5BXOA

Human tankyrase-2 in complex with macrocyclised extended peptide cp4n2m3
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
160
structure length
160
Chain Sequence
b'SGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Human Tankyrase-2 in Complex with Extended Stapled Peptide sp4n2m3
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 52
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5bxoA00
5ITZF 2KXPC 4U95D 1YMPA 4K5BA 1MYOA 4DUIA 5CEAA 4GMRA 5ENPD 1YCSB 3ZKJA 4ATZD 2HE0A 5CECB 2P2CP 2XENA 1BI8B 3ZUVB 2JABA 3B95A 5ENSD 1MX2A 4A63B 5ENTD 4LSZE 1BLXB 2ZGDA 5D66A 3J5PA 5FIOA 4HI9A 1K1BA 4HRNA 2ETCA 4BEPA 3B7BA 3JXJA 4NIKA 4F6RD 4O60A 1IXVA 4Z68A 1D9SA 3KEAA 5AQBA 3NBNB 3TWTA 5ENOD 1IKND 1TR4A 5ENRD 2QYJA 4HQDA 1A5EA 2XZTG 5KWDA 4YDWA 1N0RA 2XZDG 4HBDA 4QQIA 4F1PA 3TWUA 5KBAA 4J7WA 5AN8A 1N11A 3UTMA 1BU9A 3T8KA 4BERA 5ENQD 1AWCB 5JA4D 4LG6A 4G8KA 3TWWA 3V2OA 1DC2A 3EU9A 1S70B 5EYPF 1IHBA 4HI8A 2BKGA 3Q9UC 4HNAD 4DRXE 2RFMA 4DX6D 1G3NB 5AQAA 1WG0A 2VGEA 3EHRA 5HS0A 3V31A 3TWRA 4BSZB 1MJ0A 2MYOA 4DX1A 5KNHD 4DX5D 4K5CA 1MX6A 1SVXA 1N0QA 1WDYA 5FINA 2DZOA 5HKPA 3V79K 2ZGGA 4G8LA 3DEOA 4ZHBA 5CBOA 3TWQA 2QC9A 3NOGD 1SW6A 2NYJA 4U96D 1BD8A 2RFAA 5CERB 1OT8A 2Y1LE 3TWXA 3NOCD 4CYMD 1OY3D 1DCQA 2ETBA 4O1PA 2AJAA 1YYHA 4BETA 2V4HC 4GPMA 4UUCA 5KNGA 4HB5A 5EIBE 2ETAA 1UOHA 2FO1E 4OAVB 4CZ2D 3W9FA 4LNUD 1QYMA 2A5EA 5EN5D 4JB8P 2XEEA 4YDYA 3ZU7B 2F37A 2V5QC 3J5QB 5EIDA 4HRMB 3UXGA 2BKKB 3D9HA 3V30A 5AQ7A 3F6QA 5BXOA 4U8YD 5EILA 5AQ9A 2Y0BG 2DVWA 2XEHA 4OAUC 2F8YA 4HLLA 4DX7D 3LJNA 5CEDB 3AJIA 3C5RA 3V2XA 3W9GA 1AP7A 5BXUA 5AARA 3T9KA 3JXIA 2F8XK 3TWVA 5HRYA 3UI2A 1K1AA 4TUMA 3HRAA 5JMND 1MX4A 3DEPA 4HRLA 4U8VD 3TWSA 2PNNA 2L6BA 2B0OE 2DZNA 3IXEA 3JUEA 2J8SD 1BI7B 4RLYA 3ZNGA 4DX2A 1NFIE 4O1OA 2DWZA 2KBXA 3AAAC 4C48B 4K5AB 3HG0D 4J8YA 3Q9NC 4QFVA 5EYLA 3SO8A 4B93B 4BESA 4ZFHA 5CBNA 4N5QA 3EHQA 1K3ZD 5AAOA
chains in the Genus database with same CATH superfamily
5ITZF 1YMPA 2C2LA 2LNIA 3PEUB 2IFUA 3FUNA 3UM0A 4FULA 4UI9C 3CHOA 4KXKB 1DCEA 4A3VA 3JXJA 2WXFA 4LNBA 3NF1A 1TR4A 4AVXA 2QYJA 4HQDA 4YDWA 4HOSA 4K03A 2CHXA 2PQNA 3QB2A 3UMVA 3EHNA 4Q96A 3T8MA 4ANWA 4AJWA 4GZDA 3ISMC 1Z6TA 2ZGGA 3MKQA 2QC9A 1B89A 1BD8A 3NB2A 3UKUG 4XI9A 5EIBE 2IY0C 4XZ4A 1N54A 2FO1E 3TG5A 3AU5A 3FTUA 1S63A 1H2UA 1JCRA 5BXOA 1FPPA 3MA5A 3Q5MA 4U7EB 2XQ0A 1O1TA 1DVPA 3V2XA 3ASFA 5AARA 2CFZA 2DCPA 2I1KA 1P5QA 2VSNA 3EUVA 4G2VA 4DX2A 3FEYA 1BI7B 4DLQA 5EX0A 3Q4AB 4GA1A 3FTVA 4C48B 3FEXA 4J8YA 5CRUA 4BESA 3RJVA 4EPZA 3D9JA 4U0ZA 5DBKA 4ANUA 4ATZD 4M3OA 3HHMA 3BUAA 3G2WA 4F53A 4UI9J 5AIJA 3C3RA 4BTBA 3CHSA 2WXJA 3SQVA 3HYMB 3J5PA 4DPRA 4HLEA 3G2SA 3TXMA 4RG9A 1TN6A 3GYZA 3PZ1A 4FJZA 3IEGA 4HBDA 3BG0B 3LCAA 1E8WA 4F1PA 1BU9A 3GW4A 4GA2A 3L17A 1IHBA 4HI8A 1IYGA 3FTZA 1G3NB 1ELWA 3E4BA 1QNFA 3SHFA 4G24A 2P9KG 3ASDA 1OWPA 3LY8A 4UWLA 4UWHA 3APDA 3CR3A 3RRMB 2LXMA 2P9UG 5FQ4A 4CZ2D 4AV7A 3X2QE 5D0OD 4DK5A 5EN5D 2XEEA 3B13A 4GTSA 3UXGA 2IOLA 3SBTB 3R7QA 2CG3A 4H7YA 4F7AA 1KZOA 3JUIA 2WMNA 2B0OE 3UPVA 4XI0A 5KJNA 3B7RL 4K5AB 3FUEA 2ZU6B 2VJ8A 2HR2A 1S64A 2RKKA 2XENA 1KZPA 3ABLE 2IF4A 3B95A 2YINA 3QDNA 4OYSA 4APFA 3ASOE 5KCMA 4YDEA 3UX4A 2XCCA 3Q79A 5FZRA 1Z5SC 3Q78A 3UM2A 1QZ2A 4H7XA 3T8KA 5JA4D 2OVBA 4XIFA 3TWWA 4G26A 4DX6D 2VGEA 3I5PA 4I2ZA 3T5VA 3CVXA 4PS8A 3IHVA 1E7VA 1MX6A 1SVXA 3ML9A 4TV3A 2WMOA 3UQ3A 5G04C 5E75A 3PZ4A 3PUJA 3D9KA 2YHCA 3RKVA 3NOCD 1DCQA 2BEDA 1TNOA 2ETAA 5AYWD 2Y4UA 3W9FA 3D9OA 3ZRHA 3SD5A 4AEZC 2L0TB 3D9HA 4JEUA 4GTVA 3Q75A 4JVSA 3SGHA 2VYIA 3ZFWA 1OCRE 1TN7A 3FU5A 4EBAA 4ILHB 2CG2A 2EILE 3GZ2A 3WXXA 3PREA 4FHKA 3FU3A 4A55A 3AG1E 2DWZA 3U64A 5EYLA 4TRQA 2DBAA 4CYMD 3I3NA 3ESKA 3P2BA 2ZISA 2JABA 3FUJA 1N4PA 4A63B 1BLXB 2LXLA 2E2EA 1V55E 4I6JA 2LO6A 3ZN3A 1N94A 5JJTA 5BPPA 1TNYA 2H6GA 2RD0A 2ZXWE 4U63A 4CRWA 4NURA 3SFZA 3CVYA 3E33A 3CVPA 4L7TA 3ZGQA 3NOGD 4Y6WA 5FJYA 1OT8A 3FHEA 4ME2A 4HOTA 3TGOA 2BUGA 5T3RA 3DSVA 3AS8A 4LCTA 5EDSA 4YDYA 3P1UA 4RQIA 2DYRE 3VTYA 5CEDB 3VTXA 3AJIA 1O1SA 3MZLB 3JXIA 3G2UA 5ARFA 3LJ3A 4OVVA 3B7UX 4D10C 2MRIA 2L6BA 4BWRA 3FUDA 4JD2G 3S7JA 2WXGA 5J90A 2VGXA 3ZW3A 2H6FA 1OWMA 3FY4A 3CGHA 4GZCA 4FLHA 4L2LA 1U3CA 1IKND 2J49A 1A5EA 4HORA 3C98A 1H6PA 3D9IA 1JWGA 5E76A 3SFYA 3V2OA 3FTWA 4ILIA 3AU4A 1N52A 3FU6A 4IULA 1SA5A 1TJCA 2X38A 3OAWA 4GA0A 1WDYA 3UIPC 1TYQG 3EIJA 1JPLA 2J09A 4BSXA 1UW4B 2C0MA 2V4HC 4BX8A 2QZAA 3FUHA 1QYMA 2CHWA 1NP7A 3BG1B 3L9TA 2R17C 3LPZA 2DVWA 2X6FA 3LJNA 5HQ8A 4I6GA 1OWOA 3W9GA 3S2AA 4JEHA 2LSVA 3FTSA 4JC8A 3D3MA 4TXPA 4TXQA 1EYHA 2XS8A 1V54E 2XCBA 3N71A 2GGFA 3L08A 5BW8C 4FADA 2CFUA 1RW2A 5BT1A 4QFVA 3CV0A 3UT7A 2KXPC 1LD8A 5ENSD 3LVRE 2BF0X 2ZGDA 4YVOA 2WXRA 3OTNA 1ELRA 2J9QA 3TWTA 5ENRD 1D8EA 4TUUA 5JJ7A 3URZA 1PAQA 3BEEA 4QQIA 5ENQD 3D9NA 4WAFA 3Q9UC 4J8FA 3R7RA 3ZYKA 4BSZB 2IONA 1FVFA 1HX8A 4K5CA 2LAIA 3HDXA 5LX8A 4CDMA 1XGWA 4UQZA 4L2YA 2Y1LE 1HE8A 2FO7A 2AW6A 3LY7A 4I2WA 2GROB 4IRUA 4F1SA 4I1AA 2P9SG 5CMYA 2F37A 4N3CA 4HRMB 2FF4A 4U8YD 3PZ2A 4C0MA 1LTXA 3U4TA 3VLEA 3FULA 5CHEE 4I1OB 3DXMG 4B89A 4AXHA 2PZIA 2V8SE 4GAAA 4HRLA 3FFLA 2AXVA 4V3IA 3IBEA 3CQCB 4ATGA 4MLPA 4EHMA 2KBXA 4NRHB 4FHJA 2GRNB 3SO8A 1OWLA 5CBNA 1NZNA 3CHMA 4WNGA 3PDNA 4F3VA 2MOWA 1JCSA 4LNGA 5B1BE 3ZYMA 3ULYA 2YNQA 4BT9A 4GMRA 5ARGA 3FUMA 3QWWA 2WM9A 3ZUVB 1IHGA 4FP7A 4J8EA 4HFGA 4DI4A 1DNPA 2R05A 1Z3XA 2LSUA 4LUNU 3RU0A 4O60A 2J4DA 2XEVA 3Q47B 2P9PG 2H6HA 4OVUA 1NL4A 2KCLA 3UTMA 1GW6A 2QFCA 4HNAD 4G11A 4PUCA 3QWVA 3QARA 5FTPA 3L16A 1JWFA 4DX1A 2J08A 1WAO1 5FINA 4GMLA 5G05C 1SW6A 1HF8A 1E96B 1ZBPA 3ONLA 3CK7A 3RRNB 1N4SA 5KNGA 2OEVA 4B8AA 4RG6A 3FH5A 4ACLA 1H2TC 4U0UA 4GYYA 4L1BA 3PS6A 2OVFA 2GRLA 4KZ0A 1U3DA 2DYSE 2Y0BG 3OXFA 3PEVB 2PQRA 3MKRA 4E6HA 3CHQA 2KZTB 1MZCA 4BX9A 2P9IG 3S7DA 4WWOA 5HRYA 1TNUA 3FP3A 1KLXA 5BUZA 4GYWA 4UWFA 3GZ1A 3FH7A 4KZCA 3Q9NC 2Y3AA 2GW1A 4N5QA 5LCWC 1H0AA 3NZUA 5ENPD 4BFRA 4K0RA 2GRQB 4CT4A 3I4RB 2P2CP 3JCKC 1PC2A 3DSXA 2AXZA 5FQ6A 4JPSA 1HH8A 2KCKA 3B7BA 4NIKA 3D9MA 4WNFA 1D9SA 3QNKA 3HIZA 1N0RA 3PE4A 5C2YA 3CLJA 4G23A 2V5FA 3QKYA 4YVQC 4ACKA 3DXKG 5EYPF 4GPKA 2R59A 2BKGA 1WG0A 3TJPA 1KT0A 1FCHA 2IQCA 4WNEA 3HXCA 5JJ6A 4GMJA 1N0QA 4U04A 1JUQA 5CERB 3SNXA 3CK8A 3DSUA 2WXQA 2LAHA 4LNUD 4Q94A 2KZTA 4JB8P 1W3BA 2BKKB 3LDZA 4CEMA 1HXIA 3FUKA 2AXUA 2IOSA 4C9BB 3FUFA 4RLYA 4L23A 3JQ0A 1TEZA 4B93B 3R9AB 4YDOA 3Q15A 2FEZA 1E7UA 3DPYA 4MKTA 3U66A 3D9LA 3LY9A 3QOUA 4LSZE 2ETCA 3PNLB 1JCQA 3NBNB 1QQEA 4DLOA 1Y8MA 1N95A 2ONDA 2OCCE 4FJYA 4J8SA 4BERA 2WXKA 1VDYA 3ZPJA 4G8KA 4AP2A 5B1AE 5A7DB 5IY5E 4DRXE 5AJLA 2RFMA 3FH8A 5HS0A 2VSXE 3APFA 2MYOA 3MYVA 5T8IA 4FA6A 2VGXB 4U07A 4MBGA 2X3MA 5HKPA 4I9CA 3L82A 3R9MA 3QWPA 5CBOA 5FZQA 1XNFA 3KD7A 2NYJA 2RFAA 1WM5A 1INZA 4GPMA 2A5EA 3ENEA 3DSWA 5LP0A 3EDTB 2JEKA 3DSSA 5D0QD 3HXBA 3RK6A 5G04J 4AM9A 2QYUA 4B0ZA 4EECA 3C72A 1Z3YA 4GB9A 5J08A 4GCOA 3DEPA 5T4YA 2VSOE 3CSFA 3JUEA 4GZ5A 4XX5A 2GRRB 5AAOA 3CK9A 2XPYA 5JHBA 2KATA 4J0UA 3E32A 3K9IA 1Q2ZA 3C3OA 1E90A 3PZDA 4N3BA 5D66A 3L13A 2IEJA 1K1BA 4BEPA 4HS2A 1OCCE 3SI5A 3LXUX 5CCMA 2XRZA 5KWDA 1PY1A 3UT8A 3PVLA 2XPZA 4EZLA 4ABNA 5ANLA 4AIFA 1EF1C 2I1JA 3IKOB 2I2OA 5AQAA 3EHRA 1OXJA 4CCAA 5KJKA 3KS2A 1D8DA 4IN3B 2J07A 4I6EA 2P9LG 4GCNA 3AS4A 3Q7AA 2KCVA 4B8CB 3V79K 4ZHBA 4XE0A 1KT1A 4JL0A 1OY3D 3WG7E 1YYHA 2L0IA 4UUCA 3D9PA 1IQRA 3ML8A 2BTDA 3AG3E 4UQXA 5EILA 5AQ9A 2ZIRA 3ZHEB 4APOA 3TG4A 4OAUC 2F8YA 3MV3B 4BY6A 4GTMA 1SZ9A 2GRPB 3DPDA 2A4ZA 1K1AA 1ELKA 1OCZE 3FUIA 3CKBA 3IXEA 5FZSA 2AVPA 3AAAC 1H6KA 4HVBA 3G2TA 4UWGA 5KBAA 2WQ7A 2RG8A 2WVIA 2Q7FA 2ILRA 5KJLA 3CVLA 2AWIA 3MGBA 3ZKJA 2HYZA 3BQOA 3MJWA 4FLBA 4A1GA 4A3TA 3UM1A 3C3QA 5BV1A 5FQ8A 2EIME 4I1MA 4JA7A 3AS5A 3CVQA 1S0PA 3CHRA 3CVWA 2M63A 2X6JA 4JHKA 2WXOA 1DC2A 4ANXA 2X6HA 1A17A 3ABME 4WUYA 4U8HA 3UM3A 3MEKA 3ZXSA 3DEOA 1E8ZA 3G2VA 4O6FA 2WB2A 5EKQD 3ZHEA 4CGWA 3CQGB 4BT8A 1HG2A 1Y6IA 1FVHA 4AY5A 4TXRA 4GZ6A 3T5XA 3KSLA 2IJGX 3HXFA 4GZ3A 2XRYA 1AP7A 2F8XK 1SQMA 1UJJA 1YA0A 4JW1A 5EX3A 3EU5A 5G2NA 1QBQA 2R03A 4A1SA 4O1OA 2HO1A 2WQHA 4GTRA 1HG5A 1ZB1A 4UWKA 1UN8A 5LOZA 4UI9K 4U95D 4C0EA 4K5BA 3PH0C 5CEAA 3S7FA 2HE0A 4U0SA 3UUXA 3SFXA 3L22A 4WNDA 2WXLA 1K8KG 2L6JA 2X6KA 4GTPA 5FIOA 1U2VG 4HOQA 4HRNA 2F0YA 2WPVA 1IXVA 3KEAA 3ASGA 2J4BA 3RSEG 1WY6A 3FDHA 4JZYA 4KVMA 4CDRA 5FQ7A 2IO3C 3EU9A 1NA0A 1LD7A 4KVOA 2PM7A 4CT0A 3KEZA 2DZOA 3HXDA 2I9CA 2OEWA 3LVQE 3TWXA 4AOFA 3UKRG 3E37A 5BNWA 2HM8A 3ASNE 2CHZA 3VLDA 2C0LA 5AQ7A 5HI7A 3UIOC 2XEHA 2YQ8A 3CVNA 3HXEA 2E0IA 4U8VD 2Y4TA 2EINE 2J8SD 3EHMA 3QJZA 4I43A 4EQFA 2NC9A 4ZFHA 4JXTA 2KC7A 4N2QA 3EHQA 1H6OA 3QC1A 3ZEFA 2Y69E 1YCSB 5CECB 3OXLA 3CIAA 5FWQA 2R2LA 1TJFA 4GTOA 4HI9A 4CGVA 4PS7A 5AQBA 1TN8A 5ENOD 5G55A 3E34A 3TWUA 5AN8A 1HZ4A 4GYOA 3NZSA 3FTYA 3L54A 1S70B 5CMWA 3ONKA 3HVEB 3ZIMA 3JQ1A 2FI7A 3KSQA 3ZXPA 3CHPA 4FU3A 3RO3A 2OV8A 2FULA 2NSZA 1EDUA 4CDNA 3EJNA 3UT4A 5A23A 2UWJG 4O1PA 5AENA 1BPOA 4DI3A 4HB5A 3ZVVA 3CSTA 5EIDA 4B94A 1UN9A 4NACA 2VTBB 2GRMA 4XEIG 2FBNA 2WQ6A 5G05J 2B6CA 4NQ0A 4PDXA 1O5MA 2LUHA 4KMOA 4L9PA 2XGSA 4YNDA 3LS8A 5ENNA 2MHKA 2WXPA 3DBSA 3ESLA 3QAQA 3ULEG 2P9NG 3NAWA 4W9RA 4DJAA 5ANRA 2VSYA 3DRAA 4PS3A 5ENTD 1FT2A 2XGOA 3RAUA 3CKCA 2XS1A 3HVEA 4BTAA 1E8XA 2R02A 5LCWJ 1OWNA 1AWCB 2PL2A 4Y6CA 3V31A 4HOUA 3LEWA 2JLBA 4ANVA 4J6IA 4JHRA 4P29A 3SZ7A 5LFAA 1SZAA 4JHJA 4G8LA 3O4ZA 1OUVA 3I4GA 3B7TA 3KAEA 3MX3A 3SBSA 4N2SA 2VTBA 4OAVB 2KM4A 3ZU7B 4N5CA 2DIWA 3ABKE 4FC8A 3PRZA 5BV0A 4M7CA 4DX7D 3C5RA 3TAXA 4Q69A 3MV2B 3Q49B 3UI2A 3HRAA 1MX4A 4E85A 3PZ3A 4XKBA 2WXMA 3NQPA 4GTTA 3ZNGA 1FT1A 3HG0D 3RRUA 2L9BA 3Q73A 1MQSA 3U9WA 1MYOA 4DUIA 4WWNA 2PM6A 2H6IA 4EZJA 1BI8B 5B3SE 2VGYA 1UG3A 3VLFA 1UJKA 4UQYA 5H7PA 2IO2C 4F6RD 2NXPA 4Z68A 2UY1B 1IQUA 2XZTG 2XGMA 2XPIA 2XZDG 1N11A 3FU0A 3Q7FA 3QK0A 2QY7A 1LF8A 3ZYQA 3ASHA 3EIQC 3RIBA 2WXHA 4HXIA 3RO2A 4MRUA 3PNTB 4N3AA 1MJ0A 1ZU2A 1SA4A 3U3WA 4AY6A 4DX5D 5KNHD 1HU3A 3OXGA 4URKA 5D2MC 4U96D 2P58C 3ZYLA 2R5SA 2WXNA 2EIKE 2ETBA 4BETA 4I17A 5M72A 1UOHA 4KYOB 3J5QB 3V30A 3LYAA 4XKCA 1HFAA 4LEUA 4HLLA 2OOEA 5BXUA 4RSYA 3TWVA 3TL5A 4TUMA 5JMND 3TWSA 5CRVA 1X81A 4G25A 4LERA 5KJMA 1TNZA 2DZNA 3DWLG 1NFIE 4GTQA 2EQXA 3ULQA 1K3ZD 4EBAG 2WXIA 5A6CA 3O48A 3AG2E 1NA3A 3LKUA 1L5JA 3APCA 2UY1A 3TXNA 1TNBA 3CEQA 1MX2A 3PE3A 1OCOE 3SY2A 1HS6A 4IYPA 3PUKA 1H2VC 4J7WA 1EPUA 4LG6A 3IHYA 5DIZA 3UINC 3CVUA 1KPSB 3SF4A 3TWRA 4J8DA 2EIJE 3MCXA 2VQ2A 3E30A 1N9AA 1N4QA 1E8YA 1HO8A 4N39A 2X6IA 4EZKA 3TWQA 1N4RA 4ILGA 4I9EA 3DSTA 4PH4B 2V4LA 2AJAA 4LRZA 3AG4E 3FWVA 2I6HA 5JHAA 3S7BA 3BU8A 3MKQB 3IV0A 4X8QA 1X5BA 4MS6A 5C1DA 2V5QC 2IU1A 3F6QA 4G1TA 1MHQA 3B7SA 3JYSA 5FT9A 2YHEA 3L6AA 3FTXA 3T9KA 4GU5A 1NI1A 2A5UA 3GZSA 1H19A 2PNNA 4RVBA 5AJDA 5CCLA 4KBQA 4R7LA 3CVVA 4KT6B 2XHEA 1RZ4A 1O1RA 2V0PA 4JA9A 4WWPA
chains in the Genus database with same CATH topology
5ITZF 2KXPC 4U95D 1YMPA 4K5BA 1MYOA 4DUIA 5CEAA 4GMRA 5ENPD 1YCSB 3ZKJA 4ATZD 2HE0A 5CECB 2P2CP 2XENA 1BI8B 3ZUVB 2JABA 3B95A 5ENSD 1MX2A 4A63B 5ENTD 4LSZE 1BLXB 2ZGDA 5D66A 3J5PA 5FIOA 4HI9A 1K1BA 4HRNA 2ETCA 4BEPA 3B7BA 3JXJA 4NIKA 4F6RD 4O60A 1IXVA 4Z68A 1D9SA 3KEAA 5AQBA 3NBNB 3TWTA 5ENOD 1IKND 1TR4A 5ENRD 2QYJA 4HQDA 1A5EA 2XZTG 5KWDA 4YDWA 1N0RA 2XZDG 4HBDA 4QQIA 4F1PA 3TWUA 5KBAA 4J7WA 5AN8A 1N11A 3UTMA 1BU9A 3T8KA 4BERA 5ENQD 1AWCB 5JA4D 4LG6A 4G8KA 3TWWA 3V2OA 1DC2A 3EU9A 1S70B 5EYPF 1IHBA 4HI8A 2BKGA 3Q9UC 4HNAD 4DRXE 2RFMA 4DX6D 1G3NB 5AQAA 1WG0A 2VGEA 3EHRA 5HS0A 3V31A 3TWRA 4BSZB 1MJ0A 2MYOA 4DX1A 5KNHD 4DX5D 4K5CA 1MX6A 1SVXA 1N0QA 1WDYA 5FINA 2DZOA 5HKPA 3V79K 2ZGGA 4G8LA 3DEOA 4ZHBA 5CBOA 3TWQA 2QC9A 3NOGD 1SW6A 2NYJA 4U96D 1BD8A 2RFAA 5CERB 1OT8A 2Y1LE 3TWXA 3NOCD 4CYMD 1OY3D 1DCQA 2ETBA 4O1PA 2AJAA 1YYHA 4BETA 2V4HC 4GPMA 4UUCA 5KNGA 4HB5A 5EIBE 2ETAA 1UOHA 2FO1E 4OAVB 4CZ2D 3W9FA 4LNUD 1QYMA 2A5EA 5EN5D 4JB8P 2XEEA 4YDYA 3ZU7B 2F37A 2V5QC 3J5QB 5EIDA 4HRMB 3UXGA 2BKKB 3D9HA 3V30A 5AQ7A 3F6QA 5BXOA 4U8YD 5EILA 5AQ9A 2Y0BG 2DVWA 2XEHA 4OAUC 2F8YA 4HLLA 4DX7D 3LJNA 5CEDB 3AJIA 3C5RA 3V2XA 3W9GA 1AP7A 5BXUA 5AARA 3T9KA 3JXIA 2F8XK 3TWVA 5HRYA 3UI2A 1K1AA 4TUMA 3HRAA 5JMND 1MX4A 3DEPA 4HRLA 4U8VD 3TWSA 2PNNA 2L6BA 2B0OE 2DZNA 3IXEA 3JUEA 2J8SD 1BI7B 4RLYA 3ZNGA 4DX2A 1NFIE 4O1OA 2DWZA 2KBXA 3AAAC 4C48B 4K5AB 3HG0D 4J8YA 3Q9NC 4QFVA 5EYLA 3SO8A 4B93B 4BESA 4ZFHA 5CBNA 4N5QA 3EHQA 1K3ZD 5AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITZ F;  2KXP C;  4U95 D;  1YMP A;  4K5B A;  1MYO A;  4DUI A;  5CEA A;  4GMR A;  5ENP D;  1YCS B;  3ZKJ A;  4ATZ D;  2HE0 A;  5CEC B;  2P2C P;  2XEN A;  1BI8 B;  3ZUV B;  2JAB A;  3B95 A;  5ENS D;  1MX2 A;  4A63 B;  5ENT D;  4LSZ E;  1BLX B;  2ZGD A;  5D66 A;  3J5P A;  5FIO A;  4HI9 A;  1K1B A;  4HRN A;  2ETC A;  4BEP A;  3B7B A;  3JXJ A;  4NIK A;  4F6R D;  4O60 A;  1IXV A;  4Z68 A;  1D9S A;  3KEA A;  5AQB A;  3NBN B;  3TWT A;  5ENO D;  1IKN D;  1TR4 A;  5ENR D;  2QYJ A;  4HQD A;  1A5E A;  2XZT G;  5KWD A;  4YDW A;  1N0R A;  2XZD G;  4HBD A;  4QQI A;  4F1P A;  3TWU A;  5KBA A;  4J7W A;  5AN8 A;  1N11 A;  3UTM A;  1BU9 A;  3T8K A;  4BER A;  5ENQ D;  1AWC B;  5JA4 D;  4LG6 A;  4G8K A;  3TWW A;  3V2O A;  1DC2 A;  3EU9 A;  1S70 B;  5EYP F;  1IHB A;  4HI8 A;  2BKG A;  3Q9U C;  4HNA D;  4DRX E;  2RFM A;  4DX6 D;  1G3N B;  5AQA A;  1WG0 A;  2VGE A;  3EHR A;  5HS0 A;  3V31 A;  3TWR A;  4BSZ B;  1MJ0 A;  2MYO A;  4DX1 A;  5KNH D;  4DX5 D;  4K5C A;  1MX6 A;  1SVX A;  1N0Q A;  1WDY A;  5FIN A;  2DZO A;  5HKP A;  3V79 K;  2ZGG A;  4G8L A;  3DEO A;  4ZHB A;  5CBO A;  3TWQ A;  2QC9 A;  3NOG D;  1SW6 A;  2NYJ A;  4U96 D;  1BD8 A;  2RFA A;  5CER B;  1OT8 A;  2Y1L E;  3TWX A;  3NOC D;  4CYM D;  1OY3 D;  1DCQ A;  2ETB A;  4O1P A;  2AJA A;  1YYH A;  4BET A;  2V4H C;  4GPM A;  4UUC A;  5KNG A;  4HB5 A;  5EIB E;  2ETA A;  1UOH A;  2FO1 E;  4OAV B;  4CZ2 D;  3W9F A;  4LNU D;  1QYM A;  2A5E A;  5EN5 D;  4JB8 P;  2XEE A;  4YDY A;  3ZU7 B;  2F37 A;  2V5Q C;  3J5Q B;  5EID A;  4HRM B;  3UXG A;  2BKK B;  3D9H A;  3V30 A;  5AQ7 A;  3F6Q A;  5BXO A;  4U8Y D;  5EIL A;  5AQ9 A;  2Y0B G;  2DVW A;  2XEH A;  4OAU C;  2F8Y A;  4HLL A;  4DX7 D;  3LJN A;  5CED B;  3AJI A;  3C5R A;  3V2X A;  3W9G A;  1AP7 A;  5BXU A;  5AAR A;  3T9K A;  3JXI A;  2F8X K;  3TWV A;  5HRY A;  3UI2 A;  1K1A A;  4TUM A;  3HRA A;  5JMN D;  1MX4 A;  3DEP A;  4HRL A;  4U8V D;  3TWS A;  2PNN A;  2L6B A;  2B0O E;  2DZN A;  3IXE A;  3JUE A;  2J8S D;  1BI7 B;  4RLY A;  3ZNG A;  4DX2 A;  1NFI E;  4O1O A;  2DWZ A;  2KBX A;  3AAA C;  4C48 B;  4K5A B;  3HG0 D;  4J8Y A;  3Q9N C;  4QFV A;  5EYL A;  3SO8 A;  4B93 B;  4BES A;  4ZFH A;  5CBN A;  4N5Q A;  3EHQ A;  1K3Z D;  5AAO A; 
#chains in the Genus database with same CATH topology
 5ITZ F;  1YMP A;  2C2L A;  2LNI A;  3PEU B;  2IFU A;  3FUN A;  3UM0 A;  4FUL A;  4UI9 C;  3CHO A;  4KXK B;  1DCE A;  4A3V A;  3JXJ A;  2WXF A;  4LNB A;  3NF1 A;  1TR4 A;  4AVX A;  2QYJ A;  4HQD A;  4YDW A;  4HOS A;  4K03 A;  2CHX A;  2PQN A;  3QB2 A;  3UMV A;  3EHN A;  4Q96 A;  3T8M A;  4ANW A;  4AJW A;  4GZD A;  3ISM C;  1Z6T A;  2ZGG A;  3MKQ A;  2QC9 A;  1B89 A;  1BD8 A;  3NB2 A;  3UKU G;  4XI9 A;  5EIB E;  2IY0 C;  4XZ4 A;  1N54 A;  2FO1 E;  3TG5 A;  3AU5 A;  3FTU A;  1S63 A;  1H2U A;  1JCR A;  5BXO A;  1FPP A;  3MA5 A;  3Q5M A;  4U7E B;  2XQ0 A;  1O1T A;  1DVP A;  3V2X A;  3ASF A;  5AAR A;  2CFZ A;  2DCP A;  2I1K A;  1P5Q A;  2VSN A;  3EUV A;  4G2V A;  4DX2 A;  3FEY A;  1BI7 B;  4DLQ A;  5EX0 A;  3Q4A B;  4GA1 A;  3FTV A;  4C48 B;  3FEX A;  4J8Y A;  5CRU A;  4BES A;  3RJV A;  4EPZ A;  3D9J A;  4U0Z A;  5DBK A;  4ANU A;  4ATZ D;  4M3O A;  3HHM A;  3BUA A;  3G2W A;  4F53 A;  4UI9 J;  5AIJ A;  3C3R A;  4BTB A;  3CHS A;  2WXJ A;  3SQV A;  3HYM B;  3J5P A;  4DPR A;  4HLE A;  3G2S A;  3TXM A;  4RG9 A;  1TN6 A;  3GYZ A;  3PZ1 A;  4FJZ A;  3IEG A;  4HBD A;  3BG0 B;  3LCA A;  1E8W A;  4F1P A;  1BU9 A;  3GW4 A;  4GA2 A;  3L17 A;  1IHB A;  4HI8 A;  1IYG A;  3FTZ A;  1G3N B;  1ELW A;  3E4B A;  1QNF A;  3SHF A;  4G24 A;  2P9K G;  3ASD A;  1OWP A;  3LY8 A;  4UWL A;  4UWH A;  3APD A;  3CR3 A;  3RRM B;  2LXM A;  2P9U G;  5FQ4 A;  4CZ2 D;  4AV7 A;  3X2Q E;  5D0O D;  4DK5 A;  5EN5 D;  2XEE A;  3B13 A;  4GTS A;  3UXG A;  2IOL A;  3SBT B;  3R7Q A;  2CG3 A;  4H7Y A;  4F7A A;  1KZO A;  3JUI A;  2WMN A;  2B0O E;  3UPV A;  4XI0 A;  5KJN A;  3B7R L;  4K5A B;  3FUE A;  2ZU6 B;  2VJ8 A;  2HR2 A;  1S64 A;  2RKK A;  2XEN A;  1KZP A;  3ABL E;  2IF4 A;  3B95 A;  2YIN A;  3QDN A;  4OYS A;  4APF A;  3ASO E;  5KCM A;  4YDE A;  3UX4 A;  2XCC A;  3Q79 A;  5FZR A;  1Z5S C;  3Q78 A;  3UM2 A;  1QZ2 A;  4H7X A;  3T8K A;  5JA4 D;  2OVB A;  4XIF A;  3TWW A;  4G26 A;  4DX6 D;  2VGE A;  3I5P A;  4I2Z A;  3T5V A;  3CVX A;  4PS8 A;  3IHV A;  1E7V A;  1MX6 A;  1SVX A;  3ML9 A;  4TV3 A;  2WMO A;  3UQ3 A;  5G04 C;  5E75 A;  3PZ4 A;  3PUJ A;  3D9K A;  2YHC A;  3RKV A;  3NOC D;  1DCQ A;  2BED A;  1TNO A;  2ETA A;  5AYW D;  2Y4U A;  3W9F A;  3D9O A;  3ZRH A;  3SD5 A;  4AEZ C;  2L0T B;  3D9H A;  4JEU A;  4GTV A;  3Q75 A;  4JVS A;  3SGH A;  2VYI A;  3ZFW A;  1OCR E;  1TN7 A;  3FU5 A;  4EBA A;  4ILH B;  2CG2 A;  2EIL E;  3GZ2 A;  3WXX A;  3PRE A;  4FHK A;  3FU3 A;  4A55 A;  3AG1 E;  2DWZ A;  3U64 A;  5EYL A;  4TRQ A;  2DBA A;  4CYM D;  3I3N A;  3ESK A;  3P2B A;  2ZIS A;  2JAB A;  3FUJ A;  1N4P A;  4A63 B;  1BLX B;  2LXL A;  2E2E A;  1V55 E;  4I6J A;  2LO6 A;  3ZN3 A;  1N94 A;  5JJT A;  5BPP A;  1TNY A;  2H6G A;  2RD0 A;  2ZXW E;  4U63 A;  4CRW A;  4NUR A;  3SFZ A;  3CVY A;  3E33 A;  3CVP A;  4L7T A;  3ZGQ A;  3NOG D;  4Y6W A;  5FJY A;  1OT8 A;  3FHE A;  4ME2 A;  4HOT A;  3TGO A;  2BUG A;  5T3R A;  3DSV A;  3AS8 A;  4LCT A;  5EDS A;  4YDY A;  3P1U A;  4RQI A;  2DYR E;  3VTY A;  5CED B;  3VTX A;  3AJI A;  1O1S A;  3MZL B;  3JXI A;  3G2U A;  5ARF A;  3LJ3 A;  4OVV A;  3B7U X;  4D10 C;  2MRI A;  2L6B A;  4BWR A;  3FUD A;  4JD2 G;  3S7J A;  2WXG A;  5J90 A;  2VGX A;  3ZW3 A;  2H6F A;  1OWM A;  3FY4 A;  3CGH A;  4GZC A;  4FLH A;  4L2L A;  1U3C A;  1IKN D;  2J49 A;  1A5E A;  4HOR A;  3C98 A;  1H6P A;  3D9I A;  1JWG A;  5E76 A;  3SFY A;  3V2O A;  3FTW A;  4ILI A;  3AU4 A;  1N52 A;  3FU6 A;  4IUL A;  1SA5 A;  1TJC A;  2X38 A;  3OAW A;  4GA0 A;  1WDY A;  3UIP C;  1TYQ G;  3EIJ A;  1JPL A;  2J09 A;  4BSX A;  1UW4 B;  2C0M A;  2V4H C;  4BX8 A;  2QZA A;  3FUH A;  1QYM A;  2CHW A;  1NP7 A;  3BG1 B;  3L9T A;  2R17 C;  3LPZ A;  2DVW A;  2X6F A;  3LJN A;  5HQ8 A;  4I6G A;  1OWO A;  3W9G A;  3S2A A;  4JEH A;  2LSV A;  3FTS A;  4JC8 A;  3D3M A;  4TXP A;  4TXQ A;  1EYH A;  2XS8 A;  1V54 E;  2XCB A;  3N71 A;  2GGF A;  3L08 A;  5BW8 C;  4FAD A;  2CFU A;  1RW2 A;  5BT1 A;  4QFV A;  3CV0 A;  3UT7 A;  2KXP C;  1LD8 A;  5ENS D;  3LVR E;  2BF0 X;  2ZGD A;  4YVO A;  2WXR A;  3OTN A;  1ELR A;  2J9Q A;  3TWT A;  5ENR D;  1D8E A;  4TUU A;  5JJ7 A;  3URZ A;  1PAQ A;  3BEE A;  4QQI A;  5ENQ D;  3D9N A;  4WAF A;  3Q9U C;  4J8F A;  3R7R A;  3ZYK A;  4BSZ B;  2ION A;  1FVF A;  1HX8 A;  4K5C A;  2LAI A;  3HDX A;  5LX8 A;  4CDM A;  1XGW A;  4UQZ A;  4L2Y A;  2Y1L E;  1HE8 A;  2FO7 A;  2AW6 A;  3LY7 A;  4I2W A;  2GRO B;  4IRU A;  4F1S A;  4I1A A;  2P9S G;  5CMY A;  2F37 A;  4N3C A;  4HRM B;  2FF4 A;  4U8Y D;  3PZ2 A;  4C0M A;  1LTX A;  3U4T A;  3VLE A;  3FUL A;  5CHE E;  4I1O B;  3DXM G;  4B89 A;  4AXH A;  2PZI A;  2V8S E;  4GAA A;  4HRL A;  3FFL A;  2AXV A;  4V3I A;  3IBE A;  3CQC B;  4ATG A;  4MLP A;  4EHM A;  2KBX A;  4NRH B;  4FHJ A;  2GRN B;  3SO8 A;  1OWL A;  5CBN A;  1NZN A;  3CHM A;  4WNG A;  3PDN A;  4F3V A;  2MOW A;  1JCS A;  4LNG A;  5B1B E;  3ZYM A;  3ULY A;  2YNQ A;  4BT9 A;  4GMR A;  5ARG A;  3FUM A;  3QWW A;  2WM9 A;  3ZUV B;  1IHG A;  4FP7 A;  4J8E A;  4HFG A;  4DI4 A;  1DNP A;  2R05 A;  1Z3X A;  2LSU A;  4LUN U;  3RU0 A;  4O60 A;  2J4D A;  2XEV A;  3Q47 B;  2P9P G;  2H6H A;  4OVU A;  1NL4 A;  2KCL A;  3UTM A;  1GW6 A;  2QFC A;  4HNA D;  4G11 A;  4PUC A;  3QWV A;  3QAR A;  5FTP A;  3L16 A;  1JWF A;  4DX1 A;  2J08 A;  1WAO 1;  5FIN A;  4GML A;  5G05 C;  1SW6 A;  1HF8 A;  1E96 B;  1ZBP A;  3ONL A;  3CK7 A;  3RRN B;  1N4S A;  5KNG A;  2OEV A;  4B8A A;  4RG6 A;  3FH5 A;  4ACL A;  1H2T C;  4U0U A;  4GYY A;  4L1B A;  3PS6 A;  2OVF A;  2GRL A;  4KZ0 A;  1U3D A;  2DYS E;  2Y0B G;  3OXF A;  3PEV B;  2PQR A;  3MKR A;  4E6H A;  3CHQ A;  2KZT B;  1MZC A;  4BX9 A;  2P9I G;  3S7D A;  4WWO A;  5HRY A;  1TNU A;  3FP3 A;  1KLX A;  5BUZ A;  4GYW A;  4UWF A;  3GZ1 A;  3FH7 A;  4KZC A;  3Q9N C;  2Y3A A;  2GW1 A;  4N5Q A;  5LCW C;  1H0A A;  3NZU A;  5ENP D;  4BFR A;  4K0R A;  2GRQ B;  4CT4 A;  3I4R B;  2P2C P;  3JCK C;  1PC2 A;  3DSX A;  2AXZ A;  5FQ6 A;  4JPS A;  1HH8 A;  2KCK A;  3B7B A;  4NIK A;  3D9M A;  4WNF A;  1D9S A;  3QNK A;  3HIZ A;  1N0R A;  3PE4 A;  5C2Y A;  3CLJ A;  4G23 A;  2V5F A;  3QKY A;  4YVQ C;  4ACK A;  3DXK G;  5EYP F;  4GPK A;  2R59 A;  2BKG A;  1WG0 A;  3TJP A;  1KT0 A;  1FCH A;  2IQC A;  4WNE A;  3HXC A;  5JJ6 A;  4GMJ A;  1N0Q A;  4U04 A;  1JUQ A;  5CER B;  3SNX A;  3CK8 A;  3DSU A;  2WXQ A;  2LAH A;  4LNU D;  4Q94 A;  2KZT A;  4JB8 P;  1W3B A;  2BKK B;  3LDZ A;  4CEM A;  1HXI A;  3FUK A;  2AXU A;  2IOS A;  4C9B B;  3FUF A;  4RLY A;  4L23 A;  3JQ0 A;  1TEZ A;  4B93 B;  3R9A B;  4YDO A;  3Q15 A;  2FEZ A;  1E7U A;  3DPY A;  4MKT A;  3U66 A;  3D9L A;  3LY9 A;  3QOU A;  4LSZ E;  2ETC A;  3PNL B;  1JCQ A;  3NBN B;  1QQE A;  4DLO A;  1Y8M A;  1N95 A;  2OND A;  2OCC E;  4FJY A;  4J8S A;  4BER A;  2WXK A;  1VDY A;  3ZPJ A;  4G8K A;  4AP2 A;  5B1A E;  5A7D B;  5IY5 E;  4DRX E;  5AJL A;  2RFM A;  3FH8 A;  5HS0 A;  2VSX E;  3APF A;  2MYO A;  3MYV A;  5T8I A;  4FA6 A;  2VGX B;  4U07 A;  4MBG A;  2X3M A;  5HKP A;  4I9C A;  3L82 A;  3R9M A;  3QWP A;  5CBO A;  5FZQ A;  1XNF A;  3KD7 A;  2NYJ A;  2RFA A;  1WM5 A;  1INZ A;  4GPM A;  2A5E A;  3ENE A;  3DSW A;  5LP0 A;  3EDT B;  2JEK A;  3DSS A;  5D0Q D;  3HXB A;  3RK6 A;  5G04 J;  4AM9 A;  2QYU A;  4B0Z A;  4EEC A;  3C72 A;  1Z3Y A;  4GB9 A;  5J08 A;  4GCO A;  3DEP A;  5T4Y A;  2VSO E;  3CSF A;  3JUE A;  4GZ5 A;  4XX5 A;  2GRR B;  5AAO A;  3CK9 A;  2XPY A;  5JHB A;  2KAT A;  4J0U A;  3E32 A;  3K9I A;  1Q2Z A;  3C3O A;  1E90 A;  3PZD A;  4N3B A;  5D66 A;  3L13 A;  2IEJ A;  1K1B A;  4BEP A;  4HS2 A;  1OCC E;  3SI5 A;  3LXU X;  5CCM A;  2XRZ A;  5KWD A;  1PY1 A;  3UT8 A;  3PVL A;  2XPZ A;  4EZL A;  4ABN A;  5ANL A;  4AIF A;  1EF1 C;  2I1J A;  3IKO B;  2I2O A;  5AQA A;  3EHR A;  1OXJ A;  4CCA A;  5KJK A;  3KS2 A;  1D8D A;  4IN3 B;  2J07 A;  4I6E A;  2P9L G;  4GCN A;  3AS4 A;  3Q7A A;  2KCV A;  4B8C B;  3V79 K;  4ZHB A;  4XE0 A;  1KT1 A;  4JL0 A;  1OY3 D;  3WG7 E;  1YYH A;  2L0I A;  4UUC A;  3D9P A;  1IQR A;  3ML8 A;  2BTD A;  3AG3 E;  4UQX A;  5EIL A;  5AQ9 A;  2ZIR A;  3ZHE B;  4APO A;  3TG4 A;  4OAU C;  2F8Y A;  3MV3 B;  4BY6 A;  4GTM A;  1SZ9 A;  2GRP B;  3DPD A;  2A4Z A;  1K1A A;  1ELK A;  1OCZ E;  3FUI A;  3CKB A;  3IXE A;  5FZS A;  2AVP A;  3AAA C;  1H6K A;  4HVB A;  3G2T A;  4UWG A;  5KBA A;  2WQ7 A;  2RG8 A;  2WVI A;  2Q7F A;  2ILR A;  5KJL A;  3CVL A;  2AWI A;  3MGB A;  3ZKJ A;  2HYZ A;  3BQO A;  3MJW A;  4FLB A;  4A1G A;  4A3T A;  3UM1 A;  3C3Q A;  5BV1 A;  5FQ8 A;  2EIM E;  4I1M A;  4JA7 A;  3AS5 A;  3CVQ A;  1S0P A;  3CHR A;  3CVW A;  2M63 A;  2X6J A;  4JHK A;  2WXO A;  1DC2 A;  4ANX A;  2X6H A;  1A17 A;  3ABM E;  4WUY A;  4U8H A;  3UM3 A;  3MEK A;  3ZXS A;  3DEO A;  1E8Z A;  3G2V A;  4O6F A;  2WB2 A;  5EKQ D;  3ZHE A;  4CGW A;  3CQG B;  4BT8 A;  1HG2 A;  1Y6I A;  1FVH A;  4AY5 A;  4TXR A;  4GZ6 A;  3T5X A;  3KSL A;  2IJG X;  3HXF A;  4GZ3 A;  2XRY A;  1AP7 A;  2F8X K;  1SQM A;  1UJJ A;  1YA0 A;  4JW1 A;  5EX3 A;  3EU5 A;  5G2N A;  1QBQ A;  2R03 A;  4A1S A;  4O1O A;  2HO1 A;  2WQH A;  4GTR A;  1HG5 A;  1ZB1 A;  4UWK A;  1UN8 A;  5LOZ A;  4UI9 K;  4U95 D;  4C0E A;  4K5B A;  3PH0 C;  5CEA A;  3S7F A;  2HE0 A;  4U0S A;  3UUX A;  3SFX A;  3L22 A;  4WND A;  2WXL A;  1K8K G;  2L6J A;  2X6K A;  4GTP A;  5FIO A;  1U2V G;  4HOQ A;  4HRN A;  2F0Y A;  2WPV A;  1IXV A;  3KEA A;  3ASG A;  2J4B A;  3RSE G;  1WY6 A;  3FDH A;  4JZY A;  4KVM A;  4CDR A;  5FQ7 A;  2IO3 C;  3EU9 A;  1NA0 A;  1LD7 A;  4KVO A;  2PM7 A;  4CT0 A;  3KEZ A;  2DZO A;  3HXD A;  2I9C A;  2OEW A;  3LVQ E;  3TWX A;  4AOF A;  3UKR G;  3E37 A;  5BNW A;  2HM8 A;  3ASN E;  2CHZ A;  3VLD A;  2C0L A;  5AQ7 A;  5HI7 A;  3UIO C;  2XEH A;  2YQ8 A;  3CVN A;  3HXE A;  2E0I A;  4U8V D;  2Y4T A;  2EIN E;  2J8S D;  3EHM A;  3QJZ A;  4I43 A;  4EQF A;  2NC9 A;  4ZFH A;  4JXT A;  2KC7 A;  4N2Q A;  3EHQ A;  1H6O A;  3QC1 A;  3ZEF A;  2Y69 E;  1YCS B;  5CEC B;  3OXL A;  3CIA A;  5FWQ A;  2R2L A;  1TJF A;  4GTO A;  4HI9 A;  4CGV A;  4PS7 A;  5AQB A;  1TN8 A;  5ENO D;  5G55 A;  3E34 A;  3TWU A;  5AN8 A;  1HZ4 A;  4GYO A;  3NZS A;  3FTY A;  3L54 A;  1S70 B;  5CMW A;  3ONK A;  3HVE B;  3ZIM A;  3JQ1 A;  2FI7 A;  3KSQ A;  3ZXP A;  3CHP A;  4FU3 A;  3RO3 A;  2OV8 A;  2FUL A;  2NSZ A;  1EDU A;  4CDN A;  3EJN A;  3UT4 A;  5A23 A;  2UWJ G;  4O1P A;  5AEN A;  1BPO A;  4DI3 A;  4HB5 A;  3ZVV A;  3CST A;  5EID A;  4B94 A;  1UN9 A;  4NAC A;  2VTB B;  2GRM A;  4XEI G;  2FBN A;  2WQ6 A;  5G05 J;  2B6C A;  4NQ0 A;  4PDX A;  1O5M A;  2LUH A;  4KMO A;  4L9P A;  2XGS A;  4YND A;  3LS8 A;  5ENN A;  2MHK A;  2WXP A;  3DBS A;  3ESL A;  3QAQ A;  3ULE G;  2P9N G;  3NAW A;  4W9R A;  4DJA A;  5ANR A;  2VSY A;  3DRA A;  4PS3 A;  5ENT D;  1FT2 A;  2XGO A;  3RAU A;  3CKC A;  2XS1 A;  3HVE A;  4BTA A;  1E8X A;  2R02 A;  5LCW J;  1OWN A;  1AWC B;  2PL2 A;  4Y6C A;  3V31 A;  4HOU A;  3LEW A;  2JLB A;  4ANV A;  4J6I A;  4JHR A;  4P29 A;  3SZ7 A;  5LFA A;  1SZA A;  4JHJ A;  4G8L A;  3O4Z A;  1OUV A;  3I4G A;  3B7T A;  3KAE A;  3MX3 A;  3SBS A;  4N2S A;  2VTB A;  4OAV B;  2KM4 A;  3ZU7 B;  4N5C A;  2DIW A;  3ABK E;  4FC8 A;  3PRZ A;  5BV0 A;  4M7C A;  4DX7 D;  3C5R A;  3TAX A;  4Q69 A;  3MV2 B;  3Q49 B;  3UI2 A;  3HRA A;  1MX4 A;  4E85 A;  3PZ3 A;  4XKB A;  2WXM A;  3NQP A;  4GTT A;  3ZNG A;  1FT1 A;  3HG0 D;  3RRU A;  2L9B A;  3Q73 A;  1MQS A;  3U9W A;  1MYO A;  4DUI A;  4WWN A;  2PM6 A;  2H6I A;  4EZJ A;  1BI8 B;  5B3S E;  2VGY A;  1UG3 A;  3VLF A;  1UJK A;  4UQY A;  5H7P A;  2IO2 C;  4F6R D;  2NXP A;  4Z68 A;  2UY1 B;  1IQU A;  2XZT G;  2XGM A;  2XPI A;  2XZD G;  1N11 A;  3FU0 A;  3Q7F A;  3QK0 A;  2QY7 A;  1LF8 A;  3ZYQ A;  3ASH A;  3EIQ C;  3RIB A;  2WXH A;  4HXI A;  3RO2 A;  4MRU A;  3PNT B;  4N3A A;  1MJ0 A;  1ZU2 A;  1SA4 A;  3U3W A;  4AY6 A;  4DX5 D;  5KNH D;  1HU3 A;  3OXG A;  4URK A;  5D2M C;  4U96 D;  2P58 C;  3ZYL A;  2R5S A;  2WXN A;  2EIK E;  2ETB A;  4BET A;  4I17 A;  5M72 A;  1UOH A;  4KYO B;  3J5Q B;  3V30 A;  3LYA A;  4XKC A;  1HFA A;  4LEU A;  4HLL A;  2OOE A;  5BXU A;  4RSY A;  3TWV A;  3TL5 A;  4TUM A;  5JMN D;  3TWS A;  5CRV A;  1X81 A;  4G25 A;  4LER A;  5KJM A;  1TNZ A;  2DZN A;  3DWL G;  1NFI E;  4GTQ A;  2EQX A;  3ULQ A;  1K3Z D;  4EBA G;  2WXI A;  5A6C A;  3O48 A;  3AG2 E;  1NA3 A;  3LKU A;  1L5J A;  3APC A;  2UY1 A;  3TXN A;  1TNB A;  3CEQ A;  1MX2 A;  3PE3 A;  1OCO E;  3SY2 A;  1HS6 A;  4IYP A;  3PUK A;  1H2V C;  4J7W A;  1EPU A;  4LG6 A;  3IHY A;  5DIZ A;  3UIN C;  3CVU A;  1KPS B;  3SF4 A;  3TWR A;  4J8D A;  2EIJ E;  3MCX A;  2VQ2 A;  3E30 A;  1N9A A;  1N4Q A;  1E8Y A;  1HO8 A;  4N39 A;  2X6I A;  4EZK A;  3TWQ A;  1N4R A;  4ILG A;  4I9E A;  3DST A;  4PH4 B;  2V4L A;  2AJA A;  4LRZ A;  3AG4 E;  3FWV A;  2I6H A;  5JHA A;  3S7B A;  3BU8 A;  3MKQ B;  3IV0 A;  4X8Q A;  1X5B A;  4MS6 A;  5C1D A;  2V5Q C;  2IU1 A;  3F6Q A;  4G1T A;  1MHQ A;  3B7S A;  3JYS A;  5FT9 A;  2YHE A;  3L6A A;  3FTX A;  3T9K A;  4GU5 A;  1NI1 A;  2A5U A;  3GZS A;  1H19 A;  2PNN A;  4RVB A;  5AJD A;  5CCL A;  4KBQ A;  4R7L A;  3CVV A;  4KT6 B;  2XHE A;  1RZ4 A;  1O1R A;  2V0P A;  4JA9 A;  4WWP A; 
#chains in the Genus database with same CATH homology
 5ITZ F;  2KXP C;  4U95 D;  1YMP A;  4K5B A;  1MYO A;  4DUI A;  5CEA A;  4GMR A;  5ENP D;  1YCS B;  3ZKJ A;  4ATZ D;  2HE0 A;  5CEC B;  2P2C P;  2XEN A;  1BI8 B;  3ZUV B;  2JAB A;  3B95 A;  5ENS D;  1MX2 A;  4A63 B;  5ENT D;  4LSZ E;  1BLX B;  2ZGD A;  5D66 A;  3J5P A;  5FIO A;  4HI9 A;  1K1B A;  4HRN A;  2ETC A;  4BEP A;  3B7B A;  3JXJ A;  4NIK A;  4F6R D;  4O60 A;  1IXV A;  4Z68 A;  1D9S A;  3KEA A;  5AQB A;  3NBN B;  3TWT A;  5ENO D;  1IKN D;  1TR4 A;  5ENR D;  2QYJ A;  4HQD A;  1A5E A;  2XZT G;  5KWD A;  4YDW A;  1N0R A;  2XZD G;  4HBD A;  4QQI A;  4F1P A;  3TWU A;  5KBA A;  4J7W A;  5AN8 A;  1N11 A;  3UTM A;  1BU9 A;  3T8K A;  4BER A;  5ENQ D;  1AWC B;  5JA4 D;  4LG6 A;  4G8K A;  3TWW A;  3V2O A;  1DC2 A;  3EU9 A;  1S70 B;  5EYP F;  1IHB A;  4HI8 A;  2BKG A;  3Q9U C;  4HNA D;  4DRX E;  2RFM A;  4DX6 D;  1G3N B;  5AQA A;  1WG0 A;  2VGE A;  3EHR A;  5HS0 A;  3V31 A;  3TWR A;  4BSZ B;  1MJ0 A;  2MYO A;  4DX1 A;  5KNH D;  4DX5 D;  4K5C A;  1MX6 A;  1SVX A;  1N0Q A;  1WDY A;  5FIN A;  2DZO A;  5HKP A;  3V79 K;  2ZGG A;  4G8L A;  3DEO A;  4ZHB A;  5CBO A;  3TWQ A;  2QC9 A;  3NOG D;  1SW6 A;  2NYJ A;  4U96 D;  1BD8 A;  2RFA A;  5CER B;  1OT8 A;  2Y1L E;  3TWX A;  3NOC D;  4CYM D;  1OY3 D;  1DCQ A;  2ETB A;  4O1P A;  2AJA A;  1YYH A;  4BET A;  2V4H C;  4GPM A;  4UUC A;  5KNG A;  4HB5 A;  5EIB E;  2ETA A;  1UOH A;  2FO1 E;  4OAV B;  4CZ2 D;  3W9F A;  4LNU D;  1QYM A;  2A5E A;  5EN5 D;  4JB8 P;  2XEE A;  4YDY A;  3ZU7 B;  2F37 A;  2V5Q C;  3J5Q B;  5EID A;  4HRM B;  3UXG A;  2BKK B;  3D9H A;  3V30 A;  5AQ7 A;  3F6Q A;  5BXO A;  4U8Y D;  5EIL A;  5AQ9 A;  2Y0B G;  2DVW A;  2XEH A;  4OAU C;  2F8Y A;  4HLL A;  4DX7 D;  3LJN A;  5CED B;  3AJI A;  3C5R A;  3V2X A;  3W9G A;  1AP7 A;  5BXU A;  5AAR A;  3T9K A;  3JXI A;  2F8X K;  3TWV A;  5HRY A;  3UI2 A;  1K1A A;  4TUM A;  3HRA A;  5JMN D;  1MX4 A;  3DEP A;  4HRL A;  4U8V D;  3TWS A;  2PNN A;  2L6B A;  2B0O E;  2DZN A;  3IXE A;  3JUE A;  2J8S D;  1BI7 B;  4RLY A;  3ZNG A;  4DX2 A;  1NFI E;  4O1O A;  2DWZ A;  2KBX A;  3AAA C;  4C48 B;  4K5A B;  3HG0 D;  4J8Y A;  3Q9N C;  4QFV A;  5EYL A;  3SO8 A;  4B93 B;  4BES A;  4ZFH A;  5CBN A;  4N5Q A;  3EHQ A;  1K3Z D;  5AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...