5BOKA

Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. strain ds2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
ENWIDAAARDEVPEGDVIGINIVGKEIALYEVAGEIYATDNTCTHGAARMSDGFLEGREIECPLHQGRFDVCTGKALCTPLTQDIKTYPVKIENMRVMLKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ferredoxin component of 3-nitrotoluene dioxygenase from Diaphorobacter sp. strain DS2
rcsb
source organism Diaphorobacter sp. ds2
molecule tags Metal binding protein
molecule keywords Ferredoxin
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2015-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5bokA00
3GL0A 2ZYLA 1JM1A 1SJGA 3VMHD 1ULIA 3GZXA 4HM1A 4P1CH 4HM4A 3VMGD 4NBFD 2FYNC 2QJYC 4H0LD 1KB9E 3C0DA 3CXHE 4QDCA 5AEWA 4HM6A 2QJKC 2HMMA 2DE5D 2HMJA 1BE3E 3L70E 2A06E 1EG9A 4NBGD 1O7GA 4NBDD 1NTKE 2D2CD 4NB9D 1PP9E 1NU1E 2NVFA 3D89A 2XSHA 1SQPE 4AIVA 3GZYA 1NDOA 4H13D 2NVGA 3TGUE 3VMID 1ZRTE 1FQTA 3L74E 4EMJB 4QUPA 2E4QA 2XR8A 1O7NA 1NYKA 4NBBD 2B24A 2FYUE 1SQXE 4HM3A 5AEUA 3VCPA 1O7WA 2QPZA 2E75D 2E76D 4NBED 1EZVE 1PPJE 2BMRA 3N0QA 3GB4A 2HMKA 2NWFA 2NUKA 2ZT9D 3EQQA 1Q90C 4NBCD 1VF5D 4AAYB 3GTEA 3H1HE 2HMNA 3BCCE 4NB8D 3CWBE 4QUQA 4QDFB 2YFJA 4HM2A 1KYOE 2DE6D 4H44D 4OGQD 3DQYA 3L72E 5CXMA 1SQQE 4HM8A 2JO6A 2GBWA 3H1IE 4QDFA 2YFIA 2GBXA 4HKVA 1NTZE 5HL4A 1WQLA 1UUWA 1L0NE 2BMOA 1NTME 1VCKA 2HMLA 3GKEA 5KKZC 2IBZE 2JZAA 3GCEA 3CX5E 1RIEA 1SQBE 3AZCA 4HJLA 4HM0A 4QDDA 2BCCE 3L71E 1SQVE 2HMOA 2CKFA 5KLIC 1ULJA 2Q3WA 3FOUA 2YFLA 2E4PA 2NVEA 5BOKA 3EN1A 3L75E 1G8JB 1RFSA 4HM7A 4NBAD 4QURA 2YIUC 3H1JE 2I7FA 4U3FE 3H1LE 3L73E 1O7HA 2BMQA 2YVJB 5KLVE 4HM5A 1G8KB 2E74D 1L0LE 4QCKA 1P84E 4P1BH 2DE7D 2NUMA 1O7MA 1UUVA 2QJPC 2XRXA 1O7PA 3H1KE 4NBHD 3GL2A 1VM9A 2XSOA 3GOBA 4PD4E 4PV1D 1BCCE 2B1XA 3VCAA 3GTSA
chains in the Genus database with same CATH superfamily
3GL0A 2ZYLA 1JM1A 1SJGA 3VMHD 1ULIA 3GZXA 4HM1A 4P1CH 4HM4A 3VMGD 4NBFD 2FYNC 2QJYC 4H0LD 1KB9E 3C0DA 3CXHE 4QDCA 5AEWA 4HM6A 2QJKC 2HMMA 2DE5D 2HMJA 1BE3E 3L70E 2A06E 1EG9A 4NBGD 1O7GA 4NBDD 1NTKE 2D2CD 4NB9D 1PP9E 1NU1E 2NVFA 3D89A 2XSHA 1SQPE 4AIVA 3GZYA 1NDOA 4H13D 2NVGA 3TGUE 3VMID 1ZRTE 1FQTA 3L74E 4EMJB 4QUPA 2E4QA 2XR8A 1O7NA 1NYKA 4NBBD 2B24A 2FYUE 1SQXE 4HM3A 5AEUA 3VCPA 1O7WA 2QPZA 2E75D 2E76D 4NBED 1EZVE 1PPJE 2BMRA 3N0QA 3GB4A 2HMKA 2NWFA 2NUKA 2ZT9D 3EQQA 1Q90C 4NBCD 1VF5D 4AAYB 3GTEA 3H1HE 2HMNA 3BCCE 4NB8D 3CWBE 4QUQA 4QDFB 2YFJA 4HM2A 1KYOE 2DE6D 4H44D 4OGQD 3DQYA 3L72E 5CXMA 1SQQE 4HM8A 2JO6A 2GBWA 3H1IE 4QDFA 2YFIA 2GBXA 4HKVA 1NTZE 5HL4A 1WQLA 1UUWA 1L0NE 2BMOA 1NTME 1VCKA 2HMLA 3GKEA 5KKZC 2IBZE 2JZAA 3GCEA 3CX5E 1RIEA 1SQBE 3AZCA 4HJLA 4HM0A 4QDDA 2BCCE 3L71E 1SQVE 2HMOA 2CKFA 5KLIC 1ULJA 2Q3WA 3FOUA 2YFLA 2E4PA 2NVEA 5BOKA 3EN1A 3L75E 1G8JB 1RFSA 4HM7A 4NBAD 4QURA 2YIUC 3H1JE 2I7FA 4U3FE 3H1LE 3L73E 1O7HA 2BMQA 2YVJB 5KLVE 4HM5A 1G8KB 2E74D 1L0LE 4QCKA 1P84E 4P1BH 2DE7D 2NUMA 1O7MA 1UUVA 2QJPC 2XRXA 1O7PA 3H1KE 4NBHD 3GL2A 1VM9A 2XSOA 3GOBA 4PD4E 4PV1D 1BCCE 2B1XA 3VCAA 3GTSA
chains in the Genus database with same CATH topology
3GL0A 2ZYLA 1JM1A 1SJGA 3VMHD 1ULIA 3GZXA 4HM1A 4P1CH 4HM4A 3VMGD 4NBFD 2FYNC 2QJYC 4H0LD 1KB9E 3C0DA 3CXHE 4QDCA 5AEWA 4HM6A 2QJKC 2HMMA 2DE5D 2HMJA 1BE3E 3L70E 2A06E 1EG9A 4NBGD 1O7GA 4NBDD 1NTKE 2D2CD 4NB9D 1PP9E 1NU1E 2NVFA 3D89A 2XSHA 1SQPE 4AIVA 3GZYA 1NDOA 4H13D 2NVGA 3TGUE 3VMID 1ZRTE 1FQTA 3L74E 4EMJB 4QUPA 2E4QA 2XR8A 1O7NA 1NYKA 4NBBD 2B24A 2FYUE 1SQXE 4HM3A 5AEUA 3VCPA 1O7WA 2QPZA 2E75D 2E76D 4NBED 1EZVE 1PPJE 2BMRA 3N0QA 3GB4A 2HMKA 2NWFA 2NUKA 2ZT9D 3EQQA 1Q90C 4NBCD 1VF5D 4AAYB 3GTEA 3H1HE 2HMNA 3BCCE 4NB8D 3CWBE 4QUQA 4QDFB 2YFJA 4HM2A 1KYOE 2DE6D 4H44D 4OGQD 3DQYA 3L72E 5CXMA 1SQQE 4HM8A 2JO6A 2GBWA 3H1IE 4QDFA 2YFIA 2GBXA 4HKVA 1NTZE 5HL4A 1WQLA 1UUWA 1L0NE 2BMOA 1NTME 1VCKA 2HMLA 3GKEA 5KKZC 2IBZE 2JZAA 3GCEA 3CX5E 1RIEA 1SQBE 3AZCA 4HJLA 4HM0A 4QDDA 2BCCE 3L71E 1SQVE 2HMOA 2CKFA 5KLIC 1ULJA 2Q3WA 3FOUA 2YFLA 2E4PA 2NVEA 5BOKA 3EN1A 3L75E 1G8JB 1RFSA 4HM7A 4NBAD 4QURA 2YIUC 3H1JE 2I7FA 4U3FE 3H1LE 3L73E 1O7HA 2BMQA 2YVJB 5KLVE 4HM5A 1G8KB 2E74D 1L0LE 4QCKA 1P84E 4P1BH 2DE7D 2NUMA 1O7MA 1UUVA 2QJPC 2XRXA 1O7PA 3H1KE 4NBHD 3GL2A 1VM9A 2XSOA 3GOBA 4PD4E 4PV1D 1BCCE 2B1XA 3VCAA 3GTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL0 A;  2ZYL A;  1JM1 A;  1SJG A;  3VMH D;  1ULI A;  3GZX A;  4HM1 A;  4P1C H;  4HM4 A;  3VMG D;  4NBF D;  2FYN C;  2QJY C;  4H0L D;  1KB9 E;  3C0D A;  3CXH E;  4QDC A;  5AEW A;  4HM6 A;  2QJK C;  2HMM A;  2DE5 D;  2HMJ A;  1BE3 E;  3L70 E;  2A06 E;  1EG9 A;  4NBG D;  1O7G A;  4NBD D;  1NTK E;  2D2C D;  4NB9 D;  1PP9 E;  1NU1 E;  2NVF A;  3D89 A;  2XSH A;  1SQP E;  4AIV A;  3GZY A;  1NDO A;  4H13 D;  2NVG A;  3TGU E;  3VMI D;  1ZRT E;  1FQT A;  3L74 E;  4EMJ B;  4QUP A;  2E4Q A;  2XR8 A;  1O7N A;  1NYK A;  4NBB D;  2B24 A;  2FYU E;  1SQX E;  4HM3 A;  5AEU A;  3VCP A;  1O7W A;  2QPZ A;  2E75 D;  2E76 D;  4NBE D;  1EZV E;  1PPJ E;  2BMR A;  3N0Q A;  3GB4 A;  2HMK A;  2NWF A;  2NUK A;  2ZT9 D;  3EQQ A;  1Q90 C;  4NBC D;  1VF5 D;  4AAY B;  3GTE A;  3H1H E;  2HMN A;  3BCC E;  4NB8 D;  3CWB E;  4QUQ A;  4QDF B;  2YFJ A;  4HM2 A;  1KYO E;  2DE6 D;  4H44 D;  4OGQ D;  3DQY A;  3L72 E;  5CXM A;  1SQQ E;  4HM8 A;  2JO6 A;  2GBW A;  3H1I E;  4QDF A;  2YFI A;  2GBX A;  4HKV A;  1NTZ E;  5HL4 A;  1WQL A;  1UUW A;  1L0N E;  2BMO A;  1NTM E;  1VCK A;  2HML A;  3GKE A;  5KKZ C;  2IBZ E;  2JZA A;  3GCE A;  3CX5 E;  1RIE A;  1SQB E;  3AZC A;  4HJL A;  4HM0 A;  4QDD A;  2BCC E;  3L71 E;  1SQV E;  2HMO A;  2CKF A;  5KLI C;  1ULJ A;  2Q3W A;  3FOU A;  2YFL A;  2E4P A;  2NVE A;  5BOK A;  3EN1 A;  3L75 E;  1G8J B;  1RFS A;  4HM7 A;  4NBA D;  4QUR A;  2YIU C;  3H1J E;  2I7F A;  4U3F E;  3H1L E;  3L73 E;  1O7H A;  2BMQ A;  2YVJ B;  5KLV E;  4HM5 A;  1G8K B;  2E74 D;  1L0L E;  4QCK A;  1P84 E;  4P1B H;  2DE7 D;  2NUM A;  1O7M A;  1UUV A;  2QJP C;  2XRX A;  1O7P A;  3H1K E;  4NBH D;  3GL2 A;  1VM9 A;  2XSO A;  3GOB A;  4PD4 E;  4PV1 D;  1BCC E;  2B1X A;  3VCA A;  3GTS A; 
#chains in the Genus database with same CATH topology
 3GL0 A;  2ZYL A;  1JM1 A;  1SJG A;  3VMH D;  1ULI A;  3GZX A;  4HM1 A;  4P1C H;  4HM4 A;  3VMG D;  4NBF D;  2FYN C;  2QJY C;  4H0L D;  1KB9 E;  3C0D A;  3CXH E;  4QDC A;  5AEW A;  4HM6 A;  2QJK C;  2HMM A;  2DE5 D;  2HMJ A;  1BE3 E;  3L70 E;  2A06 E;  1EG9 A;  4NBG D;  1O7G A;  4NBD D;  1NTK E;  2D2C D;  4NB9 D;  1PP9 E;  1NU1 E;  2NVF A;  3D89 A;  2XSH A;  1SQP E;  4AIV A;  3GZY A;  1NDO A;  4H13 D;  2NVG A;  3TGU E;  3VMI D;  1ZRT E;  1FQT A;  3L74 E;  4EMJ B;  4QUP A;  2E4Q A;  2XR8 A;  1O7N A;  1NYK A;  4NBB D;  2B24 A;  2FYU E;  1SQX E;  4HM3 A;  5AEU A;  3VCP A;  1O7W A;  2QPZ A;  2E75 D;  2E76 D;  4NBE D;  1EZV E;  1PPJ E;  2BMR A;  3N0Q A;  3GB4 A;  2HMK A;  2NWF A;  2NUK A;  2ZT9 D;  3EQQ A;  1Q90 C;  4NBC D;  1VF5 D;  4AAY B;  3GTE A;  3H1H E;  2HMN A;  3BCC E;  4NB8 D;  3CWB E;  4QUQ A;  4QDF B;  2YFJ A;  4HM2 A;  1KYO E;  2DE6 D;  4H44 D;  4OGQ D;  3DQY A;  3L72 E;  5CXM A;  1SQQ E;  4HM8 A;  2JO6 A;  2GBW A;  3H1I E;  4QDF A;  2YFI A;  2GBX A;  4HKV A;  1NTZ E;  5HL4 A;  1WQL A;  1UUW A;  1L0N E;  2BMO A;  1NTM E;  1VCK A;  2HML A;  3GKE A;  5KKZ C;  2IBZ E;  2JZA A;  3GCE A;  3CX5 E;  1RIE A;  1SQB E;  3AZC A;  4HJL A;  4HM0 A;  4QDD A;  2BCC E;  3L71 E;  1SQV E;  2HMO A;  2CKF A;  5KLI C;  1ULJ A;  2Q3W A;  3FOU A;  2YFL A;  2E4P A;  2NVE A;  5BOK A;  3EN1 A;  3L75 E;  1G8J B;  1RFS A;  4HM7 A;  4NBA D;  4QUR A;  2YIU C;  3H1J E;  2I7F A;  4U3F E;  3H1L E;  3L73 E;  1O7H A;  2BMQ A;  2YVJ B;  5KLV E;  4HM5 A;  1G8K B;  2E74 D;  1L0L E;  4QCK A;  1P84 E;  4P1B H;  2DE7 D;  2NUM A;  1O7M A;  1UUV A;  2QJP C;  2XRX A;  1O7P A;  3H1K E;  4NBH D;  3GL2 A;  1VM9 A;  2XSO A;  3GOB A;  4PD4 E;  4PV1 D;  1BCC E;  2B1X A;  3VCA A;  3GTS A; 
#chains in the Genus database with same CATH homology
 3GL0 A;  2ZYL A;  1JM1 A;  1SJG A;  3VMH D;  1ULI A;  3GZX A;  4HM1 A;  4P1C H;  4HM4 A;  3VMG D;  4NBF D;  2FYN C;  2QJY C;  4H0L D;  1KB9 E;  3C0D A;  3CXH E;  4QDC A;  5AEW A;  4HM6 A;  2QJK C;  2HMM A;  2DE5 D;  2HMJ A;  1BE3 E;  3L70 E;  2A06 E;  1EG9 A;  4NBG D;  1O7G A;  4NBD D;  1NTK E;  2D2C D;  4NB9 D;  1PP9 E;  1NU1 E;  2NVF A;  3D89 A;  2XSH A;  1SQP E;  4AIV A;  3GZY A;  1NDO A;  4H13 D;  2NVG A;  3TGU E;  3VMI D;  1ZRT E;  1FQT A;  3L74 E;  4EMJ B;  4QUP A;  2E4Q A;  2XR8 A;  1O7N A;  1NYK A;  4NBB D;  2B24 A;  2FYU E;  1SQX E;  4HM3 A;  5AEU A;  3VCP A;  1O7W A;  2QPZ A;  2E75 D;  2E76 D;  4NBE D;  1EZV E;  1PPJ E;  2BMR A;  3N0Q A;  3GB4 A;  2HMK A;  2NWF A;  2NUK A;  2ZT9 D;  3EQQ A;  1Q90 C;  4NBC D;  1VF5 D;  4AAY B;  3GTE A;  3H1H E;  2HMN A;  3BCC E;  4NB8 D;  3CWB E;  4QUQ A;  4QDF B;  2YFJ A;  4HM2 A;  1KYO E;  2DE6 D;  4H44 D;  4OGQ D;  3DQY A;  3L72 E;  5CXM A;  1SQQ E;  4HM8 A;  2JO6 A;  2GBW A;  3H1I E;  4QDF A;  2YFI A;  2GBX A;  4HKV A;  1NTZ E;  5HL4 A;  1WQL A;  1UUW A;  1L0N E;  2BMO A;  1NTM E;  1VCK A;  2HML A;  3GKE A;  5KKZ C;  2IBZ E;  2JZA A;  3GCE A;  3CX5 E;  1RIE A;  1SQB E;  3AZC A;  4HJL A;  4HM0 A;  4QDD A;  2BCC E;  3L71 E;  1SQV E;  2HMO A;  2CKF A;  5KLI C;  1ULJ A;  2Q3W A;  3FOU A;  2YFL A;  2E4P A;  2NVE A;  5BOK A;  3EN1 A;  3L75 E;  1G8J B;  1RFS A;  4HM7 A;  4NBA D;  4QUR A;  2YIU C;  3H1J E;  2I7F A;  4U3F E;  3H1L E;  3L73 E;  1O7H A;  2BMQ A;  2YVJ B;  5KLV E;  4HM5 A;  1G8K B;  2E74 D;  1L0L E;  4QCK A;  1P84 E;  4P1B H;  2DE7 D;  2NUM A;  1O7M A;  1UUV A;  2QJP C;  2XRX A;  1O7P A;  3H1K E;  4NBH D;  3GL2 A;  1VM9 A;  2XSO A;  3GOB A;  4PD4 E;  4PV1 D;  1BCC E;  2B1X A;  3VCA A;  3GTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...