, domain 1 Elongin C; Chain C, domain 1 5bo4A02
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 5bo4A01
2SHPA 5HKWA 1JYUA 3EAZA 4JGHA 1R1PA 1UUSA 4FL2A 1Y1UA 3QWYA 1O4IA 4D8KA 1AYDA 2HMHA 3CXLA 3VS1A 1BHHA 1AYCA 2AUGA 1OPKA 1LUNA 1OPLA 1TCEA 1LCJA 2BBUA 1LKLA 3PSJA 2K7AB 3IMJA 2DLYA 2EYZA 1B47A 5EHRA 3N7YA 4K45A 1A1CA 1A1AA 4XZ0A 1UURA 3N84A 1R1QA 2YU7A 3VGOA 4F5BA 3CD3A 3UF4A 3OVEA 2EKXA 1A1BA 2JYQA 2FO0A 1F2FA 1O4QA 2K79B 2MQIA 3VS2A 4DGPA 5KAZA 2LQNA 2L3TA 1SHDA 1O4RA 5I6VA 1AB2A 3US4A 1QCFA 1GHUA 3UYOA 3ZKJA 1O4BA 4E93A 1YVHA 1M61A 3EACA 1MILA 1OO3A 1O42A 1AYBA 3PLFB 2MRKA 2VIFA 2ABLA 1D1ZA 1O47A 2Y1NA 1AOUF 1BLKA 5J3XA 5EEQA 1AD5A 2DCRA 3K2MA 2IUGA 1O4NA 1OO4A 2DVJA 3HCKA 2MC1A 4K11A 1HCTB 2QMSA 4OHHA 2H8HA 1O4CA 1I3ZA 3MXYA 1SPRA 1RQQC 1ZFPE 4EIHA 1NZLA 4P9ZA 3OB1B 3CWGA 1PICA 2MRJA 2C0IA 1BLJA 1BFJA 3BKBA 1O4OA 2CI9A 1AYAA 2GE9A 2CIAA 1CWDL 1SHBA 2LNWA 3MAZA 3BUOB 2CRHA 4ROJA 2ETZA 1NRVA 2PLEA 1RPYA 1FHSA 3PFVA 2HDXA 4XZ1A 2OZOA 3VS4A 3ZNGA 2EYYA 3GXXA 3PQZA 3S8LA 4QSYA 1BFIA 1D4TA 1QADA 1FMKA 5GJHA 3GQIB 2L4KA 3IN7A 1M27A 2LNXA 1BHHB 2DM0A 3S8NA 1YVLA 2AOAA 1HCSB 1SHAA 1BKMA 1O4JA 2KK6A 4FL3A 5IBSA 2Y1MA 3OP0A 2PNBA 1JYQA 1FU6A 1CSZA 3VRRA 1O4GA 1MW4A 5DC4A 4X6SA 1KC2A 3ZNIA 1LUMA 3HIZB 4E68A 1X6CA 5AULA 2CBLA 1K9AA 5DC9A 1O44A 1QG1E 1LCKA 5EHPA 1BKLA 1JWOA 5AXIA 1SKJA 3HHMB 1O4LA 2H5KA 3VS0A 1P13A 2B3OA 2SRCA 2ECDA 1Y57A 2C9WA 4JEGA 2PTKA 4GL9E 1LUIA 1G83A 2HDVA 4DGXA 5GJIA 3CBLA 1O4AA 1O41A 4LUEA 2CS0A 5CDWA 4H34A 1O49A 1Z3KA 1BMBA 3BUWB 2LQWA 1D4WA 5D0JA 4OHLA 2EYVA 4TZIA 1LKKA 2MK2A 1TZEE 3VROA 5HKZA 4A4BA 4M4ZA 2H46E 3VRNA 1X27A 4U1PA 4OHIA 4K2RA 2OQ1A 1O4DA 3OB2B 3VS7A 1O4EA 4NWGA 2C0OA 1FU5A 1O43A 4OHEA 3C7IA 1O4FA 3PS5A 1JU5A 3VS3A 2EOBA 1O4KA 3BUXB 4F59A 2Y3AB 1O4MA 3GXWA 1A81A 2IUIA 1R1SA 3VS6A 3WA4A 1A08A 3IN8A 2AOBA 3N8MA 5BO4A 2RVFA 1CWEA 3NHNA 1GRIA 1IJRA 1FYRA 4LUDA 3T04A 3S8OA 1XA6A 1O4HA 1H9OA 4OHDA 1BF5A 2PNAA 2RMXA 2RORA 4JE4A 3PSKA 3VRYA 4FBNA 1A07A 5EG3B 2FCIA 1WQUA 3QWXX 1BHFA 5IBMA 4GWFA 4NWFA 2EU0A 1O46A 5HKYA 4U17A 1BM2A 4A4CA 1NZVA 1IS0A 3PJPA 2DLZA 3BUNB 1SPSA 1RJAA 1LUKA 3M7FA 1KSWA 3TKZA 2C0TA 4K44A 3IMDA 3OV1A 2CR4A 1F1WA 1FBVA 3VRPA 5EELA 3BUMB 1JYRA 1CSYA 2LCTA 3KFJA 5DF6A 1BG1A 1FBZA 1A1EA 1KA7A 3TL0A 2XP1A 4WWQA 2GSBA 1KA6A 2L6KA 2IUHA 2PLDA 3S9KA 3VRQA 2EO3A 2HUWA 4P9VA 2KNOA 3VS5A 4F5AA 5DC0B 1O48A 1AOTF 2EL8A 1O4PA 1X0NA 2HCKA 4GPLB 4L1BB 1O45A 2IZVA 3VRZA 4EY0A 4H1OA 2RSYA 2DX0A 2CI8A 2EO6A 1A09A 1CJ1A 3MXCA 2YSXA
chains in the Genus database with same CATH superfamily
2SHPA 5HKWA 1JYUA 3EAZA 4JGHA 1R1PA 1UUSA 4FL2A 1Y1UA 3QWYA 1O4IA 4D8KA 1AYDA 2HMHA 3CXLA 3VS1A 1BHHA 1AYCA 1VCBC 2AUGA 1OPKA 1LUNA 1OPLA 4AJYV 1TCEA 1LCJA 2BBUA 1LKLA 3PSJA 2K7AB 3IMJA 2DLYA 2EYZA 1B47A 5EHRA 3N7YA 4W9JC 4K45A 1A1CA 1A1AA 4XZ0A 1UURA 3N84A 1R1QA 2YU7A 3VGOA 4F5BA 3CD3A 3UF4A 3OVEA 4B9KC 2EKXA 1A1BA 2JYQA 2FO0A 1F2FA 1O4QA 2K79B 2MQIA 3VS2A 4DGPA 5KAZA 2LQNA 4W9EC 2L3TA 1SHDA 1O4RA 5I6VA 1AB2A 3US4A 1QCFA 1GHUA 4W9IC 3K2TA 3ZKJA 3UYOA 1O4BA 4E93A 1YVHA 1M61A 3EACA 1MILA 1OO3A 1O42A 1AYBA 3PLFB 2MRKA 3LYVA 2VIFA 2ABLA 1D1ZA 1O47A 2Y1NA 1AOUF 1BLKA 5J3XA 3ZUNC 5EEQA 1AD5A 2DCRA 3K2MA 2IUGA 1O4NA 1OO4A 2DVJA 3HCKA 2MC1A 4K11A 1HCTB 2QMSA 4OHHA 2H8HA 1O4CA 1I3ZA 3MXYA 1SPRA 1RQQC 1ZFPE 4EIHA 1NZLA 4P9ZA 3OB1B 3CWGA 1PICA 2MRJA 2C0IA 1BLJA 1BFJA 3BKBA 1O4OA 2CI9A 1AYAA 2GE9A 2CIAA 1CWDL 1SHBA 2LNWA 3MAZA 3BUOB 2CRHA 4ROJA 2ETZA 1NRVA 2PLEA 4B95C 1RPYA 1FHSA 4AWJC 3PFVA 2HDXA 4XZ1A 2OZOA 3VS4A 3ZNGA 1LQBC 2EYYA 3GXXA 3PQZA 3S8LA 4QSYA 1BFIA 1D4TA 1QADA 1FMKA 5GJHA 3GQIB 2L4KA 3IN7A 1M27A 2LNXA 1BHHB 2DM0A 3S8NA 1YVLA 2AOAA 1HCSB 4W9DC 1SHAA 1BKMA 1O4JA 2KK6A 4FL3A 5IBSA 2Y1MA 3OP0A 3ZRFC 2PNBA 1JYQA 1FU6A 4BKTC 1CSZA 3VRRA 1O4GA 1MW4A 5DC4A 4X6SA 1KC2A 3ZNIA 1LUMA 3HIZB 4E68A 1X6CA 5AULA 2CBLA 1K9AA 5DC9A 1O44A 4W9FC 1QG1E 1LCKA 5EHPA 1BKLA 4BKSC 1JWOA 5AXIA 1SKJA 3HHMB 1O4LA 2H5KA 3VS0A 1P13A 2ECDA 2SRCA 2B3OA 1Y57A 2C9WA 4JEGA 2PTKA 4GL9E 1LUIA 1G83A 2HDVA 4DGXA 5GJIA 3CBLA 2KGYA 1O4AA 4W9KC 1O41A 4LUEA 2CS0A 5CDWA 4H34A 1O49A 1Z3KA 1BMBA 3BUWB 2LQWA 1D4WA 5D0JA 4OHLA 2EYVA 4TZIA 1LKKA 2MK2A 1TZEE 3VROA 5HKZA 4A4BA 4M4ZA 2H46E 3VRNA 1X27A 4U1PA 4OHIA 4K2RA 2OQ1A 1O4DA 3OB2B 3VS7A 1O4EA 4NWGA 2C0OA 1FU5A 1O43A 4OHEA 3C7IA 1O4FA 3PS5A 1JU5A 3VS3A 2EOBA 1O4KA 3BUXB 4F59A 2Y3AB 3ZTCC 1O4MA 3GXWA 1A81A 2IUIA 1R1SA 4W9HC 3VS6A 3WA4A 1A08A 3IN8A 2AOBA 3N8MA 5BO4A 2RVFA 1CWEA 3NHNA 1GRIA 1IJRA 1FYRA 4LUDA 3T04A 3S8OA 3ZRCC 1XA6A 1O4HA 1H9OA 4OHDA 1BF5A 2PNAA 2RMXA 2RORA 4WQOA 4JE4A 3PSKA 3VRYA 4FBNA 1A07A 5EG3B 2FCIA 1WQUA 3QWXX 1LM8V 1BHFA 5IBMA 4GWFA 4NWFA 2EU0A 1O46A 5HKYA 4U17A 1BM2A 4A4CA 1NZVA 1IS0A 3PJPA 2DLZA 3BUNB 1SPSA 1RJAA 1LUKA 3M7FA 1KSWA 3TKZA 2C0TA 4K44A 3IMDA 3OV1A 2CR4A 1F1WA 1FBVA 3VRPA 5EELA 3BUMB 1JYRA 1CSYA 2LCTA 2LRAA 4W9LC 3KFJA 5DF6A 1BG1A 1FBZA 1A1EA 1KA7A 3ZTDC 3TL0A 2XP1A 4WWQA 5LLIC 2GSBA 1KA6A 2L6KA 2IUHA 2PLDA 3S9KA 3VRQA 2EO3A 2HUWA 4P9VA 2KNOA 3VS5A 4F5AA 5DC0B 1O48A 1AOTF 2EL8A 1O4PA 1X0NA 2HCKA 4GPLB 4L1BB 1O45A 2IZVA 3VRZA 4EY0A 4H1OA 2RSYA 4W9GC 2DX0A 4W9CC 2CI8A 2EO6A 1A09A 1CJ1A 3MXCA 2YSXA
chains in the Genus database with same CATH topology
2SHPA 5HKWA 1JYUA 3EAZA 4JGHA 1R1PA 1UUSA 4FL2A 1Y1UA 3QWYA 1O4IA 4D8KA 1AYDA 2HMHA 3CXLA 3VS1A 1BHHA 1AYCA 2AUGA 1OPKA 1LUNA 1OPLA 1TCEA 1LCJA 2BBUA 1LKLA 3PSJA 2K7AB 3IMJA 2DLYA 2EYZA 1B47A 5EHRA 3N7YA 4K45A 1A1CA 1A1AA 4XZ0A 1UURA 3N84A 1R1QA 2YU7A 3VGOA 4F5BA 3CD3A 3UF4A 3OVEA 2EKXA 1A1BA 2JYQA 2FO0A 1F2FA 1O4QA 2K79B 2MQIA 3VS2A 4DGPA 5KAZA 2LQNA 2L3TA 1SHDA 1O4RA 5I6VA 1AB2A 3US4A 1QCFA 1GHUA 3UYOA 3ZKJA 1O4BA 4E93A 1YVHA 1M61A 3EACA 1MILA 1OO3A 1O42A 1AYBA 3PLFB 2MRKA 2VIFA 2ABLA 1D1ZA 1O47A 2Y1NA 1AOUF 1BLKA 5J3XA 5EEQA 1AD5A 2DCRA 3K2MA 2IUGA 1O4NA 1OO4A 2DVJA 3HCKA 2MC1A 4K11A 1HCTB 2QMSA 4OHHA 2H8HA 1O4CA 1I3ZA 3MXYA 1SPRA 1RQQC 1ZFPE 4EIHA 1NZLA 4P9ZA 3OB1B 3CWGA 1PICA 2MRJA 2C0IA 1BLJA 1BFJA 3BKBA 1O4OA 2CI9A 1AYAA 2GE9A 2CIAA 1CWDL 1SHBA 2LNWA 3MAZA 3BUOB 2CRHA 4ROJA 2ETZA 1NRVA 2PLEA 1RPYA 1FHSA 3PFVA 2HDXA 4XZ1A 2OZOA 3VS4A 3ZNGA 2EYYA 3GXXA 3PQZA 3S8LA 4QSYA 1BFIA 1D4TA 1QADA 1FMKA 5GJHA 3GQIB 2L4KA 3IN7A 1M27A 2LNXA 1BHHB 2DM0A 3S8NA 1YVLA 2AOAA 1HCSB 1SHAA 1BKMA 1O4JA 2KK6A 4FL3A 5IBSA 2Y1MA 3OP0A 2PNBA 1JYQA 1FU6A 1CSZA 3VRRA 1O4GA 1MW4A 5DC4A 4X6SA 1KC2A 3ZNIA 1LUMA 3HIZB 4E68A 1X6CA 5AULA 2CBLA 1K9AA 5DC9A 1O44A 1QG1E 1LCKA 5EHPA 1BKLA 1JWOA 5AXIA 1SKJA 3HHMB 1O4LA 2H5KA 3VS0A 1P13A 2B3OA 2SRCA 2ECDA 1Y57A 2C9WA 4JEGA 2PTKA 4GL9E 1LUIA 1G83A 2HDVA 4DGXA 5GJIA 3CBLA 1O4AA 1O41A 4LUEA 2CS0A 5CDWA 4H34A 1O49A 1Z3KA 1BMBA 3BUWB 2LQWA 1D4WA 5D0JA 4OHLA 2EYVA 4TZIA 1LKKA 2MK2A 1TZEE 3VROA 5HKZA 4A4BA 4M4ZA 2H46E 3VRNA 1X27A 4U1PA 4OHIA 4K2RA 2OQ1A 1O4DA 3OB2B 3VS7A 1O4EA 4NWGA 2C0OA 1FU5A 1O43A 4OHEA 3C7IA 1O4FA 3PS5A 1JU5A 3VS3A 2EOBA 1O4KA 3BUXB 4F59A 2Y3AB 1O4MA 3GXWA 1A81A 2IUIA 1R1SA 3VS6A 3WA4A 1A08A 3IN8A 2AOBA 3N8MA 5BO4A 2RVFA 1CWEA 3NHNA 1GRIA 1IJRA 1FYRA 4LUDA 3T04A 3S8OA 1XA6A 1O4HA 1H9OA 4OHDA 1BF5A 2PNAA 2RMXA 2RORA 4JE4A 3PSKA 3VRYA 4FBNA 1A07A 5EG3B 2FCIA 1WQUA 3QWXX 1BHFA 5IBMA 4GWFA 4NWFA 2EU0A 1O46A 5HKYA 4U17A 1BM2A 4A4CA 1NZVA 1IS0A 3PJPA 2DLZA 3BUNB 1SPSA 1RJAA 1LUKA 3M7FA 1KSWA 3TKZA 2C0TA 4K44A 3IMDA 3OV1A 2CR4A 1F1WA 1FBVA 3VRPA 5EELA 3BUMB 1JYRA 1CSYA 2LCTA 3KFJA 5DF6A 1BG1A 1FBZA 1A1EA 1KA7A 3TL0A 2XP1A 4WWQA 2GSBA 1KA6A 2L6KA 2IUHA 2PLDA 3S9KA 3VRQA 2EO3A 2HUWA 4P9VA 2KNOA 3VS5A 4F5AA 5DC0B 1O48A 1AOTF 2EL8A 1O4PA 1X0NA 2HCKA 4GPLB 4L1BB 1O45A 2IZVA 3VRZA 4EY0A 4H1OA 2RSYA 2DX0A 2CI8A 2EO6A 1A09A 1CJ1A 3MXCA 2YSXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SHP A;  5HKW A;  1JYU A;  3EAZ A;  4JGH A;  1R1P A;  1UUS A;  4FL2 A;  1Y1U A;  3QWY A;  1O4I A;  4D8K A;  1AYD A;  2HMH A;  3CXL A;  3VS1 A;  1BHH A;  1AYC A;  2AUG A;  1OPK A;  1LUN A;  1OPL A;  1TCE A;  1LCJ A;  2BBU A;  1LKL A;  3PSJ A;  2K7A B;  3IMJ A;  2DLY A;  2EYZ A;  1B47 A;  5EHR A;  3N7Y A;  4K45 A;  1A1C A;  1A1A A;  4XZ0 A;  1UUR A;  3N84 A;  1R1Q A;  2YU7 A;  3VGO A;  4F5B A;  3CD3 A;  3UF4 A;  3OVE A;  2EKX A;  1A1B A;  2JYQ A;  2FO0 A;  1F2F A;  1O4Q A;  2K79 B;  2MQI A;  3VS2 A;  4DGP A;  5KAZ A;  2LQN A;  2L3T A;  1SHD A;  1O4R A;  5I6V A;  1AB2 A;  3US4 A;  1QCF A;  1GHU A;  3UYO A;  3ZKJ A;  1O4B A;  4E93 A;  1YVH A;  1M61 A;  3EAC A;  1MIL A;  1OO3 A;  1O42 A;  1AYB A;  3PLF B;  2MRK A;  2VIF A;  2ABL A;  1D1Z A;  1O47 A;  2Y1N A;  1AOU F;  1BLK A;  5J3X A;  5EEQ A;  1AD5 A;  2DCR A;  3K2M A;  2IUG A;  1O4N A;  1OO4 A;  2DVJ A;  3HCK A;  2MC1 A;  4K11 A;  1HCT B;  2QMS A;  4OHH A;  2H8H A;  1O4C A;  1I3Z A;  3MXY A;  1SPR A;  1RQQ C;  1ZFP E;  4EIH A;  1NZL A;  4P9Z A;  3OB1 B;  3CWG A;  1PIC A;  2MRJ A;  2C0I A;  1BLJ A;  1BFJ A;  3BKB A;  1O4O A;  2CI9 A;  1AYA A;  2GE9 A;  2CIA A;  1CWD L;  1SHB A;  2LNW A;  3MAZ A;  3BUO B;  2CRH A;  4ROJ A;  2ETZ A;  1NRV A;  2PLE A;  1RPY A;  1FHS A;  3PFV A;  2HDX A;  4XZ1 A;  2OZO A;  3VS4 A;  3ZNG A;  2EYY A;  3GXX A;  3PQZ A;  3S8L A;  4QSY A;  1BFI A;  1D4T A;  1QAD A;  1FMK A;  5GJH A;  3GQI B;  2L4K A;  3IN7 A;  1M27 A;  2LNX A;  1BHH B;  2DM0 A;  3S8N A;  1YVL A;  2AOA A;  1HCS B;  1SHA A;  1BKM A;  1O4J A;  2KK6 A;  4FL3 A;  5IBS A;  2Y1M A;  3OP0 A;  2PNB A;  1JYQ A;  1FU6 A;  1CSZ A;  3VRR A;  1O4G A;  1MW4 A;  5DC4 A;  4X6S A;  1KC2 A;  3ZNI A;  1LUM A;  3HIZ B;  4E68 A;  1X6C A;  5AUL A;  2CBL A;  1K9A A;  5DC9 A;  1O44 A;  1QG1 E;  1LCK A;  5EHP A;  1BKL A;  1JWO A;  5AXI A;  1SKJ A;  3HHM B;  1O4L A;  2H5K A;  3VS0 A;  1P13 A;  2B3O A;  2SRC A;  2ECD A;  1Y57 A;  2C9W A;  4JEG A;  2PTK A;  4GL9 E;  1LUI A;  1G83 A;  2HDV A;  4DGX A;  5GJI A;  3CBL A;  1O4A A;  1O41 A;  4LUE A;  2CS0 A;  5CDW A;  4H34 A;  1O49 A;  1Z3K A;  1BMB A;  3BUW B;  2LQW A;  1D4W A;  5D0J A;  4OHL A;  2EYV A;  4TZI A;  1LKK A;  2MK2 A;  1TZE E;  3VRO A;  5HKZ A;  4A4B A;  4M4Z A;  2H46 E;  3VRN A;  1X27 A;  4U1P A;  4OHI A;  4K2R A;  2OQ1 A;  1O4D A;  3OB2 B;  3VS7 A;  1O4E A;  4NWG A;  2C0O A;  1FU5 A;  1O43 A;  4OHE A;  3C7I A;  1O4F A;  3PS5 A;  1JU5 A;  3VS3 A;  2EOB A;  1O4K A;  3BUX B;  4F59 A;  2Y3A B;  1O4M A;  3GXW A;  1A81 A;  2IUI A;  1R1S A;  3VS6 A;  3WA4 A;  1A08 A;  3IN8 A;  2AOB A;  3N8M A;  5BO4 A;  2RVF A;  1CWE A;  3NHN A;  1GRI A;  1IJR A;  1FYR A;  4LUD A;  3T04 A;  3S8O A;  1XA6 A;  1O4H A;  1H9O A;  4OHD A;  1BF5 A;  2PNA A;  2RMX A;  2ROR A;  4JE4 A;  3PSK A;  3VRY A;  4FBN A;  1A07 A;  5EG3 B;  2FCI A;  1WQU A;  3QWX X;  1BHF A;  5IBM A;  4GWF A;  4NWF A;  2EU0 A;  1O46 A;  5HKY A;  4U17 A;  1BM2 A;  4A4C A;  1NZV A;  1IS0 A;  3PJP A;  2DLZ A;  3BUN B;  1SPS A;  1RJA A;  1LUK A;  3M7F A;  1KSW A;  3TKZ A;  2C0T A;  4K44 A;  3IMD A;  3OV1 A;  2CR4 A;  1F1W A;  1FBV A;  3VRP A;  5EEL A;  3BUM B;  1JYR A;  1CSY A;  2LCT A;  3KFJ A;  5DF6 A;  1BG1 A;  1FBZ A;  1A1E A;  1KA7 A;  3TL0 A;  2XP1 A;  4WWQ A;  2GSB A;  1KA6 A;  2L6K A;  2IUH A;  2PLD A;  3S9K A;  3VRQ A;  2EO3 A;  2HUW A;  4P9V A;  2KNO A;  3VS5 A;  4F5A A;  5DC0 B;  1O48 A;  1AOT F;  2EL8 A;  1O4P A;  1X0N A;  2HCK A;  4GPL B;  4L1B B;  1O45 A;  2IZV A;  3VRZ A;  4EY0 A;  4H1O A;  2RSY A;  2DX0 A;  2CI8 A;  2EO6 A;  1A09 A;  1CJ1 A;  3MXC A;  2YSX A; 
#chains in the Genus database with same CATH topology
 2SHP A;  5HKW A;  1JYU A;  3EAZ A;  4JGH A;  1R1P A;  1UUS A;  4FL2 A;  1Y1U A;  3QWY A;  1O4I A;  4D8K A;  1AYD A;  2HMH A;  3CXL A;  3VS1 A;  1BHH A;  1AYC A;  1VCB C;  2AUG A;  1OPK A;  1LUN A;  1OPL A;  4AJY V;  1TCE A;  1LCJ A;  2BBU A;  1LKL A;  3PSJ A;  2K7A B;  3IMJ A;  2DLY A;  2EYZ A;  1B47 A;  5EHR A;  3N7Y A;  4W9J C;  4K45 A;  1A1C A;  1A1A A;  4XZ0 A;  1UUR A;  3N84 A;  1R1Q A;  2YU7 A;  3VGO A;  4F5B A;  3CD3 A;  3UF4 A;  3OVE A;  4B9K C;  2EKX A;  1A1B A;  2JYQ A;  2FO0 A;  1F2F A;  1O4Q A;  2K79 B;  2MQI A;  3VS2 A;  4DGP A;  5KAZ A;  2LQN A;  4W9E C;  2L3T A;  1SHD A;  1O4R A;  5I6V A;  1AB2 A;  3US4 A;  1QCF A;  1GHU A;  4W9I C;  3K2T A;  3ZKJ A;  3UYO A;  1O4B A;  4E93 A;  1YVH A;  1M61 A;  3EAC A;  1MIL A;  1OO3 A;  1O42 A;  1AYB A;  3PLF B;  2MRK A;  3LYV A;  2VIF A;  2ABL A;  1D1Z A;  1O47 A;  2Y1N A;  1AOU F;  1BLK A;  5J3X A;  3ZUN C;  5EEQ A;  1AD5 A;  2DCR A;  3K2M A;  2IUG A;  1O4N A;  1OO4 A;  2DVJ A;  3HCK A;  2MC1 A;  4K11 A;  1HCT B;  2QMS A;  4OHH A;  2H8H A;  1O4C A;  1I3Z A;  3MXY A;  1SPR A;  1RQQ C;  1ZFP E;  4EIH A;  1NZL A;  4P9Z A;  3OB1 B;  3CWG A;  1PIC A;  2MRJ A;  2C0I A;  1BLJ A;  1BFJ A;  3BKB A;  1O4O A;  2CI9 A;  1AYA A;  2GE9 A;  2CIA A;  1CWD L;  1SHB A;  2LNW A;  3MAZ A;  3BUO B;  2CRH A;  4ROJ A;  2ETZ A;  1NRV A;  2PLE A;  4B95 C;  1RPY A;  1FHS A;  4AWJ C;  3PFV A;  2HDX A;  4XZ1 A;  2OZO A;  3VS4 A;  3ZNG A;  1LQB C;  2EYY A;  3GXX A;  3PQZ A;  3S8L A;  4QSY A;  1BFI A;  1D4T A;  1QAD A;  1FMK A;  5GJH A;  3GQI B;  2L4K A;  3IN7 A;  1M27 A;  2LNX A;  1BHH B;  2DM0 A;  3S8N A;  1YVL A;  2AOA A;  1HCS B;  4W9D C;  1SHA A;  1BKM A;  1O4J A;  2KK6 A;  4FL3 A;  5IBS A;  2Y1M A;  3OP0 A;  3ZRF C;  2PNB A;  1JYQ A;  1FU6 A;  4BKT C;  1CSZ A;  3VRR A;  1O4G A;  1MW4 A;  5DC4 A;  4X6S A;  1KC2 A;  3ZNI A;  1LUM A;  3HIZ B;  4E68 A;  1X6C A;  5AUL A;  2CBL A;  1K9A A;  5DC9 A;  1O44 A;  4W9F C;  1QG1 E;  1LCK A;  5EHP A;  1BKL A;  4BKS C;  1JWO A;  5AXI A;  1SKJ A;  3HHM B;  1O4L A;  2H5K A;  3VS0 A;  1P13 A;  2ECD A;  2SRC A;  2B3O A;  1Y57 A;  2C9W A;  4JEG A;  2PTK A;  4GL9 E;  1LUI A;  1G83 A;  2HDV A;  4DGX A;  5GJI A;  3CBL A;  2KGY A;  1O4A A;  4W9K C;  1O41 A;  4LUE A;  2CS0 A;  5CDW A;  4H34 A;  1O49 A;  1Z3K A;  1BMB A;  3BUW B;  2LQW A;  1D4W A;  5D0J A;  4OHL A;  2EYV A;  4TZI A;  1LKK A;  2MK2 A;  1TZE E;  3VRO A;  5HKZ A;  4A4B A;  4M4Z A;  2H46 E;  3VRN A;  1X27 A;  4U1P A;  4OHI A;  4K2R A;  2OQ1 A;  1O4D A;  3OB2 B;  3VS7 A;  1O4E A;  4NWG A;  2C0O A;  1FU5 A;  1O43 A;  4OHE A;  3C7I A;  1O4F A;  3PS5 A;  1JU5 A;  3VS3 A;  2EOB A;  1O4K A;  3BUX B;  4F59 A;  2Y3A B;  3ZTC C;  1O4M A;  3GXW A;  1A81 A;  2IUI A;  1R1S A;  4W9H C;  3VS6 A;  3WA4 A;  1A08 A;  3IN8 A;  2AOB A;  3N8M A;  5BO4 A;  2RVF A;  1CWE A;  3NHN A;  1GRI A;  1IJR A;  1FYR A;  4LUD A;  3T04 A;  3S8O A;  3ZRC C;  1XA6 A;  1O4H A;  1H9O A;  4OHD A;  1BF5 A;  2PNA A;  2RMX A;  2ROR A;  4WQO A;  4JE4 A;  3PSK A;  3VRY A;  4FBN A;  1A07 A;  5EG3 B;  2FCI A;  1WQU A;  3QWX X;  1LM8 V;  1BHF A;  5IBM A;  4GWF A;  4NWF A;  2EU0 A;  1O46 A;  5HKY A;  4U17 A;  1BM2 A;  4A4C A;  1NZV A;  1IS0 A;  3PJP A;  2DLZ A;  3BUN B;  1SPS A;  1RJA A;  1LUK A;  3M7F A;  1KSW A;  3TKZ A;  2C0T A;  4K44 A;  3IMD A;  3OV1 A;  2CR4 A;  1F1W A;  1FBV A;  3VRP A;  5EEL A;  3BUM B;  1JYR A;  1CSY A;  2LCT A;  2LRA A;  4W9L C;  3KFJ A;  5DF6 A;  1BG1 A;  1FBZ A;  1A1E A;  1KA7 A;  3ZTD C;  3TL0 A;  2XP1 A;  4WWQ A;  5LLI C;  2GSB A;  1KA6 A;  2L6K A;  2IUH A;  2PLD A;  3S9K A;  3VRQ A;  2EO3 A;  2HUW A;  4P9V A;  2KNO A;  3VS5 A;  4F5A A;  5DC0 B;  1O48 A;  1AOT F;  2EL8 A;  1O4P A;  1X0N A;  2HCK A;  4GPL B;  4L1B B;  1O45 A;  2IZV A;  3VRZ A;  4EY0 A;  4H1O A;  2RSY A;  4W9G C;  2DX0 A;  4W9C C;  2CI8 A;  2EO6 A;  1A09 A;  1CJ1 A;  3MXC A;  2YSX A; 
#chains in the Genus database with same CATH homology
 2SHP A;  5HKW A;  1JYU A;  3EAZ A;  4JGH A;  1R1P A;  1UUS A;  4FL2 A;  1Y1U A;  3QWY A;  1O4I A;  4D8K A;  1AYD A;  2HMH A;  3CXL A;  3VS1 A;  1BHH A;  1AYC A;  2AUG A;  1OPK A;  1LUN A;  1OPL A;  1TCE A;  1LCJ A;  2BBU A;  1LKL A;  3PSJ A;  2K7A B;  3IMJ A;  2DLY A;  2EYZ A;  1B47 A;  5EHR A;  3N7Y A;  4K45 A;  1A1C A;  1A1A A;  4XZ0 A;  1UUR A;  3N84 A;  1R1Q A;  2YU7 A;  3VGO A;  4F5B A;  3CD3 A;  3UF4 A;  3OVE A;  2EKX A;  1A1B A;  2JYQ A;  2FO0 A;  1F2F A;  1O4Q A;  2K79 B;  2MQI A;  3VS2 A;  4DGP A;  5KAZ A;  2LQN A;  2L3T A;  1SHD A;  1O4R A;  5I6V A;  1AB2 A;  3US4 A;  1QCF A;  1GHU A;  3UYO A;  3ZKJ A;  1O4B A;  4E93 A;  1YVH A;  1M61 A;  3EAC A;  1MIL A;  1OO3 A;  1O42 A;  1AYB A;  3PLF B;  2MRK A;  2VIF A;  2ABL A;  1D1Z A;  1O47 A;  2Y1N A;  1AOU F;  1BLK A;  5J3X A;  5EEQ A;  1AD5 A;  2DCR A;  3K2M A;  2IUG A;  1O4N A;  1OO4 A;  2DVJ A;  3HCK A;  2MC1 A;  4K11 A;  1HCT B;  2QMS A;  4OHH A;  2H8H A;  1O4C A;  1I3Z A;  3MXY A;  1SPR A;  1RQQ C;  1ZFP E;  4EIH A;  1NZL A;  4P9Z A;  3OB1 B;  3CWG A;  1PIC A;  2MRJ A;  2C0I A;  1BLJ A;  1BFJ A;  3BKB A;  1O4O A;  2CI9 A;  1AYA A;  2GE9 A;  2CIA A;  1CWD L;  1SHB A;  2LNW A;  3MAZ A;  3BUO B;  2CRH A;  4ROJ A;  2ETZ A;  1NRV A;  2PLE A;  1RPY A;  1FHS A;  3PFV A;  2HDX A;  4XZ1 A;  2OZO A;  3VS4 A;  3ZNG A;  2EYY A;  3GXX A;  3PQZ A;  3S8L A;  4QSY A;  1BFI A;  1D4T A;  1QAD A;  1FMK A;  5GJH A;  3GQI B;  2L4K A;  3IN7 A;  1M27 A;  2LNX A;  1BHH B;  2DM0 A;  3S8N A;  1YVL A;  2AOA A;  1HCS B;  1SHA A;  1BKM A;  1O4J A;  2KK6 A;  4FL3 A;  5IBS A;  2Y1M A;  3OP0 A;  2PNB A;  1JYQ A;  1FU6 A;  1CSZ A;  3VRR A;  1O4G A;  1MW4 A;  5DC4 A;  4X6S A;  1KC2 A;  3ZNI A;  1LUM A;  3HIZ B;  4E68 A;  1X6C A;  5AUL A;  2CBL A;  1K9A A;  5DC9 A;  1O44 A;  1QG1 E;  1LCK A;  5EHP A;  1BKL A;  1JWO A;  5AXI A;  1SKJ A;  3HHM B;  1O4L A;  2H5K A;  3VS0 A;  1P13 A;  2B3O A;  2SRC A;  2ECD A;  1Y57 A;  2C9W A;  4JEG A;  2PTK A;  4GL9 E;  1LUI A;  1G83 A;  2HDV A;  4DGX A;  5GJI A;  3CBL A;  1O4A A;  1O41 A;  4LUE A;  2CS0 A;  5CDW A;  4H34 A;  1O49 A;  1Z3K A;  1BMB A;  3BUW B;  2LQW A;  1D4W A;  5D0J A;  4OHL A;  2EYV A;  4TZI A;  1LKK A;  2MK2 A;  1TZE E;  3VRO A;  5HKZ A;  4A4B A;  4M4Z A;  2H46 E;  3VRN A;  1X27 A;  4U1P A;  4OHI A;  4K2R A;  2OQ1 A;  1O4D A;  3OB2 B;  3VS7 A;  1O4E A;  4NWG A;  2C0O A;  1FU5 A;  1O43 A;  4OHE A;  3C7I A;  1O4F A;  3PS5 A;  1JU5 A;  3VS3 A;  2EOB A;  1O4K A;  3BUX B;  4F59 A;  2Y3A B;  1O4M A;  3GXW A;  1A81 A;  2IUI A;  1R1S A;  3VS6 A;  3WA4 A;  1A08 A;  3IN8 A;  2AOB A;  3N8M A;  5BO4 A;  2RVF A;  1CWE A;  3NHN A;  1GRI A;  1IJR A;  1FYR A;  4LUD A;  3T04 A;  3S8O A;  1XA6 A;  1O4H A;  1H9O A;  4OHD A;  1BF5 A;  2PNA A;  2RMX A;  2ROR A;  4JE4 A;  3PSK A;  3VRY A;  4FBN A;  1A07 A;  5EG3 B;  2FCI A;  1WQU A;  3QWX X;  1BHF A;  5IBM A;  4GWF A;  4NWF A;  2EU0 A;  1O46 A;  5HKY A;  4U17 A;  1BM2 A;  4A4C A;  1NZV A;  1IS0 A;  3PJP A;  2DLZ A;  3BUN B;  1SPS A;  1RJA A;  1LUK A;  3M7F A;  1KSW A;  3TKZ A;  2C0T A;  4K44 A;  3IMD A;  3OV1 A;  2CR4 A;  1F1W A;  1FBV A;  3VRP A;  5EEL A;  3BUM B;  1JYR A;  1CSY A;  2LCT A;  3KFJ A;  5DF6 A;  1BG1 A;  1FBZ A;  1A1E A;  1KA7 A;  3TL0 A;  2XP1 A;  4WWQ A;  2GSB A;  1KA6 A;  2L6K A;  2IUH A;  2PLD A;  3S9K A;  3VRQ A;  2EO3 A;  2HUW A;  4P9V A;  2KNO A;  3VS5 A;  4F5A A;  5DC0 B;  1O48 A;  1AOT F;  2EL8 A;  1O4P A;  1X0N A;  2HCK A;  4GPL B;  4L1B B;  1O45 A;  2IZV A;  3VRZ A;  4EY0 A;  4H1O A;  2RSY A;  2DX0 A;  2CI8 A;  2EO6 A;  1A09 A;  1CJ1 A;  3MXC A;  2YSX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...