5BRXA

X-ray crystal structure of aplysia californica (ac-achbp) in complex with 2-pyridyl azatricyclo[3.3.1.13,7]decane; 2-pyridylazaadamantane; 2-aza (ti-8480)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
211
structure length
209
Chain Sequence
b'DDKLHSQANLMRLKSDLFNRSYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFRER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soluble acetylcholine receptor
publication title Comparisons of Binding Affinities for Neuronal Nicotinic Receptors (NNRs) and AChBPs
rcsb
source organism Aplysia californica
molecule tags Acetylcholine binding protein
total genus 48
structure length 209
sequence length 211
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 5brxA00
3SIOA 5KZUA 4TWFA 3TLWA 5LXBA 2BJ0A 3U8LA 4UM3S 3PEOA 5J5IA 2VL0A 2XYTA 2X00D 4HFIA 4Z91A 2XNTA 2WN9A 4ILAA 2BYPA 3IGQA 4UY2A 5HCMA 4F8HA 4LMKA 5HEJA 3TLVA 3JADA 4IREA 4QH5A 4ZK4A 2Y58A 5TVCA 2XQAA 5AFMA 2XQ7A 5HCJA 4IL4A 2BYRA 4HFCA 4QABA 4QACA 5J5GA 3UU4A 5J5HA 3EAMA 3SQ9A 3WTHA 5J5FA 4Z90A 2W8GA 4AFTA 4TNWA 3TLUA 4XHEA 3WIPA 5AFMB 3WTJA 4IL9A 5HEOA 2BYSA 3SH1A 5BP0A 2BR7A 4QH1A 4ZRUA 3RIAA 2Y57A 4TNVA 5BRXA 5HEUA 5SYOA 4HFDA 2YN6A 5IUXA 4QH4A 4X5TA 3WTNA 2YKSA 5L47A 4ALXA 2XZ6A 4HFEA 3JAFA 4DBMA 2YMDA 3LSVA 5KE4A 2WNJA 4XK9A 3UU6A 2BG9A 1UX2A 5L4EA 2WNLA 3EI0A 4UM1A 5CFBA 5HEGA 4HQPA 2XQ8A 3WTLA 5LG3A 5L4HA 3UU3A 2XQ6A 2BG9E 4ILCA 3U8NA 4A97A 4QAAA 2Y56A 4PIRA 2X00A 4ZR6A 2BYNA 3ZDGA 4COFA 4UM3A 3EHZA 3C84A 2PGZA 5AINA 4TWDA 3WTMA 1UW6A 2XNVA 3SQ6A 1I9BA 5AFNA 3TLTA 2Y7YA 4WV9A 4UXUA 3UUBA 2WZYA 2XQ9A 5BW2A 5JMEA 3WTOA 2QC1B 4ZZBA 4ZJSA 4EZ1A 3U8MA 4AFGA 5AFKA 2XQ4A 2BR8A 2UZ6A 4HFHA 3P4WA 2PH9A 2BG9C 4ILBA 3T4MA 3ZDHA 2YOEA 3UQ7A 2ZJUA 5HEHA 2W8FA 3UU8A 3RQWA 3WTKA 4TWHA 4D01A 2BG9B 5CO5A 2XNUA 3UQ4A 4ZJTA 3RQUA 3GUAA 4NZBA 2WNCA 4HFBA 3P50A 5AFJA 4ZZCA 3RIFA 2ZJVA 3UU5A 4AFHA 5J0ZA 2XQ5A 3TLSA 4FRRA 2BYQA 2Y54A 4LMLA 4NPPA 4B5DA 4BQTA 5FJVA 2C9TA 3RHWA 3RI5A 4ZK1A 3WTIA 3U8KA 4A98A 4BFQA 5AFHA 5AFLA 2XQ3A 1UV6A 2XZ5A 4LMJA 3JAEA 2XYSA 3U8JA 4UM3P 3C79A 3PMZA 3ZKRA 2YMEA
chains in the Genus database with same CATH superfamily
3SIOA 5KZUA 4TWFA 3TLWA 5LXBA 2BJ0A 3U8LA 4UM3S 3PEOA 5J5IA 2VL0A 2XYTA 2X00D 4HFIA 4Z91A 2XNTA 2WN9A 4ILAA 2BYPA 3IGQA 4UY2A 5HCMA 4F8HA 4LMKA 5HEJA 3TLVA 3JADA 4IREA 4QH5A 4ZK4A 2Y58A 5TVCA 2XQAA 5AFMA 2XQ7A 5HCJA 4IL4A 2BYRA 4HFCA 4QABA 4QACA 5J5GA 3UU4A 5J5HA 3EAMA 3SQ9A 3WTHA 5J5FA 4Z90A 2W8GA 4AFTA 4TNWA 3TLUA 4XHEA 3WIPA 5AFMB 3WTJA 4IL9A 5HEOA 2BYSA 3SH1A 5BP0A 2BR7A 4QH1A 4ZRUA 3RIAA 2Y57A 4TNVA 5BRXA 5HEUA 5SYOA 4HFDA 2YN6A 5IUXA 4QH4A 4X5TA 3WTNA 2YKSA 5L47A 4ALXA 2XZ6A 4HFEA 3JAFA 4DBMA 2YMDA 3LSVA 5KE4A 2WNJA 4XK9A 3UU6A 2BG9A 1UX2A 5L4EA 2WNLA 3EI0A 4UM1A 5CFBA 5HEGA 4HQPA 2XQ8A 3WTLA 5LG3A 5L4HA 3UU3A 2XQ6A 2BG9E 4ILCA 3U8NA 4A97A 4QAAA 2Y56A 4PIRA 2X00A 4ZR6A 2BYNA 3ZDGA 4COFA 4UM3A 3EHZA 3C84A 2PGZA 5AINA 4TWDA 3WTMA 1UW6A 2XNVA 3SQ6A 1I9BA 5AFNA 3TLTA 2Y7YA 4WV9A 4UXUA 3UUBA 2WZYA 2XQ9A 5BW2A 5JMEA 3WTOA 2QC1B 4ZZBA 4ZJSA 4EZ1A 3U8MA 4AFGA 5AFKA 2XQ4A 2BR8A 2UZ6A 4HFHA 3P4WA 2PH9A 2BG9C 4ILBA 3T4MA 3ZDHA 2YOEA 3UQ7A 2ZJUA 5HEHA 2W8FA 3UU8A 3RQWA 3WTKA 4TWHA 4D01A 2BG9B 5CO5A 2XNUA 3UQ4A 4ZJTA 3RQUA 3GUAA 4NZBA 2WNCA 4HFBA 3P50A 5AFJA 4ZZCA 3RIFA 2ZJVA 3UU5A 4AFHA 5J0ZA 2XQ5A 3TLSA 4FRRA 2BYQA 2Y54A 4LMLA 4NPPA 4B5DA 4BQTA 5FJVA 2C9TA 3RHWA 3RI5A 4ZK1A 3WTIA 3U8KA 4A98A 4BFQA 5AFHA 5AFLA 2XQ3A 1UV6A 2XZ5A 4LMJA 3JAEA 2XYSA 3U8JA 4UM3P 3C79A 3PMZA 3ZKRA 2YMEA
chains in the Genus database with same CATH topology
3SIOA 5KZUA 4TWFA 3TLWA 5LXBA 2BJ0A 3U8LA 4UM3S 3PEOA 5J5IA 2VL0A 2XYTA 2X00D 4HFIA 4Z91A 2XNTA 2WN9A 4ILAA 2BYPA 3IGQA 4UY2A 5HCMA 4F8HA 4LMKA 5HEJA 3TLVA 3JADA 4IREA 4QH5A 4ZK4A 2Y58A 5TVCA 2XQAA 5AFMA 2XQ7A 5HCJA 4IL4A 2BYRA 4HFCA 4QABA 4QACA 5J5GA 3UU4A 5J5HA 3EAMA 3SQ9A 3WTHA 5J5FA 4Z90A 2W8GA 4AFTA 4TNWA 3TLUA 4XHEA 3WIPA 5AFMB 3WTJA 4IL9A 5HEOA 2BYSA 3SH1A 5BP0A 2BR7A 4QH1A 4ZRUA 3RIAA 2Y57A 4TNVA 5BRXA 5HEUA 5SYOA 4HFDA 2YN6A 5IUXA 4QH4A 4X5TA 3WTNA 2YKSA 5L47A 4ALXA 2XZ6A 4HFEA 3JAFA 4DBMA 2YMDA 3LSVA 5KE4A 2WNJA 4XK9A 3UU6A 2BG9A 1UX2A 5L4EA 2WNLA 3EI0A 4UM1A 5CFBA 5HEGA 4HQPA 2XQ8A 3WTLA 5LG3A 5L4HA 3UU3A 2XQ6A 2BG9E 4ILCA 3U8NA 4A97A 4QAAA 2Y56A 4PIRA 2X00A 4ZR6A 2BYNA 3ZDGA 4COFA 4UM3A 3EHZA 3C84A 2PGZA 5AINA 4TWDA 3WTMA 1UW6A 2XNVA 3SQ6A 1I9BA 5AFNA 3TLTA 2Y7YA 4WV9A 4UXUA 3UUBA 2WZYA 2XQ9A 5BW2A 5JMEA 3WTOA 2QC1B 4ZZBA 4ZJSA 4EZ1A 3U8MA 4AFGA 5AFKA 2XQ4A 2BR8A 2UZ6A 4HFHA 3P4WA 2PH9A 2BG9C 4ILBA 3T4MA 3ZDHA 2YOEA 3UQ7A 2ZJUA 5HEHA 2W8FA 3UU8A 3RQWA 3WTKA 4TWHA 4D01A 2BG9B 5CO5A 2XNUA 3UQ4A 4ZJTA 3RQUA 3GUAA 4NZBA 2WNCA 4HFBA 3P50A 5AFJA 4ZZCA 3RIFA 2ZJVA 3UU5A 4AFHA 5J0ZA 2XQ5A 3TLSA 4FRRA 2BYQA 2Y54A 4LMLA 4NPPA 4B5DA 4BQTA 5FJVA 2C9TA 3RHWA 3RI5A 4ZK1A 3WTIA 3U8KA 4A98A 4BFQA 5AFHA 5AFLA 2XQ3A 1UV6A 2XZ5A 4LMJA 3JAEA 2XYSA 3U8JA 4UM3P 3C79A 3PMZA 3ZKRA 2YMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SIO A;  5KZU A;  4TWF A;  3TLW A;  5LXB A;  2BJ0 A;  3U8L A;  4UM3 S;  3PEO A;  5J5I A;  2VL0 A;  2XYT A;  2X00 D;  4HFI A;  4Z91 A;  2XNT A;  2WN9 A;  4ILA A;  2BYP A;  3IGQ A;  4UY2 A;  5HCM A;  4F8H A;  4LMK A;  5HEJ A;  3TLV A;  3JAD A;  4IRE A;  4QH5 A;  4ZK4 A;  2Y58 A;  5TVC A;  2XQA A;  5AFM A;  2XQ7 A;  5HCJ A;  4IL4 A;  2BYR A;  4HFC A;  4QAB A;  4QAC A;  5J5G A;  3UU4 A;  5J5H A;  3EAM A;  3SQ9 A;  3WTH A;  5J5F A;  4Z90 A;  2W8G A;  4AFT A;  4TNW A;  3TLU A;  4XHE A;  3WIP A;  5AFM B;  3WTJ A;  4IL9 A;  5HEO A;  2BYS A;  3SH1 A;  5BP0 A;  2BR7 A;  4QH1 A;  4ZRU A;  3RIA A;  2Y57 A;  4TNV A;  5BRX A;  5HEU A;  5SYO A;  4HFD A;  2YN6 A;  5IUX A;  4QH4 A;  4X5T A;  3WTN A;  2YKS A;  5L47 A;  4ALX A;  2XZ6 A;  4HFE A;  3JAF A;  4DBM A;  2YMD A;  3LSV A;  5KE4 A;  2WNJ A;  4XK9 A;  3UU6 A;  2BG9 A;  1UX2 A;  5L4E A;  2WNL A;  3EI0 A;  4UM1 A;  5CFB A;  5HEG A;  4HQP A;  2XQ8 A;  3WTL A;  5LG3 A;  5L4H A;  3UU3 A;  2XQ6 A;  2BG9 E;  4ILC A;  3U8N A;  4A97 A;  4QAA A;  2Y56 A;  4PIR A;  2X00 A;  4ZR6 A;  2BYN A;  3ZDG A;  4COF A;  4UM3 A;  3EHZ A;  3C84 A;  2PGZ A;  5AIN A;  4TWD A;  3WTM A;  1UW6 A;  2XNV A;  3SQ6 A;  1I9B A;  5AFN A;  3TLT A;  2Y7Y A;  4WV9 A;  4UXU A;  3UUB A;  2WZY A;  2XQ9 A;  5BW2 A;  5JME A;  3WTO A;  2QC1 B;  4ZZB A;  4ZJS A;  4EZ1 A;  3U8M A;  4AFG A;  5AFK A;  2XQ4 A;  2BR8 A;  2UZ6 A;  4HFH A;  3P4W A;  2PH9 A;  2BG9 C;  4ILB A;  3T4M A;  3ZDH A;  2YOE A;  3UQ7 A;  2ZJU A;  5HEH A;  2W8F A;  3UU8 A;  3RQW A;  3WTK A;  4TWH A;  4D01 A;  2BG9 B;  5CO5 A;  2XNU A;  3UQ4 A;  4ZJT A;  3RQU A;  3GUA A;  4NZB A;  2WNC A;  4HFB A;  3P50 A;  5AFJ A;  4ZZC A;  3RIF A;  2ZJV A;  3UU5 A;  4AFH A;  5J0Z A;  2XQ5 A;  3TLS A;  4FRR A;  2BYQ A;  2Y54 A;  4LML A;  4NPP A;  4B5D A;  4BQT A;  5FJV A;  2C9T A;  3RHW A;  3RI5 A;  4ZK1 A;  3WTI A;  3U8K A;  4A98 A;  4BFQ A;  5AFH A;  5AFL A;  2XQ3 A;  1UV6 A;  2XZ5 A;  4LMJ A;  3JAE A;  2XYS A;  3U8J A;  4UM3 P;  3C79 A;  3PMZ A;  3ZKR A;  2YME A; 
#chains in the Genus database with same CATH topology
 3SIO A;  5KZU A;  4TWF A;  3TLW A;  5LXB A;  2BJ0 A;  3U8L A;  4UM3 S;  3PEO A;  5J5I A;  2VL0 A;  2XYT A;  2X00 D;  4HFI A;  4Z91 A;  2XNT A;  2WN9 A;  4ILA A;  2BYP A;  3IGQ A;  4UY2 A;  5HCM A;  4F8H A;  4LMK A;  5HEJ A;  3TLV A;  3JAD A;  4IRE A;  4QH5 A;  4ZK4 A;  2Y58 A;  5TVC A;  2XQA A;  5AFM A;  2XQ7 A;  5HCJ A;  4IL4 A;  2BYR A;  4HFC A;  4QAB A;  4QAC A;  5J5G A;  3UU4 A;  5J5H A;  3EAM A;  3SQ9 A;  3WTH A;  5J5F A;  4Z90 A;  2W8G A;  4AFT A;  4TNW A;  3TLU A;  4XHE A;  3WIP A;  5AFM B;  3WTJ A;  4IL9 A;  5HEO A;  2BYS A;  3SH1 A;  5BP0 A;  2BR7 A;  4QH1 A;  4ZRU A;  3RIA A;  2Y57 A;  4TNV A;  5BRX A;  5HEU A;  5SYO A;  4HFD A;  2YN6 A;  5IUX A;  4QH4 A;  4X5T A;  3WTN A;  2YKS A;  5L47 A;  4ALX A;  2XZ6 A;  4HFE A;  3JAF A;  4DBM A;  2YMD A;  3LSV A;  5KE4 A;  2WNJ A;  4XK9 A;  3UU6 A;  2BG9 A;  1UX2 A;  5L4E A;  2WNL A;  3EI0 A;  4UM1 A;  5CFB A;  5HEG A;  4HQP A;  2XQ8 A;  3WTL A;  5LG3 A;  5L4H A;  3UU3 A;  2XQ6 A;  2BG9 E;  4ILC A;  3U8N A;  4A97 A;  4QAA A;  2Y56 A;  4PIR A;  2X00 A;  4ZR6 A;  2BYN A;  3ZDG A;  4COF A;  4UM3 A;  3EHZ A;  3C84 A;  2PGZ A;  5AIN A;  4TWD A;  3WTM A;  1UW6 A;  2XNV A;  3SQ6 A;  1I9B A;  5AFN A;  3TLT A;  2Y7Y A;  4WV9 A;  4UXU A;  3UUB A;  2WZY A;  2XQ9 A;  5BW2 A;  5JME A;  3WTO A;  2QC1 B;  4ZZB A;  4ZJS A;  4EZ1 A;  3U8M A;  4AFG A;  5AFK A;  2XQ4 A;  2BR8 A;  2UZ6 A;  4HFH A;  3P4W A;  2PH9 A;  2BG9 C;  4ILB A;  3T4M A;  3ZDH A;  2YOE A;  3UQ7 A;  2ZJU A;  5HEH A;  2W8F A;  3UU8 A;  3RQW A;  3WTK A;  4TWH A;  4D01 A;  2BG9 B;  5CO5 A;  2XNU A;  3UQ4 A;  4ZJT A;  3RQU A;  3GUA A;  4NZB A;  2WNC A;  4HFB A;  3P50 A;  5AFJ A;  4ZZC A;  3RIF A;  2ZJV A;  3UU5 A;  4AFH A;  5J0Z A;  2XQ5 A;  3TLS A;  4FRR A;  2BYQ A;  2Y54 A;  4LML A;  4NPP A;  4B5D A;  4BQT A;  5FJV A;  2C9T A;  3RHW A;  3RI5 A;  4ZK1 A;  3WTI A;  3U8K A;  4A98 A;  4BFQ A;  5AFH A;  5AFL A;  2XQ3 A;  1UV6 A;  2XZ5 A;  4LMJ A;  3JAE A;  2XYS A;  3U8J A;  4UM3 P;  3C79 A;  3PMZ A;  3ZKR A;  2YME A; 
#chains in the Genus database with same CATH homology
 3SIO A;  5KZU A;  4TWF A;  3TLW A;  5LXB A;  2BJ0 A;  3U8L A;  4UM3 S;  3PEO A;  5J5I A;  2VL0 A;  2XYT A;  2X00 D;  4HFI A;  4Z91 A;  2XNT A;  2WN9 A;  4ILA A;  2BYP A;  3IGQ A;  4UY2 A;  5HCM A;  4F8H A;  4LMK A;  5HEJ A;  3TLV A;  3JAD A;  4IRE A;  4QH5 A;  4ZK4 A;  2Y58 A;  5TVC A;  2XQA A;  5AFM A;  2XQ7 A;  5HCJ A;  4IL4 A;  2BYR A;  4HFC A;  4QAB A;  4QAC A;  5J5G A;  3UU4 A;  5J5H A;  3EAM A;  3SQ9 A;  3WTH A;  5J5F A;  4Z90 A;  2W8G A;  4AFT A;  4TNW A;  3TLU A;  4XHE A;  3WIP A;  5AFM B;  3WTJ A;  4IL9 A;  5HEO A;  2BYS A;  3SH1 A;  5BP0 A;  2BR7 A;  4QH1 A;  4ZRU A;  3RIA A;  2Y57 A;  4TNV A;  5BRX A;  5HEU A;  5SYO A;  4HFD A;  2YN6 A;  5IUX A;  4QH4 A;  4X5T A;  3WTN A;  2YKS A;  5L47 A;  4ALX A;  2XZ6 A;  4HFE A;  3JAF A;  4DBM A;  2YMD A;  3LSV A;  5KE4 A;  2WNJ A;  4XK9 A;  3UU6 A;  2BG9 A;  1UX2 A;  5L4E A;  2WNL A;  3EI0 A;  4UM1 A;  5CFB A;  5HEG A;  4HQP A;  2XQ8 A;  3WTL A;  5LG3 A;  5L4H A;  3UU3 A;  2XQ6 A;  2BG9 E;  4ILC A;  3U8N A;  4A97 A;  4QAA A;  2Y56 A;  4PIR A;  2X00 A;  4ZR6 A;  2BYN A;  3ZDG A;  4COF A;  4UM3 A;  3EHZ A;  3C84 A;  2PGZ A;  5AIN A;  4TWD A;  3WTM A;  1UW6 A;  2XNV A;  3SQ6 A;  1I9B A;  5AFN A;  3TLT A;  2Y7Y A;  4WV9 A;  4UXU A;  3UUB A;  2WZY A;  2XQ9 A;  5BW2 A;  5JME A;  3WTO A;  2QC1 B;  4ZZB A;  4ZJS A;  4EZ1 A;  3U8M A;  4AFG A;  5AFK A;  2XQ4 A;  2BR8 A;  2UZ6 A;  4HFH A;  3P4W A;  2PH9 A;  2BG9 C;  4ILB A;  3T4M A;  3ZDH A;  2YOE A;  3UQ7 A;  2ZJU A;  5HEH A;  2W8F A;  3UU8 A;  3RQW A;  3WTK A;  4TWH A;  4D01 A;  2BG9 B;  5CO5 A;  2XNU A;  3UQ4 A;  4ZJT A;  3RQU A;  3GUA A;  4NZB A;  2WNC A;  4HFB A;  3P50 A;  5AFJ A;  4ZZC A;  3RIF A;  2ZJV A;  3UU5 A;  4AFH A;  5J0Z A;  2XQ5 A;  3TLS A;  4FRR A;  2BYQ A;  2Y54 A;  4LML A;  4NPP A;  4B5D A;  4BQT A;  5FJV A;  2C9T A;  3RHW A;  3RI5 A;  4ZK1 A;  3WTI A;  3U8K A;  4A98 A;  4BFQ A;  5AFH A;  5AFL A;  2XQ3 A;  1UV6 A;  2XZ5 A;  4LMJ A;  3JAE A;  2XYS A;  3U8J A;  4UM3 P;  3C79 A;  3PMZ A;  3ZKR A;  2YME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...