5C13A

Crystal structure of taf3 phd finger bound to histone h3c4me3 peptide
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
MYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Jarid1a PHD finger bound to histone H3C4me3 peptide
rcsb
molecule keywords Transcription initiation factor TFIID subunit 3
molecule tags Hydrolase
source organism Homo sapiens
total genus 8
structure length 59
sequence length 59
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5c13A00
2G43A 4B86C 3LQHA 3EB6A 4ZQLA 4N3WA 2YSMA 2CKLB 2KREA 2YQLA 3DPLR 2OXQC 3MHHA 1RMDA 4YATA 5D1KB 3RTRB 2PNXA 5G0FA 2K4DA 1HYJA 4S3OB 2VJFB 4YAXA 3IHPA 2KWKA 2ZETC 3RPGB 3MHSA 2LGLA 2YURA 2FSAA 2YHOA 5I3LA 2HDPA 2LRIC 3EB5A 3KQIA 4BBQA 4B7YC 5B76A 4I7DA 3N9LA 1WESA 4O64A 3N9MA 3LRQA 2EA6A 2ECNA 5TDWA 4YABA 3O7AA 2JMIA 5KH7A 4FJCA 2LXPC 3PUQA 3ASLA 2LV9A 2G6QA 1JM7A 4CA1A 4R2YA 4X3GA 2VPGA 4XI1A 3ZVYA 2VJEB 1VD4A 3GV4A 4TKPB 2LGKA 1DVPA 2L0BA 3U5PA 2F6JA 3KV6A 3HTKC 3L1ZB 4FIPA 3T7LA 2CT2A 3L11A 3ZPVE 4V3LC 4L58A 2L43A 4YADA 1X4UA 3N9NA 2E6RA 4A49A 2EODA 5TRBA 5AIUA 3L1XA 5LCWB 4YBSA 3GL6A 2MT5A 3O33A 2LGGA 2Y1NA 2IDAA 2JRJA 2KWOA 5D1MB 4AUQB 3LQIA 1N87A 2L5UA 2LXHC 2MIQA 1WILA 5B77A 2MNYA 4LLBA 3LQJA 2L80A 2M85A 2MA5A 2ECVA 4GNEA 5KH3A 2MA6A 2VPEA 4QF3A 2AN6A 3SOWA 3HCSA 2FUUA 4W4UA 1WFKA 4R7EA 2YQMA 3C5KA 4IC2A 3T6RA 2EGPA 4ZDTA 2XB1A 1WEWA 4NN2A 1FBVA 5FB0A 3SOUA 2F42A 4LJNA 2KFTA 1F62A 1G25A 3N9PA 4L7XA 2LGVA 5JG6A 3VK6A 2KGIA 1WEMA 4AVXA 5FEYA 5TDRA 4GNDA 3ZPV1 3I2DA 2KGGA 4MVTA 1VFYA 2CSZA 1MM3A 1WEPA 2ECJA 5B8DA 2PUYA 4P5OB 2M6MA 2RSDA 4BHWA 1U6GB 4S3OC 1JM7B 2L75A 2Y1MA 4YBMA 2FUIA 3RPGC 1JOCA 3M62A 2YHNA 4FO9A 2QICA 1WGMA 4LADB 1K2FA 2NAAA 4N4FA 1T1HA 1WEEA 5AITA 3HCTA 3ZVZB 2VPBA 5J3XA 1V87A 2MD7B 1WEVA 2VP7A 2LDRA 3U5NA 4ZUXU 4AYCA 1MM2A 4GNGA 4AYCB 5EYAF 2D8SA 3QZVA 2LN0A 2VNFA 1WE9A 5DINA 2QIZA 4F52B 3SHBA 4Q6FA 3PURA 3KV5A 2JMJA 2I50A 5TABA 4A4BA 2YYRA 3O70A 5G05B 4FK5A 1BORA 1FP0A 2HYED 4PTBA 1LDJB 4WA6A 2ECIA 4I7CA 3V43A 3U5OA 2CKLA 5C11A 4CCGX 2BAYA 1IYMA 5TBNA 2YSJA 3M99A 5KH9A 2MUMA 2ECWA 1X4JA 2C2LA 3PHDA 2KWNA 2KU3A 2QJ0A 2YUCA 2Y43A 1WEQA 3C6WA 2K17A 1WENA 3DQVR 2KWJA 1Z2QA 3FL2A 2ECGA 5DKAA 2VJFA 2LQ6A 2UZGA 5H9MA 5LKXA 2K16A 4YC9A 2XEUA 5LKZA 4PPEA 1WIMA 1VYXA 1Z60A 2KYUA 3O37A 2YT5A 1WEUA 2H0DA 2KIZA 2YU4A 5LKUA 5B78A 2H0DB 4UP5A 3N9QA 2ECTA 5B79A 1Z6UA 3O36A 2E6SA 4WZ0A 2M3HA 3M63A 5B75A 5H1TA 2MNZA 4A0CD 4GNFA 2VPDA 4UI9B 2KE1A 4LKAA 1CHCA 4V3KC 2CSYA 4IC3A 4C9ZA 1E4UA 4I7BA 3N9OA 2JMDA 4AP4A 2VJEA 2MD8C 2G45A 2K1JA 1ZBDB 3NG2A 5C13A 5H1VA 3HCUA 2C2VS 2DX8A 3ZNIA 1XWHA 5G04B 3KNVA 2KR4A 4WZ3B 4GB0A 4QF2A 4A4CA 3O35A 5H1UA 4UP0A 4YBTA 2M1RA 2RI7A 3U5MA 5FERA 3SOXA 4R8PK 3ZTGA 2YREA 5FB1A 2F6NA 1X4IA 4WZ2A 2YW8A 3ZYQA 1HYIA 4LK9A 4MSXA 3O34A 5LKTA 5D1LB 1LDKC 1WEOA
chains in the Genus database with same CATH superfamily
2G43A 4B86C 3LQHA 3EB6A 4ZQLA 4N3WA 2YSMA 2CKLB 2KREA 2YQLA 3DPLR 2OXQC 2YVRA 3MHHA 1RMDA 4YATA 5D1KB 3RTRB 2PNXA 5G0FA 2K4DA 3T9KA 1HYJA 4S3OB 2JM3A 2VJFB 3E2DA 4YAXA 3IHPA 2KWKA 2ZETC 3RPGB 3MHSA 2LGLA 2YURA 2FSAA 2YHOA 5I3LA 2HDPA 2LRIC 3EB5A 3KQIA 4BBQA 4B7YC 5B76A 4I7DA 3N9LA 1WESA 4O64A 3N9MA 3LRQA 2EA6A 2ECNA 4OGCA 3FM8C 5TDWA 4YABA 3O7AA 2JMIA 2DSMA 5KH7A 2FD4A 4FJCA 2LXPC 3PUQA 3ASLA 2LV9A 2G6QA 1JM7A 4CA1A 4R2YA 4O62A 4X3GA 2VPGA 4XI1A 3ZVYA 2VJEB 1VD4A 5SVIA 2OWAA 3MDBC 3GV4A 4TKPB 2LGKA 1MBMA 1DVPA 2L0BA 3U5PA 2F6JA 3KV6A 3HTKC 3L1ZB 4FIPA 3T7LA 2CT2A 3L11A 3ZPVE 4V3LC 4L58A 2L43A 4YADA 1X4UA 3N9NA 2E6RA 2M13A 4A49A 2EODA 5TRBA 5AIUA 3L1XA 5LCWB 4YBSA 3GL6A 2MT5A 3O33A 4OGEA 2LGGA 2Y1NA 2IDAA 2JRJA 2MKEA 2KWOA 5D1MB 1DCQA 4AUQB 3LQIA 1N87A 2L5UA 2LXHC 2MIQA 1WILA 5B77A 3DDTA 2MNYA 4LLBA 4Z0OA 3LQJA 2L80A 2M85A 2MA5A 2ECVA 4GNEA 5KH3A 2MA6A 2VPEA 3FANA 4QF3A 2AN6A 3SUBA 3SOWA 3HCSA 2FUUA 2CSVA 4W4UA 3PLWA 1WFKA 4R7EA 2YQMA 3C5KA 3Q1DA 4IC2A 3T6RA 3LJUX 2EGPA 4ZDTA 2XB1A 1WEWA 4NN2A 5SVYA 1FBVA 5FB0A 4QQ4A 3SOUA 2F42A 3JUEA 4LJNA 2KFTA 1F62A 1G25A 3N9PA 4L7XA 2LGVA 5JG6A 3VK6A 2KGIA 1WEMA 4AVXA 5FEYA 2LAUA 5TDRA 4GNDA 3ZPV1 3I2DA 2KGGA 4MVTA 1VFYA 2CSZA 1MM3A 1WEPA 2ECJA 3LVRE 5B8DA 2PUYA 4P5OB 2M6MA 2RSDA 4BHWA 1U6GB 3DWDA 4S3OC 1JM7B 2L75A 2Y1MA 4YBMA 4F1PA 2FUIA 3RPGC 1JOCA 3M62A 2YHNA 4FO9A 2QICA 5SVIB 1WGMA 2CONA 4LADB 2XOZA 1K2FA 2NAAA 4N4FA 2FFWA 1T1HA 1WEEA 5AITA 3FJUB 3HCTA 3ZVZB 5SVXA 2VPBA 5J3XA 1V87A 2MD7B 1WEVA 2VP7A 2L7PA 2LDRA 3U5NA 4ZUXU 4AYCA 1MM2A 4GNGA 4AYCB 2KKXA 2D8SA 3QZVA 5EYAF 2LN0A 2VNFA 1WE9A 5DINA 2QIZA 4F52B 3SHBA 4Q6FA 3PURA 3KDEC 3LDYA 3KV5A 2JMJA 2I50A 5TABA 4A4BA 4H9DA 2YYRA 3O70A 2E61A 5G05B 4FK5A 1BORA 1FP0A 2HYED 4PTBA 1LDJB 4WA6A 2ECIA 4I7CA 3V43A 3U5OA 2CKLA 5C11A 4CCGX 2BAYA 1IYMA 5TBNA 2YSJA 3M99A 5KH9A 2MUMA 2ECWA 1X4JA 2C2LA 3PHDA 2KWNA 2IQJA 2KU3A 2QJ0A 2YUCA 2Y43A 1WEQA 2JUNA 3C6WA 2K17A 1WENA 4Z0RA 3DQVR 2KWJA 1Z2QA 3FL2A 2ECGA 5DKAA 2P57A 3FEHA 2VJFA 2KKYA 2LQ6A 2UZGA 5H9MA 5LKXA 2CRRA 2EGMA 2K16A 4YC9A 2XEUA 5LKZA 4PPEA 1WIMA 1VYXA 1Z60A 2KYUA 3O37A 2YT5A 1WEUA 2H0DA 2KIZA 2YU4A 5LKUA 5B78A 2XOYA 2H0DB 4UP5A 3N9QA 2ECTA 5B79A 1Z6UA 3O36A 2E6SA 4WZ0A 2M3HA 3M63A 5B75A 5H1TA 2MNZA 3O47A 4GNFA 4A0CD 2VPDA 4UI9B 2KE1A 4LKAA 1CHCA 4V3KC 2CSYA 4IC3A 4C9ZA 1E4UA 4I7BA 3N9OA 2JMDA 4AP4A 2VJEA 2MD8C 2G45A 3M7KA 3H7HA 2K1JA 1ZBDB 3NG2A 5C13A 5H1VA 3FAOA 3HCUA 2C2VS 2XOCA 2DX8A 2D8UA 2B0OE 1XWHA 2EXUA 3ZNIA 2DJAA 5G04B 3LVQE 3KNVA 2KR4A 4WZ3B 4GB0A 4QF2A 4A4CA 2CRWA 3O35A 5K3QA 5H1UA 4UP0A 4YBTA 2M1RA 2RI7A 3U5MA 5FERA 3SOXA 4R8PK 3ZTGA 2RR4A 2YREA 5FB1A 2F6NA 1X4IA 2XP0A 4WZ2A 2YW8A 3ZYQA 1HYIA 4LK9A 4MSXA 3O34A 5LKTA 5D1LB 1LDKC 1WEOA
chains in the Genus database with same CATH topology
2G43A 4B86C 3LQHA 3EB6A 4ZQLA 4N3WA 2YSMA 2CKLB 2KREA 2YQLA 3DPLR 2OXQC 3MHHA 1RMDA 4YATA 5D1KB 3RTRB 2PNXA 5G0FA 2K4DA 1HYJA 4S3OB 2VJFB 4YAXA 3IHPA 2KWKA 2ZETC 3RPGB 3MHSA 2LGLA 2YURA 2FSAA 2YHOA 5I3LA 2HDPA 2LRIC 3EB5A 3KQIA 4BBQA 4B7YC 5B76A 4I7DA 3N9LA 1WESA 4O64A 3N9MA 3LRQA 2EA6A 2ECNA 5TDWA 4YABA 3O7AA 2JMIA 5KH7A 4FJCA 2LXPC 3PUQA 3ASLA 2LV9A 2G6QA 1JM7A 4CA1A 4R2YA 4X3GA 2VPGA 4XI1A 3ZVYA 2VJEB 1VD4A 3GV4A 4TKPB 2LGKA 1DVPA 2L0BA 3U5PA 2F6JA 3KV6A 3HTKC 3L1ZB 4FIPA 3T7LA 2CT2A 3L11A 3ZPVE 4V3LC 4L58A 2L43A 4YADA 1X4UA 3N9NA 2E6RA 4A49A 2EODA 5TRBA 5AIUA 3L1XA 5LCWB 4YBSA 3GL6A 2MT5A 3O33A 2LGGA 2Y1NA 2IDAA 2JRJA 2KWOA 5D1MB 4AUQB 3LQIA 1N87A 2L5UA 2LXHC 2MIQA 1WILA 5B77A 2MNYA 4LLBA 3LQJA 2L80A 2M85A 2MA5A 2ECVA 4GNEA 5KH3A 2MA6A 2VPEA 4QF3A 2AN6A 3SOWA 3HCSA 2FUUA 4W4UA 1WFKA 4R7EA 2YQMA 3C5KA 4IC2A 3T6RA 2EGPA 4ZDTA 2XB1A 1WEWA 4NN2A 1FBVA 5FB0A 3SOUA 2F42A 4LJNA 2KFTA 1F62A 1G25A 3N9PA 4L7XA 2LGVA 5JG6A 3VK6A 2KGIA 1WEMA 4AVXA 5FEYA 5TDRA 4GNDA 3ZPV1 3I2DA 2KGGA 4MVTA 1VFYA 2CSZA 1MM3A 1WEPA 2ECJA 5B8DA 2PUYA 4P5OB 2M6MA 2RSDA 4BHWA 1U6GB 4S3OC 1JM7B 2L75A 2Y1MA 4YBMA 2FUIA 3RPGC 1JOCA 3M62A 2YHNA 4FO9A 2QICA 1WGMA 4LADB 1K2FA 2NAAA 4N4FA 1T1HA 1WEEA 5AITA 3HCTA 3ZVZB 2VPBA 5J3XA 1V87A 2MD7B 1WEVA 2VP7A 2LDRA 3U5NA 4ZUXU 4AYCA 1MM2A 4GNGA 4AYCB 5EYAF 2D8SA 3QZVA 2LN0A 2VNFA 1WE9A 5DINA 2QIZA 4F52B 3SHBA 4Q6FA 3PURA 3KV5A 2JMJA 2I50A 5TABA 4A4BA 2YYRA 3O70A 5G05B 4FK5A 1BORA 1FP0A 2HYED 4PTBA 1LDJB 4WA6A 2ECIA 4I7CA 3V43A 3U5OA 2CKLA 5C11A 4CCGX 2BAYA 1IYMA 5TBNA 2YSJA 3M99A 5KH9A 2MUMA 2ECWA 1X4JA 2C2LA 3PHDA 2KWNA 2KU3A 2QJ0A 2YUCA 2Y43A 1WEQA 3C6WA 2K17A 1WENA 3DQVR 2KWJA 1Z2QA 3FL2A 2ECGA 5DKAA 2VJFA 2LQ6A 2UZGA 5H9MA 5LKXA 2K16A 4YC9A 2XEUA 5LKZA 4PPEA 1WIMA 1VYXA 1Z60A 2KYUA 3O37A 2YT5A 1WEUA 2H0DA 2KIZA 2YU4A 5LKUA 5B78A 2H0DB 4UP5A 3N9QA 2ECTA 5B79A 1Z6UA 3O36A 2E6SA 4WZ0A 2M3HA 3M63A 5B75A 5H1TA 2MNZA 4A0CD 4GNFA 2VPDA 4UI9B 2KE1A 4LKAA 1CHCA 4V3KC 2CSYA 4IC3A 4C9ZA 1E4UA 4I7BA 3N9OA 2JMDA 4AP4A 2VJEA 2MD8C 2G45A 2K1JA 1ZBDB 3NG2A 5C13A 5H1VA 3HCUA 2C2VS 2DX8A 3ZNIA 1XWHA 5G04B 3KNVA 2KR4A 4WZ3B 4GB0A 4QF2A 4A4CA 3O35A 5H1UA 4UP0A 4YBTA 2M1RA 2RI7A 3U5MA 5FERA 3SOXA 4R8PK 3ZTGA 2YREA 5FB1A 2F6NA 1X4IA 4WZ2A 2YW8A 3ZYQA 1HYIA 4LK9A 4MSXA 3O34A 5LKTA 5D1LB 1LDKC 1WEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G43 A;  4B86 C;  3LQH A;  3EB6 A;  4ZQL A;  4N3W A;  2YSM A;  2CKL B;  2KRE A;  2YQL A;  3DPL R;  2OXQ C;  3MHH A;  1RMD A;  4YAT A;  5D1K B;  3RTR B;  2PNX A;  5G0F A;  2K4D A;  1HYJ A;  4S3O B;  2VJF B;  4YAX A;  3IHP A;  2KWK A;  2ZET C;  3RPG B;  3MHS A;  2LGL A;  2YUR A;  2FSA A;  2YHO A;  5I3L A;  2HDP A;  2LRI C;  3EB5 A;  3KQI A;  4BBQ A;  4B7Y C;  5B76 A;  4I7D A;  3N9L A;  1WES A;  4O64 A;  3N9M A;  3LRQ A;  2EA6 A;  2ECN A;  5TDW A;  4YAB A;  3O7A A;  2JMI A;  5KH7 A;  4FJC A;  2LXP C;  3PUQ A;  3ASL A;  2LV9 A;  2G6Q A;  1JM7 A;  4CA1 A;  4R2Y A;  4X3G A;  2VPG A;  4XI1 A;  3ZVY A;  2VJE B;  1VD4 A;  3GV4 A;  4TKP B;  2LGK A;  1DVP A;  2L0B A;  3U5P A;  2F6J A;  3KV6 A;  3HTK C;  3L1Z B;  4FIP A;  3T7L A;  2CT2 A;  3L11 A;  3ZPV E;  4V3L C;  4L58 A;  2L43 A;  4YAD A;  1X4U A;  3N9N A;  2E6R A;  4A49 A;  2EOD A;  5TRB A;  5AIU A;  3L1X A;  5LCW B;  4YBS A;  3GL6 A;  2MT5 A;  3O33 A;  2LGG A;  2Y1N A;  2IDA A;  2JRJ A;  2KWO A;  5D1M B;  4AUQ B;  3LQI A;  1N87 A;  2L5U A;  2LXH C;  2MIQ A;  1WIL A;  5B77 A;  2MNY A;  4LLB A;  3LQJ A;  2L80 A;  2M85 A;  2MA5 A;  2ECV A;  4GNE A;  5KH3 A;  2MA6 A;  2VPE A;  4QF3 A;  2AN6 A;  3SOW A;  3HCS A;  2FUU A;  4W4U A;  1WFK A;  4R7E A;  2YQM A;  3C5K A;  4IC2 A;  3T6R A;  2EGP A;  4ZDT A;  2XB1 A;  1WEW A;  4NN2 A;  1FBV A;  5FB0 A;  3SOU A;  2F42 A;  4LJN A;  2KFT A;  1F62 A;  1G25 A;  3N9P A;  4L7X A;  2LGV A;  5JG6 A;  3VK6 A;  2KGI A;  1WEM A;  4AVX A;  5FEY A;  5TDR A;  4GND A;  3ZPV 1;  3I2D A;  2KGG A;  4MVT A;  1VFY A;  2CSZ A;  1MM3 A;  1WEP A;  2ECJ A;  5B8D A;  2PUY A;  4P5O B;  2M6M A;  2RSD A;  4BHW A;  1U6G B;  4S3O C;  1JM7 B;  2L75 A;  2Y1M A;  4YBM A;  2FUI A;  3RPG C;  1JOC A;  3M62 A;  2YHN A;  4FO9 A;  2QIC A;  1WGM A;  4LAD B;  1K2F A;  2NAA A;  4N4F A;  1T1H A;  1WEE A;  5AIT A;  3HCT A;  3ZVZ B;  2VPB A;  5J3X A;  1V87 A;  2MD7 B;  1WEV A;  2VP7 A;  2LDR A;  3U5N A;  4ZUX U;  4AYC A;  1MM2 A;  4GNG A;  4AYC B;  5EYA F;  2D8S A;  3QZV A;  2LN0 A;  2VNF A;  1WE9 A;  5DIN A;  2QIZ A;  4F52 B;  3SHB A;  4Q6F A;  3PUR A;  3KV5 A;  2JMJ A;  2I50 A;  5TAB A;  4A4B A;  2YYR A;  3O70 A;  5G05 B;  4FK5 A;  1BOR A;  1FP0 A;  2HYE D;  4PTB A;  1LDJ B;  4WA6 A;  2ECI A;  4I7C A;  3V43 A;  3U5O A;  2CKL A;  5C11 A;  4CCG X;  2BAY A;  1IYM A;  5TBN A;  2YSJ A;  3M99 A;  5KH9 A;  2MUM A;  2ECW A;  1X4J A;  2C2L A;  3PHD A;  2KWN A;  2KU3 A;  2QJ0 A;  2YUC A;  2Y43 A;  1WEQ A;  3C6W A;  2K17 A;  1WEN A;  3DQV R;  2KWJ A;  1Z2Q A;  3FL2 A;  2ECG A;  5DKA A;  2VJF A;  2LQ6 A;  2UZG A;  5H9M A;  5LKX A;  2K16 A;  4YC9 A;  2XEU A;  5LKZ A;  4PPE A;  1WIM A;  1VYX A;  1Z60 A;  2KYU A;  3O37 A;  2YT5 A;  1WEU A;  2H0D A;  2KIZ A;  2YU4 A;  5LKU A;  5B78 A;  2H0D B;  4UP5 A;  3N9Q A;  2ECT A;  5B79 A;  1Z6U A;  3O36 A;  2E6S A;  4WZ0 A;  2M3H A;  3M63 A;  5B75 A;  5H1T A;  2MNZ A;  4A0C D;  4GNF A;  2VPD A;  4UI9 B;  2KE1 A;  4LKA A;  1CHC A;  4V3K C;  2CSY A;  4IC3 A;  4C9Z A;  1E4U A;  4I7B A;  3N9O A;  2JMD A;  4AP4 A;  2VJE A;  2MD8 C;  2G45 A;  2K1J A;  1ZBD B;  3NG2 A;  5C13 A;  5H1V A;  3HCU A;  2C2V S;  2DX8 A;  3ZNI A;  1XWH A;  5G04 B;  3KNV A;  2KR4 A;  4WZ3 B;  4GB0 A;  4QF2 A;  4A4C A;  3O35 A;  5H1U A;  4UP0 A;  4YBT A;  2M1R A;  2RI7 A;  3U5M A;  5FER A;  3SOX A;  4R8P K;  3ZTG A;  2YRE A;  5FB1 A;  2F6N A;  1X4I A;  4WZ2 A;  2YW8 A;  3ZYQ A;  1HYI A;  4LK9 A;  4MSX A;  3O34 A;  5LKT A;  5D1L B;  1LDK C;  1WEO A; 
#chains in the Genus database with same CATH topology
 2G43 A;  4B86 C;  3LQH A;  3EB6 A;  4ZQL A;  4N3W A;  2YSM A;  2CKL B;  2KRE A;  2YQL A;  3DPL R;  2OXQ C;  2YVR A;  3MHH A;  1RMD A;  4YAT A;  5D1K B;  3RTR B;  2PNX A;  5G0F A;  2K4D A;  3T9K A;  1HYJ A;  4S3O B;  2JM3 A;  2VJF B;  3E2D A;  4YAX A;  3IHP A;  2KWK A;  2ZET C;  3RPG B;  3MHS A;  2LGL A;  2YUR A;  2FSA A;  2YHO A;  5I3L A;  2HDP A;  2LRI C;  3EB5 A;  3KQI A;  4BBQ A;  4B7Y C;  5B76 A;  4I7D A;  3N9L A;  1WES A;  4O64 A;  3N9M A;  3LRQ A;  2EA6 A;  2ECN A;  4OGC A;  3FM8 C;  5TDW A;  4YAB A;  3O7A A;  2JMI A;  2DSM A;  5KH7 A;  2FD4 A;  4FJC A;  2LXP C;  3PUQ A;  3ASL A;  2LV9 A;  2G6Q A;  1JM7 A;  4CA1 A;  4R2Y A;  4O62 A;  4X3G A;  2VPG A;  4XI1 A;  3ZVY A;  2VJE B;  1VD4 A;  5SVI A;  2OWA A;  3MDB C;  3GV4 A;  4TKP B;  2LGK A;  1MBM A;  1DVP A;  2L0B A;  3U5P A;  2F6J A;  3KV6 A;  3HTK C;  3L1Z B;  4FIP A;  3T7L A;  2CT2 A;  3L11 A;  3ZPV E;  4V3L C;  4L58 A;  2L43 A;  4YAD A;  1X4U A;  3N9N A;  2E6R A;  2M13 A;  4A49 A;  2EOD A;  5TRB A;  5AIU A;  3L1X A;  5LCW B;  4YBS A;  3GL6 A;  2MT5 A;  3O33 A;  4OGE A;  2LGG A;  2Y1N A;  2IDA A;  2JRJ A;  2MKE A;  2KWO A;  5D1M B;  1DCQ A;  4AUQ B;  3LQI A;  1N87 A;  2L5U A;  2LXH C;  2MIQ A;  1WIL A;  5B77 A;  3DDT A;  2MNY A;  4LLB A;  4Z0O A;  3LQJ A;  2L80 A;  2M85 A;  2MA5 A;  2ECV A;  4GNE A;  5KH3 A;  2MA6 A;  2VPE A;  3FAN A;  4QF3 A;  2AN6 A;  3SUB A;  3SOW A;  3HCS A;  2FUU A;  2CSV A;  4W4U A;  3PLW A;  1WFK A;  4R7E A;  2YQM A;  3C5K A;  3Q1D A;  4IC2 A;  3T6R A;  3LJU X;  2EGP A;  4ZDT A;  2XB1 A;  1WEW A;  4NN2 A;  5SVY A;  1FBV A;  5FB0 A;  4QQ4 A;  3SOU A;  2F42 A;  3JUE A;  4LJN A;  2KFT A;  1F62 A;  1G25 A;  3N9P A;  4L7X A;  2LGV A;  5JG6 A;  3VK6 A;  2KGI A;  1WEM A;  4AVX A;  5FEY A;  2LAU A;  5TDR A;  4GND A;  3ZPV 1;  3I2D A;  2KGG A;  4MVT A;  1VFY A;  2CSZ A;  1MM3 A;  1WEP A;  2ECJ A;  3LVR E;  5B8D A;  2PUY A;  4P5O B;  2M6M A;  2RSD A;  4BHW A;  1U6G B;  3DWD A;  4S3O C;  1JM7 B;  2L75 A;  2Y1M A;  4YBM A;  4F1P A;  2FUI A;  3RPG C;  1JOC A;  3M62 A;  2YHN A;  4FO9 A;  2QIC A;  5SVI B;  1WGM A;  2CON A;  4LAD B;  2XOZ A;  1K2F A;  2NAA A;  4N4F A;  2FFW A;  1T1H A;  1WEE A;  5AIT A;  3FJU B;  3HCT A;  3ZVZ B;  5SVX A;  2VPB A;  5J3X A;  1V87 A;  2MD7 B;  1WEV A;  2VP7 A;  2L7P A;  2LDR A;  3U5N A;  4ZUX U;  4AYC A;  1MM2 A;  4GNG A;  4AYC B;  2KKX A;  2D8S A;  3QZV A;  5EYA F;  2LN0 A;  2VNF A;  1WE9 A;  5DIN A;  2QIZ A;  4F52 B;  3SHB A;  4Q6F A;  3PUR A;  3KDE C;  3LDY A;  3KV5 A;  2JMJ A;  2I50 A;  5TAB A;  4A4B A;  4H9D A;  2YYR A;  3O70 A;  2E61 A;  5G05 B;  4FK5 A;  1BOR A;  1FP0 A;  2HYE D;  4PTB A;  1LDJ B;  4WA6 A;  2ECI A;  4I7C A;  3V43 A;  3U5O A;  2CKL A;  5C11 A;  4CCG X;  2BAY A;  1IYM A;  5TBN A;  2YSJ A;  3M99 A;  5KH9 A;  2MUM A;  2ECW A;  1X4J A;  2C2L A;  3PHD A;  2KWN A;  2IQJ A;  2KU3 A;  2QJ0 A;  2YUC A;  2Y43 A;  1WEQ A;  2JUN A;  3C6W A;  2K17 A;  1WEN A;  4Z0R A;  3DQV R;  2KWJ A;  1Z2Q A;  3FL2 A;  2ECG A;  5DKA A;  2P57 A;  3FEH A;  2VJF A;  2KKY A;  2LQ6 A;  2UZG A;  5H9M A;  5LKX A;  2CRR A;  2EGM A;  2K16 A;  4YC9 A;  2XEU A;  5LKZ A;  4PPE A;  1WIM A;  1VYX A;  1Z60 A;  2KYU A;  3O37 A;  2YT5 A;  1WEU A;  2H0D A;  2KIZ A;  2YU4 A;  5LKU A;  5B78 A;  2XOY A;  2H0D B;  4UP5 A;  3N9Q A;  2ECT A;  5B79 A;  1Z6U A;  3O36 A;  2E6S A;  4WZ0 A;  2M3H A;  3M63 A;  5B75 A;  5H1T A;  2MNZ A;  3O47 A;  4GNF A;  4A0C D;  2VPD A;  4UI9 B;  2KE1 A;  4LKA A;  1CHC A;  4V3K C;  2CSY A;  4IC3 A;  4C9Z A;  1E4U A;  4I7B A;  3N9O A;  2JMD A;  4AP4 A;  2VJE A;  2MD8 C;  2G45 A;  3M7K A;  3H7H A;  2K1J A;  1ZBD B;  3NG2 A;  5C13 A;  5H1V A;  3FAO A;  3HCU A;  2C2V S;  2XOC A;  2DX8 A;  2D8U A;  2B0O E;  1XWH A;  2EXU A;  3ZNI A;  2DJA A;  5G04 B;  3LVQ E;  3KNV A;  2KR4 A;  4WZ3 B;  4GB0 A;  4QF2 A;  4A4C A;  2CRW A;  3O35 A;  5K3Q A;  5H1U A;  4UP0 A;  4YBT A;  2M1R A;  2RI7 A;  3U5M A;  5FER A;  3SOX A;  4R8P K;  3ZTG A;  2RR4 A;  2YRE A;  5FB1 A;  2F6N A;  1X4I A;  2XP0 A;  4WZ2 A;  2YW8 A;  3ZYQ A;  1HYI A;  4LK9 A;  4MSX A;  3O34 A;  5LKT A;  5D1L B;  1LDK C;  1WEO A; 
#chains in the Genus database with same CATH homology
 2G43 A;  4B86 C;  3LQH A;  3EB6 A;  4ZQL A;  4N3W A;  2YSM A;  2CKL B;  2KRE A;  2YQL A;  3DPL R;  2OXQ C;  3MHH A;  1RMD A;  4YAT A;  5D1K B;  3RTR B;  2PNX A;  5G0F A;  2K4D A;  1HYJ A;  4S3O B;  2VJF B;  4YAX A;  3IHP A;  2KWK A;  2ZET C;  3RPG B;  3MHS A;  2LGL A;  2YUR A;  2FSA A;  2YHO A;  5I3L A;  2HDP A;  2LRI C;  3EB5 A;  3KQI A;  4BBQ A;  4B7Y C;  5B76 A;  4I7D A;  3N9L A;  1WES A;  4O64 A;  3N9M A;  3LRQ A;  2EA6 A;  2ECN A;  5TDW A;  4YAB A;  3O7A A;  2JMI A;  5KH7 A;  4FJC A;  2LXP C;  3PUQ A;  3ASL A;  2LV9 A;  2G6Q A;  1JM7 A;  4CA1 A;  4R2Y A;  4X3G A;  2VPG A;  4XI1 A;  3ZVY A;  2VJE B;  1VD4 A;  3GV4 A;  4TKP B;  2LGK A;  1DVP A;  2L0B A;  3U5P A;  2F6J A;  3KV6 A;  3HTK C;  3L1Z B;  4FIP A;  3T7L A;  2CT2 A;  3L11 A;  3ZPV E;  4V3L C;  4L58 A;  2L43 A;  4YAD A;  1X4U A;  3N9N A;  2E6R A;  4A49 A;  2EOD A;  5TRB A;  5AIU A;  3L1X A;  5LCW B;  4YBS A;  3GL6 A;  2MT5 A;  3O33 A;  2LGG A;  2Y1N A;  2IDA A;  2JRJ A;  2KWO A;  5D1M B;  4AUQ B;  3LQI A;  1N87 A;  2L5U A;  2LXH C;  2MIQ A;  1WIL A;  5B77 A;  2MNY A;  4LLB A;  3LQJ A;  2L80 A;  2M85 A;  2MA5 A;  2ECV A;  4GNE A;  5KH3 A;  2MA6 A;  2VPE A;  4QF3 A;  2AN6 A;  3SOW A;  3HCS A;  2FUU A;  4W4U A;  1WFK A;  4R7E A;  2YQM A;  3C5K A;  4IC2 A;  3T6R A;  2EGP A;  4ZDT A;  2XB1 A;  1WEW A;  4NN2 A;  1FBV A;  5FB0 A;  3SOU A;  2F42 A;  4LJN A;  2KFT A;  1F62 A;  1G25 A;  3N9P A;  4L7X A;  2LGV A;  5JG6 A;  3VK6 A;  2KGI A;  1WEM A;  4AVX A;  5FEY A;  5TDR A;  4GND A;  3ZPV 1;  3I2D A;  2KGG A;  4MVT A;  1VFY A;  2CSZ A;  1MM3 A;  1WEP A;  2ECJ A;  5B8D A;  2PUY A;  4P5O B;  2M6M A;  2RSD A;  4BHW A;  1U6G B;  4S3O C;  1JM7 B;  2L75 A;  2Y1M A;  4YBM A;  2FUI A;  3RPG C;  1JOC A;  3M62 A;  2YHN A;  4FO9 A;  2QIC A;  1WGM A;  4LAD B;  1K2F A;  2NAA A;  4N4F A;  1T1H A;  1WEE A;  5AIT A;  3HCT A;  3ZVZ B;  2VPB A;  5J3X A;  1V87 A;  2MD7 B;  1WEV A;  2VP7 A;  2LDR A;  3U5N A;  4ZUX U;  4AYC A;  1MM2 A;  4GNG A;  4AYC B;  5EYA F;  2D8S A;  3QZV A;  2LN0 A;  2VNF A;  1WE9 A;  5DIN A;  2QIZ A;  4F52 B;  3SHB A;  4Q6F A;  3PUR A;  3KV5 A;  2JMJ A;  2I50 A;  5TAB A;  4A4B A;  2YYR A;  3O70 A;  5G05 B;  4FK5 A;  1BOR A;  1FP0 A;  2HYE D;  4PTB A;  1LDJ B;  4WA6 A;  2ECI A;  4I7C A;  3V43 A;  3U5O A;  2CKL A;  5C11 A;  4CCG X;  2BAY A;  1IYM A;  5TBN A;  2YSJ A;  3M99 A;  5KH9 A;  2MUM A;  2ECW A;  1X4J A;  2C2L A;  3PHD A;  2KWN A;  2KU3 A;  2QJ0 A;  2YUC A;  2Y43 A;  1WEQ A;  3C6W A;  2K17 A;  1WEN A;  3DQV R;  2KWJ A;  1Z2Q A;  3FL2 A;  2ECG A;  5DKA A;  2VJF A;  2LQ6 A;  2UZG A;  5H9M A;  5LKX A;  2K16 A;  4YC9 A;  2XEU A;  5LKZ A;  4PPE A;  1WIM A;  1VYX A;  1Z60 A;  2KYU A;  3O37 A;  2YT5 A;  1WEU A;  2H0D A;  2KIZ A;  2YU4 A;  5LKU A;  5B78 A;  2H0D B;  4UP5 A;  3N9Q A;  2ECT A;  5B79 A;  1Z6U A;  3O36 A;  2E6S A;  4WZ0 A;  2M3H A;  3M63 A;  5B75 A;  5H1T A;  2MNZ A;  4A0C D;  4GNF A;  2VPD A;  4UI9 B;  2KE1 A;  4LKA A;  1CHC A;  4V3K C;  2CSY A;  4IC3 A;  4C9Z A;  1E4U A;  4I7B A;  3N9O A;  2JMD A;  4AP4 A;  2VJE A;  2MD8 C;  2G45 A;  2K1J A;  1ZBD B;  3NG2 A;  5C13 A;  5H1V A;  3HCU A;  2C2V S;  2DX8 A;  3ZNI A;  1XWH A;  5G04 B;  3KNV A;  2KR4 A;  4WZ3 B;  4GB0 A;  4QF2 A;  4A4C A;  3O35 A;  5H1U A;  4UP0 A;  4YBT A;  2M1R A;  2RI7 A;  3U5M A;  5FER A;  3SOX A;  4R8P K;  3ZTG A;  2YRE A;  5FB1 A;  2F6N A;  1X4I A;  4WZ2 A;  2YW8 A;  3ZYQ A;  1HYI A;  4LK9 A;  4MSX A;  3O34 A;  5LKT A;  5D1L B;  1LDK C;  1WEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...