5C52B

Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial dna polymerase gamma
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
418
structure length
363
Chain Sequence
ALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVFDTKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase subunit gamma-1
publication title Probing the structural and molecular basis of nucleotide selectivity by human mitochondrial DNA polymerase gamma.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 363
sequence length 418
chains with identical sequence C
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-06-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 5c52B01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 5c52B02
2E65A 3DSQA 2I4NA 4G85A 2PMFA 4DQ2A 3HFZB 1B7YB 2HNIA 4P72A 4XTYA 1SERA 1EOVA 4KR3A 1ADYA 1KMNA 2ZT8A 3TEGA 2CGHA 4LNSA 2CJAA 4CH4A 1G5HA 1G5IA 4DPGA 1X56A 3L1AA 1W66A 3OD1A 3HY1A 2ZZGA 1H4VB 1X55A 2ZIOA 2DZCA 1ASYA 5KNNA 4BWAA 3REXA 3REUA 1KOGA 4CS4A 4XTWA 3VQXA 3M4QA 3L4GA 4Q15A 3IKMB 2E1HA 2Q7GA 4H2SA 3LC0A 1WNLA 3HTZA 1YFRA 3R07A 2I4OA 4E51A 5C52B 4HWSA 1X01A 2EJFA 1RIQA 3VBBA 1JJCA 2DKGA 2ZIMA 3NETA 4YP0A 1EVKA 1YFSA 4TVAA 5F5WA 2DEQA 3HRKA 4H2XB 4P73A 2EL9A 4YRGA 1EVLA 2Q5IA 4TVAB 2XGTA 1Z7MA 1Z7NA 3VQYA 4YRIA 1N9WA 1B76A 5K1PA 4XEMA 1WPYA 4NCXA 3BFMA 3VQWA 2ZZEA 4YRJA 3UH0A 4PG3A 4P71A 4WI1A 3UGTA 1X2GA 2ZT6A 1NNHA 1B70A 3P8TA 2RHSA 5K1XA 1WQWA 3RGLA 1C0AA 4YRNA 3UFGA 3RACA 4YRCA 1B70B 1SETA 2EWNA 2AKWB 4XU2A 2DXTA 3QNEA 1HXDA 1ASZA 2ZR2A 4YYEA 1USYC 4YRPA 4YRFA 1IL2A 3HXZA 2EJGA 1NYQA 1B7YA 3I7FA 2LW7A 4CH5A 3CMQA 4TTVA 1WLEA 2ODRD 1YGBA 3A74A 3QO5A 3UGQA 3NENA 4CS2A 3RIRA 4XU1A 1FYFA 3RKXA 4TWAA 4H2TA 2EAYA 1VQZA 3A7UA 1BIAA 1NJ6A 2E41A 4TVYA 3TUPA 4YROA 1QF6A 4CH6A 1BIBA 4HVCA 1J5WA 4H2WA 4YRLA 5ELOA 2CJBA 1PYSB 3IG2A 4P72C 3NEMA 4K88A 3HXXA 4ZIBA 2Q7HA 2DTHA 2G4CA 4HWPA 1YFTA 3PZCA 4P74A 2Q7EA 4PHCA 1L0WA 4CH3A 2J3LA 4P3PA 2C7IA 4P3OA 4XTUA 3QO8A 1E24A 3V7SA 1ADJA 3P8YA 4YRTA 3PCOB 5C53B 1ATIA 4HA8A 4XTXA 4H2XA 4OP0A 2PMEA 3HFVA 3IALA 3TEHB 2E3CA 2Q5HA 3IKLA 4G84A 4YRKA 4RMFA 2DVEA 4YRSA 4ZTZB 3A31A 2DQ0A 4ZTUB 4WJ3M 3A7AA 4YCVA 4RQFA 2FYKA 4UP9A 4X5OA 2ALYA 4CS3A 1QE0A 1G51A 4P75A 2ALYB 3E9HA 2AKWA 3HRIA 1WU7A 1NJ8A 5E3IA 3HXUA 4XEOA 4P73C 1H4SA 4YDQA 3ERRA 4EX5A 4H2UA 5ELNA 2DTIA 2RHQB 3V7CA 4K87A 3RF1A 4XTZA 1X2HA 4H02A 1HTTA 2DU7A 3NELA 1EIYB 4KR2A 2ZINA 3HXVA 1NJ1A 1WQ7A 4P71C 1H4TA 4YREA 2E64A 2C8MA 3V8KA 4K86A 1B8AA 4Q6GA 2AMCB 4H2VA 4J15A 4UP7A 4YRRA 2I4LA 3LSQA 4UP8A 1NJ2A 4TQDA 3EFSA 2ARTA 3RKWA 4YCWA 3RUXA 1NYRA 4H2YA 4XTVA 1PYSA 2DZ9A 3RKYA 1X54A 2QHTA 2IY5A 2P5IA 3P8VA 2IY5B 1GGMA 4HWRA 4YRQA 1SESA 3RL6A 3HXWA 1V95A 3PCOA 2ARUA 2DDZA 3MEYA 3TEHA 3EFRA 2P0LA 3HY0A 4XU0A 2E10A 4OLFA 3QTCA 4KQEA 12ASA 3A7RA 4HWTA 4O2DA 3MF2A 3QO7A 2QHVA 3W3SA 2QHSA 3L4GB 2ZTGA 4L87A 2ZNJA 1BBWA 4P74C 4P3NA 2CJ9A 3MF1A 3A5YA 2CIMA 4TQFA 2DJZA 3KFUA 1KMMA 4YCUA 3V8JA 2ZZFA 3LSSA 3FJPA 1JJCB 2ZXFA 3M4PA 2ZR3A 5HGQA 1H4QA 2J3MA 1E1TA 1EQRA 1BBUA 3VQVA 2RHQA 1EIYA 4TVWA 3L2ZA 1EFWA 1HC7A 2ARSA 3HXYA 1USYA 3BJUA 3V8LA 2ZT7A 1WYDA 4YRMA 4RQEA 1YB3A 4HWOA 4RDXA 2DTOA 4AH6A 2EJ9A 2E5AA 3G1ZA 3A5ZA 1SRYA 2I4MA 4XU3A 3E9IA 2RHSB 4BW9A 1NJ5A 1LYLA 4P75C 11ASA 3V7RA 2AMCA 2QHUA 1E1OA 4EO4A 4UPAA 2ZNIA 5C51B 2DU5A 3ICAA 4WJ4A 2DQ3A 4YPFA 2ZT5A 2ZGWA 1E22A 2ZCEA 2XTIA 3A32A 3WQZA 4WF2A 2ODRC 3HFZA 2DXUA
chains in the Genus database with same CATH superfamily
2VPPA 2SKEA 2O8EB 4NJMA 1ZMTA 1I30A 5T4BA 3R9XB 1BGVA 2QROA 2ZLBA 1NQWA 4I4CA 3RIMA 1EFVA 4Y1EA 3MCVA 4WXPA 5D1NA 5FL7A 2X9NA 4LC1A 4H3VA 1C30B 1IQPA 1VSQA 3MSXA 5HFJA 1CIJA 2B99A 2I78A 3WFIA 3DZ8A 1I0LA 1Q1GA 3FCCA 5FKJA 3IBFA 3KAPA 4I1UA 5PNTA 4C20A 1SR8A 1PS0A 1H2ZA 3D6UA 2XNHA 3T41A 4EVQA 2QGNA 3VOTA 2ZJ3A 3DQPA 3GDHA 2R6DA 3NC1C 4LA4A 5D84A 5DBIA 1E0DA 4PSVA 1YB6A 1YBHA 2O2DA 5GWXA 1E5QA 2GEKA 3LF1A 5K0TA 3FLMA 4OHUA 4DREA 3R44A 4LBVA 4G67A 3R3SA 4RTMA 3DMRA 3BE4A 4XWOA 1S2NA 4YUWA 5T6BA 4ETMA 2HMYB 3U4CA 3USES 1KMHB 1G8GA 1QOQB 2ZIGA 4CLEA 3GH1A 4JSYA 1B23P 3D8HA 1HORA 1CY0A 5F9FA 1KSHA 1ZW1A 3DQQA 5E3HA 3JW8A 5C4MA 1LDMA 3TRHA 2AN4A 3L05A 2HU7A 3DUFB 3OHPA 5EQJB 3UG6A 1P77A 2G71A 2YWDA 1AZSC 2PANA 1U9ZA 1WW8A 2O8CB 3CXRA 4ZO8A 2WT9A 4NV1A 4N39A 3AHDA 3P32A 1KO7A 1CUZA 2P65A 4JL5A 3REUA 4XJSA 3EEOA 2XMRA 4PW0A 5HKKA 4HCJA 4JP5A 4JI6B 3ND6A 3V7YA 1AN9A 3A28A 3MELA 4H60A 5DHAA 4RTLA 5FNVF 1UJCA 1LQUA 2JNWA 2GM4A 2FZ5A 3AHHA 9ABPA 3AKZA 1Y8QA 4MCAA 1XZKA 3WA7A 2YMLA 4IMJB 3GLTA 2VP4A 2CF5A 1NN1A 5REQB 1PGNA 2JLSA 2KYRA 2PBZA 5LP1A 1WOMA 3LD9A 4DLWA 2CD7A 5A6SB 4IGIA 4RK0A 3VZDA 3LCJA 4YBZA 5CR9A 1BMFD 1E6EA 1V3TA 3EWNA 4R2XA 4Z9FA 3E1SA 1BW9A 2HC9A 1JJCA 2VAVA 4LXGA 4UMVA 4INOA 1E0JA 2F4NA 3PJGA 4M6WA 4JBLA 1Q5PA 4YP0A 1JN0A 5HFNA 4AIIA 1MR3F 3Q3EA 1T6XA 4ECAA 1E98A 3RRMA 2XZOA 3O38A 3DE3X 3HKBA 4QU0A 4R1PA 5CFMA 1UMDA 2R00A 2WMNB 1NQAO 4M6WB 3NOOA 3VU3A 3OSZA 1MIOA 4FZRA 2XQGA 1ADBA 4LE1A 3WRWA 3WA6A 3BSYA 5HIMA 2JBAA 4JBGA 4Y1FA 2HK7A 1Z7MA 4A8TA 5CX1A 2YBDA 1D2AA 5F1KA 3VDXA 2ADFA 2ORYA 1SBCA 2FR8A 3HYRA 3OZFA 4IUBS 4RD6A 4YT4A 2ZE7A 2HCBA 5ES4B 3AUAA 3OAAD 5JIBA 2NPOA 1ZU5A 1J0EA 3EN0A 5JARA 3VPXA 2JGAA 2JFZA 1OOEA 3KR9A 3DVAA 2ISQA 4M9SA 3ZV3A 1O0BA 1C3XA 4IDNA 1UK6A 1D0VA 1L5LA 1WPGA 4WI1A 1Z75A 2PKYX 1GEEA 3ZN2A 721PA 1QIEA 1QHHA 5BN1A 3HEBA 4KMRA 3VZQA 3LFUA 4NYJR 5JPIA 1T29A 2QJFA 3A2KA 1SUDA 2DPYA 2P78A 4ZVRA 3FJYA 4PWYA 2ZI5A 4K03A 4TV8B 2Y99A 5FF9A 4TGLA 3TOSA 4I14A 2ZJ5A 2P6NA 1EHIA 5BUQA 1ZMOA 1B6RA 2E2WA 3B5IA 3CB4A 3LUFA 4M89A 1NMXA 1ZCJA 1P2FA 5EP2A 4JXKA 2D4HA 2H1VA 2ZI9A 3TIIA 4NCIA 2Z56A 1KQGA 1G1MA 3OEHD 2HXSA 3N87A 4WK6A 3CKYA 4JJ8A 4PPFA 3QNEA 1SWVA 2V0GA 3B36A 2BEVB 2IELA 2V6GA 1HFKA 1OXKB 1T2EA 3QKRA 2EZ9A 3QX8A 3M6XA 4M8KA 2W2MA 3FWNA 1RM5A 4DNQA 2O07A 3PQ2A 4GZ6A 1UBUS 1VI2A 4UBOA 3ZLJA 3QEOA 3FB4A 1K2VN 1UDCA 1VCNA 1Z8NA 2A94A 3AESB 1J21A 3QKRB 2GAJA 2TRSB 4DQVA 4PC7A 3B3AA 1Z56C 1AKWA 1FB5A 3E8MA 3EZ2A 3I5YA 2DPLA 2R8YA 5JVDB 1ID8A 1LUAA 2PEYA 5B3LA 3SIRA 2IYFA 1ZM9A 2C3PA 1IVSA 3AP1A 2BKAA 1XLTC 2O3QA 3MHPA 4AJIA 1VL0A 2ZRPA 2I80A 5E0OA 1E5TA 2R6AA 2HNKA 3VKUA 1RXUA 4FFPA 2ODRD 1CVRA 1C5KA 3FWZA 3WIOA 5KMGA 1PBNA 1VI5A 2GF9A 5AK5A 1JVNA 1L9KA 1NVBA 1X3LA 2I0FA 2VHJA 4K6KA 1W5BA 3VDNB 5DM4A 5HJ5A 4I66A 4KOEC 3MJRA 4B3HA 2HCJB 5JQWA 4BX8A 1CNFA 1G8FA 5DTMA 3R5TA 5KMGB 4QPPA 4HS9A 3V6MA 3D4BA 3EIEA 4WFQA 2ZTSA 2EDCA 4IMPA 3QEKA 4OJMX 4XD7A 1UMCA 1ABEA 4I55B 4R84A 2BY4A 1VLZA 1Y33E 4OFWA 5JDCC 5CYFA 3ZBUA 4AG5A 3SHWA 3OY7A 3IEMA 4TT8A 1U3GA 3WYAA 3GJSA 4B4DA 3CCBA 1PDOA 1RYFA 2RIPA 1ESNA 3IL2A 2IX3A 4K26A 4DWOA 5HIIA 2W6QA 2VTEA 2FMFA 4TYMA 2WM3A 5J4YA 4NBVA 5SZIA 3ZE1B 1YB2A 4H27A 2GA9A 1O2DA 2VHXA 1W76A 2VSYA 1EX6A 4QFMA 3UMCA 1NNI1 4CFSA 4PYRA 5JMOA 1AA9A 1BOOA 2DP4E 1XHEA 2JH8A 3KJIA 4GXNA 4D3DA 3I34X 2NG1A 3PQ5A 2Z30A 3SU8A 4UTPA 2O59A 2WG1A 2D2VA 4JSRA 3R7LA 4CG2A 1DI0A 2F1IA 4HMPA 1G21A 3CZ9A 1XMJA 1G4HA 5A9RA 3M3DA 3WE7A 5I5EA 3NPAA 3OTGA 5KNCA 3LNTA 1LCIA 3G0OA 3JQ7A 2E4XA 2JFBA 1A97A 3OFJA 4Q0MA 3D3QA 2P2LA 2WJZB 5I4IA 1TTPB 4UEWA 3T5PA 2Y6UA 3L84A 3QA3E 1NN5A 4N54A 4RV5A 4AZ3B 1HR0B 4PLHA 2R8XA 1TQ6A 4P3OA 3E1KA 3U49A 3WC4A 2HJWA 1Z82A 2R2AA 4XJVA 5CJJA 2WUFA 5KU7A 3DTNA 1M2KA 1DGQA 2M2IA 1VMEA 3L4EA 3TVDA 5A3RA 3K05A 1BQ3A 4FD2A 3TVYA 1ADJA 2XW6A 3O4JA 1XNQB 3JQ9A 5FWXB 4OLAA 1Y1QA 1H5NA 1T0IA 3T7KA 3L8DA 1SCUA 1PYDA 2PH3A 4G37A 1ST2A 4JJZA 5E6RA 1Z6QA 2WIAA 3SJBA 3SYLA 3WGTA 4BO3A 4DW8A 1NW3A 1WV1A 3K0FB 4M88A 1CUEA 5FA8A 2FSFA 3RB8A 1P0IA 4IL5A 1XDSA 3IILA 2YFKA 2WAXA 4LF8B 5SYAA 2CKDA 4DLLA 4R1QA 4GNKA 1Q22A 1PR1A 1OFIA 3WNZA 2JI8A 2R8RA 1OU0A 3QMWA 3A1SA 4M9ZA 3PS9A 1IU9A 4EUFA 1RAAA 3AH8A 1Q15A 4LHSA 1R3DA 2RJOA 4CCSA 2OLEA 1L5YA 3ETCA 3GEIA 3S70A 5LFAA 3MMZA 3KSDO 3SX4A 1E1RD 2X86A 5U9CA 3H83A 4DQXA 3KTAA 1UZAA 1Z22A 2WSMA 1LTKA 2G5PA 2H00A 3IMGA 5F1PA 3SN6A 3W5UA 3SVTA 3WWPA 3CVVA 4ARZB 4TQUS 1JQAA 1K3TA 4ZO6A 4RDCA 5JNSA 4PINA 4B3MB 1I33A 4MUXA 3SF8B 4LYDA 5CB0A 3A36A 3JRNA 1X9GA 2NTJA 4X8OA 1OGIA 1EWVA 1L8OA 1RYYA 1B3RA 4IFTA 3WRXA 1IMOA 2ODPA 5PGMA 4KV7A 1WU7A 2RH9B 4YJ2A 3QF4B 2YFYA 2TS1A 5IYZB 2HRCA 2ZKLA 3A58B 4P73C 3GUCA 1MABA 1SQ6A 2IHYA 3CLTC 1FBNA 1N0IA 4X3CA 5BVHA 1IONA 1IFXA 2ZROA 4GP6A 3FETA 4EW2A 4IX1A 4CKXA 2G36A 3KPUA 2Y77A 4DV1B 2OWDA 2WJJA 2C98A 2G09A 3HB5X 4OMFG 1HDYA 5IXJA 4INJA 5LDHA 1E9SA 1A2BA 4KR7A 2HSGA 2PUHA 1VECA 3ROPA 4CLOB 3DQZA 5KWVA 3HU2A 3O31A 3I5XA 3AP2A 4RTSA 1O5TA 1UM8A 3QPUA 4W7SA 3ZW9A 5LCXA 2AMJA 1C7RA 2HA2A 4KBGA 4RBNA 4AXXA 1XR3A 2WMYA 5H8WA 5CT6A 3E15A 1T1GA 2UZ0A 3D5QA 2RI0A 4KZPA 1CRPA 2NGRA 2V9PA 3CF0A 4KN8A 1XJCA 2FFBA 2QZJA 2R11A 2D74A 1GAEO 3D8NA 2WTBA 3KEFA 4RD1A 4S1PA 4PYJA 1Q3TA 5EE3A 2XA9A 2ZM6B 2PBRA 3HA3A 3MJTA 1SUIA 3GRYA 3AF4A 2G88A 4YPVA 4ATNA 5L45A 4QT0A 5HKLA 3H2KA 5D6NA 1CRZA 2GEBA 2AFHA 3D6FA 1P1KA 1ZH2A 1YNOA 3I4FA 3SLKA 4BUZA 1Y6ZA 5K3DA 5ITSA 5LD2C 3DE4X 3EQZA 1SHZA 1XWIA 1H6CA 2ENWA 1CUXA 3OIFA 3RJTA 4OREX 4BEWA 3KJGA 2YMMA 4MTCA 3LSQA 5TJHA 2VSXA 1JZQA 1BEUB 2YQ5A 1K6JA 2E82A 4OB7A 5IAOA 1GSIA 2DX7A 4MS3A 4X44A 4X3PA 3WIVA 2AUNA 4RXUA 1GFIA 1XPJA 2Q4BA 3IQIX 1LBHA 4L8VA 3ZXIA 4FNMA 3LA8A 5EMHA 5AD1A 5KDOA 3WIDA 4HVAA 1P7PA 2GKSA 3ZCQA 1FSSA 1MAUA 1FLNA 1VMKA 2O7SA 3DEAA 4HAIA 1CWUA 1H6DA 4ED9A 4ACAA 2XGSA 1I5EA 2GJSA 2VPQA 1AKNA 3AEZA 1T4DA 4GLOA 1KNXA 3FKQA 3MMSA 1DIGA 4AP9A 3VOAA 3B82A 4ENUA 3ZQKA 2HHCA 1VE6A 3CWCA 1G8YA 3C87A 5BR1A 3RYCA 4KXQA 2XSZA 4X1KA 3GK3A 1PV4A 3NG1A 4URFA 1D2EA 3DLTA 4ENRA 1P3DA 4M1ZA 3WGMA 1V9CA 3LF2A 5JNVA 2V8OA 1X1RA 1ZW6A 1C9YA 1L5VA 2C9BA 1C1HA 1X42A 3UM9A 3UW3A 1GUZA 3EYAA 2MYUA 3NBZC 3RYCB 4LF4B 1W6UA 5BV2P 1Z5ZA 3TW8A 1IXKA 4PANA 4ONEA 4MI6A 1ZGCA 4U6SA 1F17A 4QOFA 5EJ5A 5KPDA 4P5DA 5B6IA 3ROQA 2XF8A 4YB8A 3L3BA 3OM8A 1CYEA 1LNSA 4EKGA 1YUNA 3H5LA 3TQOA 4B09A 1GAXA 5FXMA 2A59A 4MEJA 4NFHA 1YAHA 4FCTA 4JXJA 4V0QA 2C07A 1D0IA 1JHVA 4GI2A 1RCFA 1GA6A 2CDAA 3C14C 4MPJA 3A9RA 1USIA 4GOJA 4DIBA 3B3JA 3R3XA 5J2UB 3F0TA 3V3TA 4ERNA 1UXHA 1V11B 1UT5A 3HADA 5AKKA 1SOUA 2YBEA 1JQBA 4ALMA 4R0MA 5AVZA 3KSMA 1E9DA 1FDWA 5T7BA 4J1TC 4HDCA 3BTOA 4J1SA 5BSHA 1M5TA 4FOOA 2O4UX 2RBGA 2H3HA 4K9SA 5B53A 1BD3A 3PRHA 3DWFA 2DGDA 5EMNA 4IQGA 2WU3A 3M1AA 3SZMA 1O94C 3D3NA 3N1UA 3LBAA 3MT0A 1V7CA 2FXIA 1KJNA 1J00A 1KMIY 2IPXA 4LK3A 3VOSA 4XLLA 5KNDD 1GA4A 4BMNA 1IPEA 2YZMA 5FBQB 1QB8A 4D02A 4WAUA 3KDPA 4ND8B 4ZV9A 3A5YA 3KLPX 2CIMA 1RU3A 2BISA 2AKEA 1LI5A 2P4HX 1FQJA 3L6CA 4WCDA 3RSLA 2VF4X 3LNCA 3P0RA 1OLOA 4DYDA 1EYZA 3PJRA 1U2SA 2F17A 3PFCA 5IXSA 2F3SA 3FWYA 2ZANA 4IXNA 1BC5A 2QX7A 4UPDA 3INNA 1AXRA 4Y8VA 4F4FA 4N3GA 3VH3A 1OBFO 1P91A 2OHGA 4J0HA 5TMBA 1KPIA 3DNPA 4BNXA 2JGLA 1J8FA 4NV0A 5T6MA 4WPGA 4EA9A 5LU8A 3CG4A 2Q5CA 2X9VA 3PLNA 4FONA 2VYCA 2X0DA 3A6GA 1G7CA 3H3XA 4IEIA 4E6PA 1PU2A 4UUPA 5JASA 3KKOA 1PGOA 4A0SA 1E62A 2QNIA 1U0JA 1UJNA 2P67A 1R15A 3DF7A 3KZVA 3NFRA 3SHQA 2O3JA 4Q48A 3TUIC 5CVCA 5A03A 2AMFA 2Y05A 3EH1A 4MVJP 4RD4A 5F7OA 1E2KA 1QE3A 2DH6A 3O1LA 3IUPA 4O2AA 4IH4A 1YZUA 1GQ2A 1U7PA 2D00A 1WYDA 4RQEA 3EGDB 4Q6WA 3L7YA 5AIAA 4DCCA 2ZZMA 2Y67A 4NOLA 2OK7A 1X9IA 3LL4A 1RQ2A 1AQIA 2PGXA 3RABA 2Q07A 2XHZA 3UANA 4BFWA 3IHLA 1SRYA 4TN5A 1BX0A 1T0PA 2A5LA 3ONNA 3KLMX 4MVJH 4HUQB 3ZY3A 2JI4A 2I2FA 2X40A 3A4LA 4V0RA 2Q2NA 4RD3A 3THWB 1H23A 1X8KA 2PZAA 1N0WA 2QX8A 3LSTA 4IS2A 2ZRBA 4RPIA 2RB5A 2SNIE 3S5UA 5A4DA 5K9ZA 1M2OA 5HZKA 3RYFB 3LSYA 4WJ4A 2GFQA 3MAGA 3SIXA 3V46A 4WBNF 3UT5B 1LBIA 3HKEB 3Q5EA 3RC3A 1W5AA 3MOIA 3HU1A 2ZCEA 5LZ7A 4BZWA 2CVQA 3MWLA 5BSRA 3RPEA 2YS6A 5IVHA 4RLQA 1LLDA 2XJ9A 3H0EA 3KQOA 1WCIB 1YQGA 1PX0A 2FKNA 2BR5A 3EEYA 3P9PA 5TQVA 3ZGNA 3GCDA 5KZMB 3B9PA 1PYGA 1JJ7A 2B5VA 1DIBA 3U6KA 4ZRDA 4LYHA 2YY6A 1CSEE 3WSWA 1HFEL 2F2TA 1T0BA 4G85A 2FOIA 3AERA 1U0OC 3EQ9A 1LC0A 4XQCA 3ZWPA 3O75A 4XCVA 1RVDA 5IT9A 1XKXA 3O2JA 3X1DA 1HE8B 2NP7A 2NOAA 4BNIA 3OF5A 3V1NA 3AERB 4GMGA 4LCJA 2IKSA 2ZUVA 3W9YA 4B4VA 3IBTA 3O82A 1M2EA 4GM1A 4MGZR 4AMBA 1ZR4A 4IVPA 4MVCA 3CC8A 5BYBA 5HKOA 1LY1A 2WABA 5M3BA 2OV1A 5IRCD 3ZJ5A 3S8EA 2NYRA 1G5HA 1BXZA 1M2VA 3K4PA 1FFCA 3NIWA 1U2QA 4UM8B 2Y93A 3F8TA 5DX8A 1GNTA 4G5FA 4ZIRB 5B4TA 4XFKA 2PN1A 5KWJA 3L1AA 4NVRA 2A84A 2CK3A 5EA2A 1T35A 1YQTA 4IQ8A 3PC4A 2XODA 2V9ZA 2I2WA 1OE0A 2FQYA 3JX9A 4HPWA 2BSXA 1TT7A 4I9FA 3UK0A 5LWHA 1E2MA 2YWRA 4ZP1A 4CKWB 2HJVA 2OO3A 1XPRA 3FVTA 1KHTA 1RM3A 3T5BA 3TLJA 3T8YA 4MRAA 5ICCA 3T7TA 2D1YA 2NO0A 3RUHA 2IPMA 4PZDA 1R9GA 2JJ2A 5D01A 4TYWA 1PZNA 4ERXA 3GFQA 5C8YF 4O4IA 2MYTA 3W79A 2QUAA 4XYEA 4ZZ0A 4IFEA 3WQQA 4ODIA 2G9UA 6GPBA 4FGJA 1BVUA 1N92A 3GMSA 1HM5A 3MUEA 1QGYA 5H7XA 3K9FC 1HX7A 2JAHA 3FUXA 2OXIA 1GLVA 1XTTA 1ZRNA 1QHYA 1U8UA 2JFOA 3A6KA 3JVIA 4JYCA 3VBCA 3GJZA 1SCDA 2VUSA 1RJEA 3C70A 4BQOA 3CUSA 5DULA 5L4SA 4NJEA 4OOFA 1WY7A 4HI0E 4KJZA 5IJXA 1ZM4A 3VR0A 3L8CA 1JBKA 1JSXA 4I50F 2O8DA 4UFPA 1OSNA 1W0JA 2E49A 2VDUE 5DLPA 1KQ3A 4N49A 4M38A 4YAEA 3Q0IA 2Z5FA 4GBMA 1E2NA 1P33A 3GT3A 3EEIA 2B83A 4AXBA 5KUTA 2CHEA 4HH4A 2QMZA 2XUQA 3LDAA 4TRNA 2CNKA 4CW7A 4G0YA 1XZCA 1U63A 3VYWA 2YR0A 4CL3A 1EFTA 4YQEA 1NPDA 3CEJA 1RHKA 1L5HA 2QV7A 5HIAA 1NKTA 5CH3A 5JZOA 1SVMA 3EEQA 5BMVF 4MWCA 3AR4A 1Q1NA 4IYJA 4PG3A 3CEAA 2XMCA 3UMSA 1MOSA 5ALMA 2MSNA 3L07A 3ER9A 1CEYA 4FB4A 3P8TA 1Y7PA 3VAAA 1YQEA 1WB6A 4U6NA 3JSXA 3ZW7A 1VG8A 5K1XA 3DW3X 2OBLA 4QUDA 4WNIA 5C2JB 5GV8A 1CY1A 3P9QA 1N5MA 2YFQA 3LA6A 1A27A 2XYQA 4I0WB 2QTRA 4TZ6A 1J7KA 2WSSD 2IEIA 4TQAA 2PLFA 4YUZA 5BN3B 3KETA 4RIGA 2G6TA 4WOCA 3S7ZA 2EWNA 1MNQA 2F3PA 2H65A 4HTFB 1TJ5A 1Z47A 4EB0A 2UZ4A 2WIGA 1ZS9A 3O3MB 3C48A 3U0BA 1E1QA 1OXUA 3E5MA 2R4UA 2YN0A 2HTEA 1L5OA 1O97C 3HYTA 3O1HB 4JC5A 2C4HA 2JJQA 3AKYA 5ALEA 3I2YX 3GJYA 4BFXA 1KZHA 2CJFA 1BXKA 2HIHA 3SS7X 4IQFA 2EBHX 1KHHA 2H57A 3FSGA 4FZJA 4I5EA 3VTKA 3RF6A 1N75A 1XCGB 5DYGA 4TZ0A 2VI5A 4S1WA 2VT7A 1AQJA 2QRZA 3RNOA 4L85A 2HUPA 4HQNA 3RFVA 2JA1A 4NMHA 4FBLA 3FMGA 4WVLA 3IUJA 4BBZA 2C3OA 3OKCA 1PCXA 4F91B 2WT4A 4C4PA 1OVGA 1NY6A 3P52A 4Z8XA 3E6AA 2APJA 4M86A 4AM8A 2LW7A 1COWD 3VVBA 1VKHA 4CH5A 1Z6PA 3BYZA 4BTVA 4YY3B 5J3JA 1RE0A 2C96A 1FQKA 4RF3A 1DRVA 1YR1A 2PVCA 3ZE7A 2YIMA 4U5XA 3BJRA 4QULA 3U7EB 1PJSA 4U2GA 5J1TB 1QV7A 5MF6A 1GAWA 2DQSA 5EJMA 3KQVA 2UAGA 5IZCC 1XSEA 5A9TA 3A1FA 5FWYA 5KNBA 4MKGA 4YC7A 1UAAA 2BF4A 5EKTA 5GVSA 1SK9A 2AW3A 3KZCA 3KOWA 4H2TA 2K2WA 2V7GA 1U1IA 1OI4A 3T4EA 4BO1A 4ENTA 3FF1A 1Y4UA 3OOEA 1PWHA 2GXAA 5HZGA 3IH5A 4J9UE 4PSAA 1DO0A 2QXYA 4J0JA 4I7EA 3H0KA 1YBAA 4MGEA 4GBGA 5LPNA 4HLNA 3J7AC 4H4EA 1I7QB 1L5NA 4BAGA 4MAMA 5FTWA 3JQFA 4FDTA 2IOHA 5FR2A 3U2QA 3BSFA 1NMYA 3NEYA 3SY8A 3TUPA 3N0TA 4C89A 5BUSA 5IANA 3UFXA 5LZ9A 2FSGA 2XXAA 3DOJA 1H2BA 1P0QA 4XQ0A 3GBPA 1HYHA 2VCHA 2BFMA 3AUYA 4DR7B 1H1DA 4BPBA 3LKVA 2XWBF 1TCBA 3GWGA 4B31A 4DUGD 1PYSB 1C4XA 2XXAB 4HNUA 4G6ZA 1RHRA 1T10A 3OJLA 1XTSA 5L3ZA 4GT1A 3I4CA 4Z3DA 3GNSA 4Z4IA 4U5QA 1C1YA 5IJWA 4UQLA 3MZ0A 1IAVA 2J8ZA 3GFFA 2FF7A 3W9BA 1C29B 3EPPA 1ACJA 1P4AA 4UASA 1BO6A 2J6IA 2C7IA 5EESA 3NWPA 2OA0A 1BDHA 3ICCA 1K0FA 5ITZA 4XTUA 3NHZA 1UZLA 2RMKA 3PVCA 1E1YA 3C7TA 3HJTA 1P80A 2UV8A 3HCCA 1IHXA 1VDZA 2Q1SA 3HSKA 3K32A 4Y6QA 4B47A 3ADCA 3IP3A 2B61A 2YZKA 3NZEA 3QFHA 3P8YA 4NCJA 3RIEA 3T7RA 3ZNOA 4DEXA 5EZ6B 3CNEA 5AVTA 1WS6A 1T9HA 1P4JA 1TJNA 1Q1BA 1UQTA 1V1JA 3IE2A 4IO0A 4R1OA 1SXGA 3CUEF 3F6RA 3G9XA 2QNBA 1HH4A 3E3LA 3I3OA 3IODA 4LJLA 4JJIA 3K6JA 4FU0A 4D81A 1QU2A 4HYQA 4ITRC 3W5HA 1CDDA 1F2UA 1R0BA 1XLVA 3CR7A 4XGRA 3IAM1 2FFJA 3VYTB 1R74A 2CHUA 2VH2A 2Y9PB 3M1LA 3OCCA 1P18A 3GRZA 3RVRA 4ZHSA 1VQ1A 4KQWA 1E3MA 2DUWA 2ASVA 1T5OA 2VSQA 1CUCA 5L4LA 1F2UB 1LRJA 3M2PA 1AZTA 3LM8A 4J03A 2HLDD 6REQA 4Z4FA 1N4AA 3Q10A 1GNRA 5CUQA 1RJWA 2CJPA 4EP1A 1I36A 3AEKB 4UQPA 1Z15A 1XTKA 3CPSA 3IURA 4IZIA 4QUIA 4U1RA 4LTNA 2CDRA 3B7WA 1L7DA 4LC9A 4R8VA 1BKYA 1IUNA 5IW8A 1ZNQO 4C0WA 2NVOA 2EJTA 2L17A 2VHYA 3LLCA 4MW2A 1VKOA 2WYIA 3JARB 4J0EA 4WJKB 3V8BA 4S1VA 2A0FA 1LVGA 4F1WA 1C9NA 5JANA 2V3VA 3GGPA 2PUGA 1T4CA 2AKAB 7GPBA 3HRIA 3JQ8A 5EIWA 4DPMA 2IU0A 2Q6KA 4HDAA 4ZAYA 1KKLA 3H97A 2V96A 2BKVA 1HYQA 1W5EA 1NRWA 2GCGA 3HXQA 5BR8B 2GVNA 4TLDA 1U0HC 2H1WA 3K2EA 1IDOA 1MH9A 3DBVO 3JQPA 3FTCA 3ILXA 4P9NA 1AT1A 2W00A 2HCFA 2KBEA 4ILKA 2PAAA 4G56A 4L50A 4YRAA 4IQ0A 4DA4A 3IAFA 2NQ2C 1JIKA 4ZQGA 2A2ZA 3SBOA 3QPVA 4PFSA 1U98A 1T9DA 3JATA 4DLBA 1E3WB 4RMNA 1QVVA 1T3HA 3AO0B 5FWDA 4MQ5A 4P71C 1XZDA 2OCAA 1AK2A 3H75A 4RHEA 3KOMA 3DFKA 3SYRA 4B3SB 1XFAA 4YREA 1XKTA 2BTEA 4QRDA 1TYAE 1GPLA 1YS6A 3CGGA 3KVVA 4NZYA 4C01A 3L6RA 3VX4A 1AK9A 1U2GA 4JELA 3BL6A 2XD9A 3PQ6A 1DJQA 1FJ2A 3NHLA 3H04A 3FUCA 2EGGA 3MXOA 2BHSA 1MJNA 3HBLA 4AMZA 2HSZA 1OBHA 1WDMA 1I6KA 2MSEB 2ZXEA 4JU8A 4DHWA 1P75A 4OOEA 2EX1A 2QDXA 4H6XA 4CLHA 1F2DA 1KVSA 4RIFA 1CF2O 1OGYA 1CUAA 2CHFA 3MXTA 3OWHA 1TLTA 4RC9A 4LIPD 4J76A 5THKA 2KPOA 2R79A 3VZPA 5LN1A 1YDHA 2IZOA 3IV6A 1GAQA 3MA0A 4FI3F 2QLBA 4WZAB 3HUFA 4WN3A 3F5FA 2ONCA 3TGLA 3RUXA 2NPFA 3E0XA 2NUAA 2DUNA 3CRVA 3IP5A 3JWJA 1IUKA 2H9YA 3L7MA 4QQ8A 1XOIA 2ZCUA 3DTVD 3CR3C 1XZEA 3Q6IA 2XI4A 3RG2A 2Z6UA 1U9IC 1CQWA 1J2TA 5K3BA 3UICA 5GJCA 3TLGA 5KTMA 1XCOA 2BBTA 4MQ6A 1F0NA 2IKQA 4IQ4A 1RLIA 4R6WA 3U9TA 4XSHA 3MNFA 2ZUCA 4L0MA 1SD2A 3PRJA 3TLGB 1SCKA 3P94A 3AYXB 3QVMA 2BFDB 4PBSA 5LNK1 2P5IA 1TPZA 1D3AA 2NZUG 4AF8A 2Q1YA 2ATCA 4AAYA 1WMBA 5ILGA 4J43A 3VI3B 5JYBA 1AVTA 1EXMA 1MC5A 3PEUA 4W8GA 1LPBB 5JDIC 5DASA 1J2UA 1EDDA 3PDIA 2QUZA 5DYIA 1AMUA 4BGIA 3OZEA 3EBOA 1VKNA 4K9RA 4YAWA 2WJIA 3K5IA 3WRVA 4M36A 3OURA 1YZYA 1I5OA 1C8KA 4MB2A 4YGXB 1ESCA 1J9EA 3KJXA 5CP8A 1EGMB 2XMGA 2Z3VA 2WB4A 3KL4A 4MVJE 5LQAA 1FW8A 1P9LA 1Y8ZA 1BCRA 3FYSA 1T8TA 3D7RA 1II9A 2YWHA 3E8XA 4CKZA 3BGOS 2IIVA 2PRYA 3L0ZA 4EQ6A 4MS4B 5I8PA 3FMFA 1EK2A 2X0IA 5IMBA 4HC4A 3OTIA 3HDVA 4FOLA 1DAFA 3PPYA 1BCRB 2DFKB 4FGZA 2CUZA 4ZANA 4D99A 2BLLA 5IT5A 5EUMA 4EQ6B 5L3SB 1PL6A 1AV7A 2VSNA 4TVKA 2H1RA 1GKUB 3AOEC 3DXYA 4YVFA 4BE7B 1XNRB 2H8GA 1JE1A 3AQ4A 1FRVA 1KVTA 2V97A 4FXPA 1IZYA 1RXEA 1WZNA 5H59A 5TT0A 3HCPA 4I9NA 1GPBA 1XYGA 2AK3A 2RG1A 3QHQA 1Z35A 3ZXSA 3CCFA 2ZNJA 1N5KA 1C1DA 1RRMA 5JJCA 2HWYA 1XAJA 3FGNA 4EH1A 4Y0AA 2HFKA 3V7FA 5MFZA 3VBEA 1O08A 4TUYA 4OSOA 1OUMA 1D4FA 1KYXA 2PVPA 2ZPUA 1E6UA 2JFHA 5KKNB 1L8AA 4HUJA 3GLFB 4LJ5A 4N4AA 4CIXA 5IDWA 1SXJB 2BIFA 4MMZB 1AKEA 3HN7A 4QU5A 4NHOA 1UBRS 3G8CA 4R54A 1H69A 1H4QA 2J3MA 1MT3A 4YR7A 4P8RA 4ZMBA 2GD2A 3EWIA 4RJLA 3RVJA 4MQBA 1A9YA 1IB0A 3B6KA 1XCPA 4OVKA 4AZTA 3HLTA 1U81A 2G82A 1QJ4A 5HX7A 4N41A 1SHTX 4X1OA 8ABPA 4G26A 3HJCA 1TM2A 3GPLA 3JV7A 4MYUA 4QGHA 2VWGA 5AXBA 4JI3B 4E15A 5ICSA 2J6CA 2JDID 2IDZA 3NTOA 3ZLUA 1DRUA 3ESXA 1U6KA 3IIKA 3P2EA 4KE7A 4UD2A 2D4AA 4AX8A 4EYKA 4EY5A 1H1LA 2A0XA 4HAWA 1USYA 4X65B 4KREA 1JKMA 4Q4CA 1TU0A 3H5NA 3QMPA 2EHDA 1K63A 1P4SA 4P58A 1Y4SA 4LVLA 1J25A 4Q24A 1Z5NA 1VYVA 1R16A 4LVMA 2QI9F 3LRXA 2AN9A 3E5RA 3SYNA 1RJDA 121PA 1N5LA 2E5AA 2CFCA 4UNQA 1NW8A 3F7NA 2YJ5A 4DUYB 4QM6A 4E6EA 4KK4A 3RHTA 5IJ9B 4N40A 1ULAA 3TB4A 5CTAA 5DPMA 1C7ZA 1I7PA 4JB3A 3EVGA 2JFNA 3I30X 1XPOA 1G2OA 4B75A 5I9SA 4HT4A 2FPIB 2HYIC 3PJFA 4DA0A 4U2BA 3GYBA 1JJBA 3AHIA 1G5RA 2SKDA 1KWGA 3GZNA 1EG2A 1A5BB 3RSGA 3RCBA 1KGSA 2WIKA 2M32A 2Y0EA 3QXXA 3KX2A 1MRNA 3EA0A 1KFEB 4UBNA 3MQZA 1CLUA 3A26A 3KFVA 3WQZA 5FUXA 2AA3A 2WPDA 3HFZA 4A5SA 1CETA 4QUJA 1IE3A 3IUBA 4LRXA 5L3VA 1DIAA 1EJBA 2JIZD 3LTNC 1E1DA 1TX4B 2I4NA 1SC3A 2IEBA 1JB9A 3AETB 3SDBA 3LVQE 1EI9A 1O6CA 3HFZB 4Q4JB 4TTIA 2XCQA 4LTDA 2W8BB 3B5JA 2HMWA 3HJFA 2IP1A 3LUHA 2V7EA 4L4YA 4NFLA 4Q01A 4TV9B 2UXCB 1T15A 2RARA 1QK5A 4EUSA 4JVOA 1MJGM 4OGGA 1YCFA 2WV9A 1VG0B 3H2YA 3OJEA 3UJHA 3VVCA 5HUQA 2R6ZA 2WFMA 4DCMA 4LSMA 1FDTA 1QORA 2HQBA 2GJ4A 1OFHA 4OP2A 1HNWB 3A27A 4IHAA 1OASA 4M76B 5EFOA 1M7BA 5GJWC 5JAOA 1GNVA 1AOXA 5FJJA 1VHJA 5BNWA 1EBUA 3EG9A 3T12A 3RSHA 3KZNA 1QJCA 1NURA 1OREA 3LH5A 2Q3FA 4KU4A 4RJJA 3NUZA 2FWNA 3TLEA 2CD9A 3BAZA 3N8NA 3OESA 4K1XA 3NR2A 4HGRA 1T2AA 4HY3A 3EG9B 1EA7A 3QKWA 1QK4A 3IUEA 3ZWCA 3ZCUA 4MVJI 5BSGA 3R6DA 5D51S 3L6OO 3HCEA 3KKZA 4GKAA 4RAQA 3GU3A 1R6DA 1NBEA 4DMHA 1IQUA 2VATA 5JNTA 1ZWLA 4ZMRA 4DLNA 5CITA 1Q0TA 4RPHA 1Q7RA 1QYDA 3WTCA 1P1CA 4JZYA 2E1HA 1NZFA 3PEEA 5B7NA 1I1OA 2A0YA 2J67A 3OJCA 1U99A 5EQTA 3GEEA 1I2BA 4D3SA 5AQEA 1YDFA 2PLRA 4BQQA 3LG2A 3CN7A 2INGX 5AVVA 1KYTA 4IEFB 2O8VA 3RU2A 4DLXA 4H3SA 1IEXA 4OXNA 3RC2A 4DM7A 4P54A 5TQ0B 2N3ZA 3LT2A 3BWBA 4M98A 4N6OA 2EKQA 2EGHA 1C8LA 1P7CA 2OHVA 5FHQA 1RAHA 3CPJB 3FOCA 4LJ6A 4CEIA 4YLGA 1RQGA 3UA4A 1PL7A 2X9LA 3AR9A 1X7ZA 5TPZD 4BNUA 1PBTA 3GVPA 3VPFA 4TWJA 3KT3A 3C5CA 1WX1A 2GZ2A 3PKJA 3EAFA 4AP5A 4A8HA 5ALZA 1SU4A 4DVJA 2DEQA 1WSWA 3H1EA 4H2XB 4MVYA 2QY6A 2VP5A 3K9LA 1V37A 4L8FA 4PIMA 1TYCA 3E23A 4Y1RA 4CI9A 2CKMA 2Q5IA 3KTFA 1KZ7B 5F3RA 3PEYA 1AN0A 3V1MA 3AF5A 3RVLA 1E4VA 2OP0A 2VPIA 4G1MB 2GJKA 2R5WA 3KAKA 1DCKA 3EVZA 1XHLA 2ZDGA 3BMQB 4XQ9A 3B48A 3L5KA 3WSTA 3NO4A 3OETA 3QYAA 5CVDA 1BYUA 2ICAA 2V7TA 1P1RA 4EEKA 4JYAB 2BFEA 3ODGA 1B14A 1USUA 3GT0A 3EK2A 2QLMA 2ZT6A 1JX6A 4F6CA 4ALJA 2IOFA 1OWLA 2QZZA 2XV1A 5J4KA 3QTBA 4CM3A 2IHVA 4XB6B 2VRBA 2V7UA 5ALGA 2R4TA 5LZ8A 3L7OA 2NU6A 3OTQA 3WISA 3RG8A 4ZO9A 4CMEA 2HFJA 1WTCA 3BIJA 1DKMA 1P4HA 2AKWB 1P7ZA 5F5NA 3IPLA 3DGFC 3QFRA 1Q50A 1JH8A 3I2HA 3L8GA 2NU6B 4E94A 3HDYA 1VP3A 3D6JA 3UK7A 3CLHA 3FNFA 4MDYA 3HWWA 2B82A 3LECA 1WPQA 4PLGA 4PX3A 5CB6A 3CRZA 2XCRB 2QOEA 3NBKA 1TF5A 3BORA 3GG2A 3L6DA 3PDJA 1DO2A 2ZR2A 1LH0A 4GPAA 1JFLA 3FPBA 1K1EA 3COSA 4U7GA 2JLZA 5C8VA 4W6ZA 3PR1A 4QT4A 2R84A 3UB4A 4IBOA 2FW8A 3TLMA 1C14A 1X2BA 1TM5E 3ZCTA 1K88A 5B2ZA 4P3YA 4HNRA 4ZU1X 3WLAA 4ZZ3A 3TX6A 1HGXA 1MJHA 5LDDC 1Y7HA 2IYYA 3RU9A 1SY7A 1TFUA 2NXWA 2Q3EA 4Q00A 1T3GA 4Y2JA 1EEHA 1FNMA 2GZDA 4ZV7A 1U0GA 3QY9A 2ISCA 3IPAA 4PFQA 5DXJA 3ZTYA 2P2YA 4KRFA 2RE8A 4K9DA 1BXRA 1UKBA 4PSKA 3DMYA 2GZHA 5DOZA 3IDZA 3SSMA 1N2XA 1YZFA 2QUHA 3HB9A 5ADHA 1KBQA 3RJ9A 3TRJA 2C94A 2FMXA 4J0QA 3D7SA 4EHFA 2ZBQA 2VLIA 3Q3GE 4XU1A 1Z6GA 1UM9A 2VDWA 2WBLC 3W9UA 5B58T 3KRTA 5CVEA 4ENVA 4PYOA 2QYOA 4Q7JB 2Z98A 3OZCA 1P0CA 1I0IA 2XUKA 2YNMC 3NHJA 1RBQA 4I19A 1FUIA 1UADA 2A5DA 1V3UA 2AMLA 1GQYA 1QF9A 2FN8A 3LLVA 5AI9A 2H1CA 3WLFA 2G76A 2O2XA 2VDWB 1U2RA 2OCIA 5B1IA 3CMMA 1AD2A 1MG5A 3E3MA 4FD3A 4W1QA 3BZBA 1S96A 2WJ6A 3M4XA 4Z7QB 1DPGA 1OFUA 5KBYA 1PV2A 3WGQA 1S2OA 1VB5A 2J5QA 3NHFA 4EYQA 4EUKA 2V6JA 4CH6A 3NNDA 1F1BA 1BIBA 3WL7A 3C8ZA 3JQ6A 1UPAA 3AEYA 2DBVO 3A4MA 1YASA 3Q7PA 1B73A 2QIOA 2HV9A 1QHNA 4WNAA 3PYMA 1BJTA 1PKXA 2VXBA 4AKEA 4ER3A 3OJFA 2C2GA 2QB5A 4E3WA 4EGSA 2F3TA 3GIWA 5D87A 5EE1A 2MCFA 3VR4D 1EM8B 1E60A 1QP7A 2BGNA 2D5AA 4WNAB 4YMUA 4PPNA 3MB8A 5CM9C 3UTCA 3BWXA 3KE8A 4IRMA 4Y6SA 3CW2A 3FM9A 5JOQA 5EHQA 3RFTA 3TNLA 5F9HA 4J0FA 1O8BA 2WJPA 4HDMB 1ZM7A 4J2OA 4ICIA 2ZU0C 4F5WA 2QQ5A 3TR6A 2G5TA 2P9CA 3FHCB 1A8SA 3ZQJA 1U7TA 5HFAA 2JJYA 3ZY6A 3HHPA 3C1TA 2LR0A 2CEKA 3V8RA 3PXBA 4JL6A 1XU7A 3PUXA 1POWA 4G2TA 4MJ7A 4QTUB 4RIHA 3TI9A 3THXB 1BWRA 3BXHA 1GRNA 1FTGA 1PNQA 4UREA 4WCFA 1FXWF 4MI3A 3SEZA 4YLYA 5HQ3A 3PEVA 1RI3A 1U1DA 1W1IA 4U4AA 4OIFA 1PT9A 3SNKA 3P97A 3SJZA 1CNMA 1ANKA 2ZRQA 2FVXA 4U2DA 2VF8A 4MQLA 2CMKA 1E61A 4IFBA 4BQIA 2Q8PA 2HY7A 2I7TA 4WJ3M 1OAOA 4ARIA 2PA3A 3RU3A 4LZZA 2Y1EA 1XJ5A 4GVXA 4DRXA 3GLGB 5D7NA 2NZJA 3W7AA 4BS9A 3P71T 2IU6A 5AKLA 5JW6A 3WLQA 1N2CE 2VRWA 2VJYA 3PC8C 1A1SA 3H4IA 5D5QA 2A4KA 3FXAA 3VJMA 2GQ0A 3JZMA 3USCS 2W83A 1SXJC 2CZQA 3A3KA 3PFGA 3O4VA 1NM5A 1IDN1 4MRVA 4R2LA 4YRDA 1G51A 2EZ4A 2WF6A 4X9XA 4ZTBA 5IKXA 1S3FA 2AN1A 2H7YA 2HUNA 3CXUA 3EBPA 3HYSA 2QE7D 1T9GS 3C3KA 3K9WA 5HIKA 5KQGA 4JJEA 5INTA 4B3FX 2C1EA 1CDEA 1NJ8A 4C7VA 3KCNA 2CB9A 3NCTA 4CVNA 1IBSA 1NRXA 4Z51A 2NUPA 3VJRA 1EE9A 2IYAA 2J46A 2GGSA 5CRIA 1YQDA 1Z28A 2HRDA 3IX7A 3LDFA 4ENSA 5IF3A 4E4YA 1A8UA 3COYA 4FDAA 4JWKA 3RTDA 3EZLA 4XTZA 2VT6A 1K0UA 1OH8A 5E4YA 3GWZA 3T5CA 2C8KA 4CCYB 4D4IA 3LO5A 1JPJA 2NUPB 2P9YA 2WJGA 5AW5A 3PWTA 3Q6NA 1I3KA 3FY4A 3H8JA 2NX2A 4FCCA 1IUOA 4HX5A 4K9KA 2C9ZA 2P3OA 2W6CX 3OF3A 2Y1GA 4JT2A 3GT7A 3F4KA 2BV3A 4AY4A 2BHTA 1JV2B 3VKHA 3F97A 4ZQHA 5K51A 1TTTA 3HJUA 5KOJA 4K9MA 3RRNA 2BBWA 2UYQA 2CLSA 2DVMA 2GI4A 4OQZA 3W2TA 2CYAA 1NIJA 1XN4A 1XTVA 1GUFA 1HT3A 1T1SA 2DLNA 4EJ2A 3FWKA 1ZOPA 3V8KA 2FPKA 5EKXA 2HSJA 1DT5A 1SVIA 2LV8A 2AJCA 1IB6A 3FZQA 3VV2A 3V4OA 3CKMA 3NCHA 2PMKA 3G7SA 1FP2A 4NLLA 4Q1AA 1CUDA 3SIWA 7ABPA 4H2VA 2ORWA 5LA6F 3L41A 4BXOA 3AKDA 1YDWA 2XXJA 1RC8A 1RWOA 4CM9D 3NVKI 1AB5A 2CLHB 1SHUX 4P5EA 2ZBPA 4HQRA 1H93A 1UOEA 3VAYA 5AKJA 5BR4A 1Y5LA 4Z6KA 4KDEA 1CP2A 4EG7A 4HPXB 1PNOA 3J80A 2GFHA 4NOJA 1D2CA 4BZPA 4YCWA 1JR6A 3QHPA 1C0KA 3FUTA 4RMJA 2VTKA 3NPMA 4UE6A 3NKLA 2FPGA 3D3WB 4OK3A 2WTUA 3I1YA 2BDEA 4M60A 2J4CA 5B1DA 4BEVA 3LXMA 1DJPA 5JCOA 1EFUA 2ZP1A 3I6YA 3PR2B 4NCBA 2JCVA 4K9QA 1HL3A 1RQLA 4GAEA 4N3CA 4QARA 5EGNA 3NTRA 1AQLA 4QJ5A 3WIEA 1WB5A 3ZH2A 3IQHX 2YHSA 2GBCA 1ZD5A 2PWPA 4Y2RA 1YUMA 3OD5A 4G65A 2ZSJA 1T13A 3C3CA 5DOVA 2ANCA 2IL1A 4PAWA 3JASB 3N2LA 4FSXA 2CMDA 4NEHB 1K92A 1ACLA 4QDZA 2OV6A 1GGMA 1GPH1 2K6GA 4YLEA 2Z8ZA 3MINA 1X1QA 1V6SA 5A2GA 3T5MA 1LV8A 3ZDXB 3GDGA 4CLXA 2AEEA 3RL6A 1RWQA 2CLMB 2YJ6A 3JCZA 4R2MA 3M6AA 4WOKA 3TRFA 3TS1A 2I6QA 4E33A 1V2GA 1Z6TA 4GECA 3IEXA 3O2QB 2VIIA 3PNMA 5DN6D 1LSJA 4F3YA 2AYXA 3DYVA 1MAHA 4WACA 1IBCA 3KKMA 3IOEA 3ORHA 1HE3A 4R83A 1Q0HA 2YWGA 3P0JA 3PZBA 4ZRMA 3WFJA 1M8PA 2NPIA 4OLFA 1YR3A 3GFPA 12ASA 4PXAA 2I29A 2JEYA 1BWPA 4I1RA 4KQCA 4QJ4A 5DTQA 2A3NA 1CUFA 3WR5A 2HT1A 2KMLA 1FX0B 1M2FA 3N76A 1HYBA 3N6RA 3W3SA 4Q3LA 1J5EB 1RKBA 4IDPA 3C6QA 1RD4A 4GM0A 2PCLA 3C24A 1FCJA 4Z4EA 2BGIA 1AV6A 1TO2E 5JT1A 2GEDA 1VIYA 2DSTA 4E5SA 4UOEA 3PQEA 4DV3B 1NX6A 4WZAE 1XVIA 3D4OA 1TF7A 5ICGA 4X7RA 2RK3A 2WNSA 1FRQA 1UWLA 4QUGA 4TVBA 4D3ZA 3BGIA 3TZBA 1B2RA 4I36A 1H2EA 1LGYA 3JAKB 2DJZA 1LW6E 1XTUA 2VJQA 3V8JA 3AONB 3W8DA 2HOQA 1B2LA 3ED5A 3QVSA 1TAHA 2F90A 3G49A 2XB6A 1QRDA 4FFLA 5JRZA 3IQXA 1KEWA 2NTNA 1X14A 1B16A 5HEKA 1U11A 3Q7QA 2XMZA 3MRVA 2B8JA 2QV0A 1PNVA 4DV2B 1TM4E 4G9GA 2N42A 3L04A 4N0DA 4PSDA 4DT1A 4Z53A 5E7IA 5IXYA 2AOWA 1Z5OA 2VUHB 2Q0HA 4IIUA 1L1FA 4NHEA 4N82A 2AHOA 4FILA 1A2QA 4D43A 5KYXA 2R66A 2XAAA 1PR4A 2PMDA 3NJRA 3M7IA 1L7VC 2ID4A 4FMPA 3VDQA 1YIAA 2AR0A 2V54A 1BCSB 5EZYB 4X63A 3T3DA 2QRPA 1CUBA 4EGAA 2ZSKA 1WO8A 4B9AA 3CRNA 4FFVA 3EFBA 2FB9A 3FYUA 3O5AA 4FE4A 1WLYA 3MQ2A 5JAQA 3O4IA 1XZAA 2BCEA 3LYLA 1I1HA 2BJWA 3IC5A 4LDNA 3VNQA 4C6SA 1G63A 5SV2A 3N39C 4RGVA 2QTFA 2MMCA 1LPAB 2QTZA 2YMPA 2POCA 1QH8A 4YCLA 1JEQB 3DXXA 4MZDA 1SGWA 1IN6A 1SZCA 2REOA 3QGMA 4GPIB 3LV8A 2BONA 4MRPA 4P35A 5L95A 1D5CA 1G4AE 4Z0TA 4FJ1A 4YUAA 3R9WA 1H8EA 3OU2A 5IJAA 2FQWA 1A04A 3LTEA 3ME5A 4CMEC 2N46A 2W6ID 4FJ0A 3B51X 1F8FA 2OXTA 4PG7A 3W4JA 5KTYA 3P20A 1T2DA 5CD1A 3RSZA 4M8LA 2I3GA 5DYTA 1NN3A 3MWGA 3CLUD 3RYHB 3E5NA 3RUAA 2OOKA 1RZVA 5I7AA 2C77A 2CV1A 1V0JA 1EGHA 3FPLA 4G4GA 3LC2O 3GLFE 4CQJA 1ZRHA 4YAKA 2QRLA 2WIBA 1SXJE 2R4QA 1T9BA 3IEUA 3JRXA 3PEWA 2QR5A 4RFVA 4A8JA 1QE5A 4D1YA 4J1NA 4Q9AA 1DEHA 1TO1E 1F2VA 5H16A 1M66A 5K6AC 3TCXB 1Q1AA 1S2IA 2FE1A 3ET5A 5CA0A 2PMFA 4AO6A 4DQ2A 4J91A 1N6NA 1E0SA 2IYNA 4A8JB 1EQAA 2I03A 2HNIA 1U0NA 4Y7CA 2GBLC 5F2OA 1NF2A 5LQDA 3GVCA 1Z8FA 3EJWA 1L1RA 5DJ5A 5M29A 1G41A 4B6PA 1Z3IX 4JT9A 5CAEA 2QHXA 4NG4A 3DMDA 2DUUA 2JD0A 4XUGB 4LVOA 2AR7A 3D8TA 4Z99A 2OQRA 5A0TA 3IAS1 4KNVA 3AVYA 3W7BA 4DR4B 1T2FA 1XD2A 1NBME 3OIVA 3LUDA 2DUJA 2BD0A 4ZMSA 1Y34E 4ITUA 5TV2A 3NWEA 1NLZA 1DAPA 1PJ3A 1EP2B 2QQFA 3ILHA 4MPPA 5JD3A 4OL0A 5KTOA 3ANYB 1PJZA 4AY6A 4CJXA 5IG2A 3KS9A 2YV5A 3LC1O 1AKMA 2YJNA 2QTAA 3OQIA 4H7JA 1GUYA 2QSJA 3L01A 5AW8A 1UBOS 1YZNA 1HNNA 4L0CA 4FLMA 4XGNA 2ZPAA 3RAGA 1H6BA 2X5XA 2DHDA 2BELA 1R8YA 3U7FB 2A5YB 4KFCA 1QO7A 1BFDA 4UUMA 2E1PA 3O0TA 4MQMA 2D1RA 3ZZTA 3I9NA 4MQEB 4FJ2A 2IH4A 1RLMA 4YCAA 2H51A 1GHTA 2O2YA 3NEJA 1X1EA 4PG5A 2VRNA 3QG1A 1M6WA 5TGDA 1QYXA 3CKLA 3GEMA 4OXQA 1UZUA 1N77A 4GE0A 5KWSA 1E9EA 4HEQA 3CJQA 4IDGA 5EPOA 1IQ0A 1T3SA 2B37A 2I4OA 5BNIA 5T3YA 4JUAA 2ZWMA 3AVOA 4LAFA 5LQJA 1SOWA 1Z0ZA 2OSVA 2Y71A 2FXVA 1P31A 1OAKA 1R6UA 1ZG3A 2EDAA 2BI8A 3MCTA 4OPMA 1TM7E 1OHHD 4PHGA 1GQSA 1SCQA 4YCDA 1KPHA 1T8RA 2CNDA 2ZRLA 3II6X 4JK3A 3TNYA 2C7QA 1IY2A 2BFBA 2XE7A 4WZBB 1BFKA 4WEQA 4BVFA 1T36B 2RGBA 2A88A 2PMWB 3H8WA 4ZCTA 4U7WA 4ALKA 1QQ7A 3W9SA 2ERYA 1G3QA 1C8BA 1LLFA 1URPA 3K1YA 1VG9B 4I8XA 5EQFA 3VXKA 6AT1A 2AUTA 1E7MA 1QHEA 1JH9A 3TW4A 1GTG1 2CDBA 4KQ6A 4LVUA 3BMNB 4KWIA 4N0PA 4ARCA 2IK8A 1Z7NA 1WIWA 1R50A 1UBJS 2KM1A 3O84A 5FPHA 2JPDA 3U62A 2ERCA 1XZHA 4PGGA 4COOA 2B92A 1KQPA 1H2XA 1LU9A 4REMA 4FYMA 5CA1F 3VZRA 5EIEA 2AEJA 4BMZA 3NKVA 2Q6IA 4BO4A 2PSEA 1TNDA 1SKYB 4V2IA 2HWUA 1LLUA 2OV4A 3I2JA 2XUGA 1DXQA 2G0NA 3DAOA 3DBIA 4KQKA 4OB6A 5AM5A 1JEOA 4FTWA 4I81A 3WB2A 4MYHA 5E9JA 4UPEA 3U6BA 2X14A 4CMAA 1KP3A 3ELDA 4UD6A 2OBMA 1EFRD 2B4RO 3WAKA 3TOXA 4GLBA 4HJXA 4KGZA 4FKMA 5LYJA 1JSLA 2R1ZA 4NQZA 2M6RA 3VNRA 4FNAA 4R1TA 5ALXA 2QSZA 2ZFUA 1YRHA 5AKEA 2GRJA 3I04M 3DOCA 1X77A 5EMLA 3B78A 2LZ0A 3GMDA 4N0MA 5FNZA 5BWNA 5HP4A 1NXPA 1VHLA 3QFCA 4PPGA 5G0WA 3E3NA 5LWQA 2XCLA 2X8AA 4Q9NA 2VAPA 5E7MA 2A1IA 4B6RA 4BIMA 1TKRA 2MINA 3GRFA 1YC2A 4FIDA 1SO8A 4IJ5A 4TYQA 2OXCA 2PKCA 4ZAZA 1ASZA 4PYQA 1ZH0A 1QIKA 4UHEA 1UC9A 3AKCA 3CNBA 4TKVB 4UZFA 1GCUA 1XRMA 3PUZA 3TN7A 1MENA 1H6AA 4KLZA 1K5PA 2E18A 1GKKA 1G8MA 1KIMA 3KAQA 4OU4A 4M1MA 1HLDA 4L72A 4DQLA 4IH1A 2ZRCA 4NE2A 4R3NA 4EGJA 1JB1A 3OJWA 4EHIA 1YDMA 1NW4A 3TSYA 4LWZA 3IVRA 4X7PA 3SMVA 3ZEAA 3RKUA 1WAMA 1XVTA 2HA4A 1JLLA 1NVMB 1HSZA 4RAOA 5G1NA 3BGSA 1CE8A 1W4RA 2AJLI 3KPWA 1R3UA 3LZDA 1SBZA 2GKOA 3DKPA 2Q2VA 4R01A 1KYQA 4RQBA 5LZ5A 5IHXA 3ND5A 3IIIA 3V4PB 4NCAA 1XA4A 4NENB 2FEAA 1I1QB 3BGDA 4CEJA 1GPDG 3Q3IA 4S05A 1NDUA 3S40A 4GSYA 4D96A 4LWPA 1ORRA 4IV8A 3RROA 4D0GA 3H5WA 4D4KA 5JR3A 2OVFA 3A7UA 1MGPA 4E07A 2P1RA 2DHRA 4C78A 3PT5A 5C34B 3OICA 4AKHA 3FI0A 2QM7A 4IIYA 3VSEA 4YJ3F 1IHPA 3TNDA 2GXQA 2WF8A 3A9WA 3ENZA 3O8DA 4GZ5A 5C5CA 2H3EA 3V1KA 1OXXK 2OY0A 2XTZA 2ZWPA 3IT1A 3IVAA 3QEBZ 2IPOA 1L5RA 2ZIVB 3TTYA 3OPQA 2P0EA 3L43A 3NRJA 1EVIA 1NR1A 3AZOA 1H2WA 2I6SA 3R5FA 4P4SB 2OSBA 3TEFA 2Q3MA 5IU6A 5FIUA 5EE5B 5ADWA 2BFFB 3A8TA 3FYDA 4P5PA 2V7VA 4PQGA 3WZMA 1RFGE 1PNRA 1B00A 1WMSA 4O4JF 4BBJA 4EPYA 4DC0A 1FTYA 3EOBI 5C5EA 1YDEA 2Q7EA 1PZMA 2GH1A 2XMBA 4BBPA 5G3YA 4GDMA 2I1WA 3VYUB 3A6LA 1OYVA 3CT6A 3MQFA 3DDZX 4EY6A 1DOHA 2N1BA 2DTEA 3HPQA 3M4NA 5CCXA 3MUNA 1QR6A 1PHRA 3AHCA 2GDZA 2JANA 2WDPA 1W85B 3OJ0A 4I8IA 3VOBA 3KQNA 2VNHA 4Q66C 4P34A 3Q12A 3WJAA 4NV3A 3ND9A 4D8UA 4F96A 2B8WA 3KLBA 4M0DA 4YRTA 3H2GA 1FUEA 1B74A 4PQYA 4R2KA 4ZGWA 5I9IA 3RC8A 2DULA 4GOKA 4PG8A 1QHSA 2HJRA 1WZ2A 3CRQA 1ZJYA 2X58A 4HGPA 3BZUA 2D5LA 5BNTA 1D4AA 3IBCA 1K2WA 4LECA 3LGXA 1DC7A 2BSAA 1KK0A 2Z4TA 3KBBA 1DBVO 3RBXA 3T9BA 5HR5A 2X0EA 5L3RA 2HQSA 3U3KA 3L6BA 2FRVA 4MHTA 3AWIA 1SG6A 4DLUA 4MKHA 1G9SA 1NONA 4RMFA 4RK4A 2ZBUA 1WSDA 2AXPA 2WTEA 4Q9HA 3FDIA 4NZZA 4X3OA 5EIHA 3OT1A 3SYKA 5ADUS 5I7EA 1G0NA 3WLMA 3EF0A 4ZJYA 2IJGX 4HFJA 2AK2A 5HE9A 3F9IA 4DR3B 3ZBTA 1EUZA 1L5FA 2LE0A 4IAOA 4YXWA 4IJWA 3ZH9B 1M2JA 4RPJA 2AB0A 4AJNA 2HTFA 3TZKA 4MTLA 1QUEA 2BHLA 3EWSA 3L1KA 1EWYA 2NZYA 4ZVUA 1YJ8A 4M9RA 4N8EA 1UBEA 3S8YA 5FOWA 5AHRA 1BEZA 3G1TA 3QU7A 2D8MA 2B35A 3PGA1 4EPVA 4JQYA 2N9UA 5JMWA 3BD9A 3ZNQA 4JKYA 5DGCA 5I47A 5AM0A 3WDLA 3FROA 5JS2A 5JXHA 3TUZC 8ADHA 2JGJA 3WZ2A 1WULS 1FP1D 4W5HA 5EL0A 2OZVA 2J3IA 4PICA 1VLHA 1YGPA 2NSHA 4ZJUA 1KZYC 2D2IA 4G63A 4B40A 1DQNA 1QYRA 1BA3A 2ZYHA 1DUVG 1NT2A 4CLRB 4WUVA 1W94A 4Q9IA 2Y1WA 4G5SA 2WMDA 5LUBA 4A7PA 4E5UA 5I7OA 2V7QD 5FWNA 1E5XA 1L0BA 1VCHA 3UB3A 3N5KA 1ADCA 1J22A 2A3RA 2PRKA 2X9QA 1JJFA 1JDPA 1VBFA 4GI3A 1T2VA 1IIRA 1ODKA 3AJRA 3F5DA 2B25A 1K98A 2ZTUA 4KTVE 4MWDA 4RF5A 4BVHA 2OK8A 5KU1A 3IXMA 3OHSX 4O29A 5I6DA 4LJKA 4JITA 4EHBA 4DXAA 4QTYA 1WQ7A 1WXQA 1EA5A 1E6LA 2XYPA 2BC9A 3AUJB 2GAOA 3ETLA 3PUHA 3QXCA 4LXHA 4OHXA 3RVQA 4MLCA 3T3NA 4Z9AA 4AJ1A 5D3ZA 3JALB 2P35A 5CXQA 3EDQA 5F2NA 3TDMA 4O25A 1T9AA 1ZICA 2BUCA 1JG4A 1U9YA 3LMKA 5D6OA 3SS9X 1YJQA 3KQKA 2DCUA 4PN7A 4KIWA 3FWHA 1KXJA 1ORWA 2FDXA 1IJBA 1V48A 1X7WA 2WHYA 1ESEA 1XTIA 2FK7A 2IUEA 2ZJZA 3EXAA 3MJSA 4IM7A 4QG3A 1M1NA 2HPHA 1JXQA 4TTPA 4TVOA 4ZC8A 1J6UA 4LYAA 1ULHA 1HETA 2F3UA 3JYQA 1D6JA 2EJBA 3CZ5A 4IIDA 4QDUA 2VNIA 1JTVA 4ETNA 3GLGE 5HQTA 2WP8J 4PC6A 2FZVA 1X7WB 2GB4A 1P61B 3NHSA 3ZQ4A 5CB4A 2VDRB 3NAZA 4RVUA 4DMFA 1F51E 5IVPA 3WL5A 3EFSA 4J7UA 4XIIA 5CDTA 5K8UA 3QFFA 1L6IA 3KSRA 4L9WA 2YVAA 3HY4A 1ECGA 2WHPA 5AVKA 3WYBA 3OO1A 2HBRA 3BRWD 1MJFA 1FFWA 1Z83A 2PBFA 3K2IA 1FSGA 4I46A 3F3YA 2OT3B 1ZOSA 2GBFA 4JOCA 2CCJA 4LWQA 2ODBA 4I6GA 2XYVA 3GO4A 2RCYA 4B6QA 1ODIA 1ORIA 4A0QA 1K8RA 2ONJA 3H84A 4XTVA 2GK3A 2IXBA 3MC1A 3NOXA 4FX2A 2DT5A 2FI1A 2YJTD 4PTLA 5ELXA 2XNCA 1R0XA 3PA8A 1SVSA 1WVIA 1I8TA 3PUJA 5L3QB 3UATA 3NHWA 1U94A 4P2BA 1YRWA 1KFKB 3G85A 3OOYA 1IYZA 1HOTA 3FUVA 3FOZA 2CL0X 3ABIA 4GO1A 4JWTA 3IMCA 3TQQA 1NPYA 1TGYA 4IHJF 2OUKA 3E9QA 4JLVA 4RA6A 2Z83A 2O14A 1NQTA 2IVZA 4YASA 1XQYA 5KC8A 2TMKA 3ZYZA 2HQOA 1ZK3A 2Q1WA 2XOKD 2H11A 1U7UA 4YACA 3WBFA 3KXIA 1TVKA 4CIBA 1YF3A 1VPWA 3S1AA 3F3KA 3G2LA 5FOVA 1EP1B 2ATVA 4L28A 3OPYB 4RF4A 4GRIA 2CV0A 2ARUA 2RBEA 1DTWB 1FFGA 4JJ7A 3TEHA 3NS7A 3NGLA 4C4ZA 3EGVA 3MRSA 1TVKB 2ZJAA 1I6LA 3K72B 1G5FA 1PLJA 3SXUA 3USZA 3HY0A 1FYDA 4JY7A 1GCOA 4MB6A 5JXJA 2WYVA 4PG6A 1GU0A 1RWXA 2GILA 1X1BA 4OAOA 1P5JA 5AJVB 3EHDA 1XNJA 2OZPA 3UCXA 5CBPB 4BNZA 2IBTA 4EQZA 3VO9A 5JSZA 1ODTC 1CF9A 2ES4A 4LX0A 3LT4A 1Z0DA 1JXMA 4CG3A 3JZIA 1UPXA 2CLLB 4JEMA 4PPQA 2F43B 1XCLA 3KUDA 3V2HA 4CNBA 2JI6A 4JCCA 1EESA 1XUOA 3A6DA 1ISIA 1X8JA 3CSSA 1GQOA 3HR8A 4WLFA 3UJBA 5BW8A 1XRPA 1THGA 1VZ2A 2QK4A 3PNKA 1JVSA 2AQ8A 3BJZA 3NDBB 3DEYX 4MI9A 5H9VA 5BWOA 4ZARA 5EJEA 2HNAA 2C61A 3H1BA 2FJ0A 4KQJA 2HCTA 4ZKDA 4PG4A 4EJ6A 2C2OA 5TS3A 4JKOA 4EX6A 1VC2A 4IP0A 1XZLA 1K7YA 5KOHB 1XMSA 2ZZNA 1Y3AA 2VDJA 3R23A 2ZTHA 4JDUA 1B43A 4YJFA 5ESDA 1P81A 3DM9B 3OM0A 3KVNA 4Z1MD 4JI8B 1E4YA 3F1LA 2Q62A 3IKJA 1QWSA 5TR9A 1WP4A 4B79A 3L8FA 1YHYA 1PKEA 2LWIA 1D09A 2OXEA 2AWNA 2GNPA 2IHZA 1JALA 3CLRC 3EFHA 3I6ZA 4FGSA 4GYKA 1CJVC 1PTJA 4YJFB 2QIPA 4ZOLA 5EWJA 3TLZA 1ZXBA 2ZJ0A 3BWVA 2ECQA 2WIJA 4IDCA 2CE2X 3NBUA 2OXRA 3PF8A 3MBOA 4DLZA 1FEZA 1W1WA 3WNQA 4BX9A 1VE1A 4D4HA 3ASZA 4LCEA 4TS9A 4ZOLB 4QVGA 5DM70 1D0SA 1BG6A 4KWEA 2AMVA 3CLTD 3SGLA 5C7YA 4R41A 3JZFA 3RJMA 3OLXA 1ZO8A 2OG1A 2PKRA 1RKVA 4NAUA 3DOHA 4RVHA 5A04A 1FSZA 3SNHA 1K9VF 1S3IA 1SUWA 4OAQA 4GPD1 2OXFA 1A2KC 3E8SA 4QOIA 1NJSA 3C6BA 3EXEA 4IG9A 4HAVA 2I4MA 4P4LA 4FGUA 2I71A 5EPEA 1CRLA 4LOKA 3TKAA 2ID9A 3GUZA 5JALA 4HYEA 4IO1A 3TAHA 3EIUA 2CXRA 4IIJA 4U00A 2LTAA 3PL1A 2WTNA 1KR2A 3I9KA 4B6SA 4GLLA 1QO0D 3STUA 2B7CA 2BLNA 4CM6A 4O1HA 2O3UA 4LSWA 2ZUTA 4V1CA 5JJLA 5DRTA 2I1QA 4O2BB 2DHEA 3ZKAA 2W2OA 4OLBA 1Z6YA 2Y92A 2HIAA 3EXHB 1QKIA 4IIJB 3ICAA 1JLSA 1JT9A 3GGDA 3BMOA 4OTZA 1MH1A 16PKA 1CU1A 2W5UA 3QMVA 1BE1A 3PFHA 4C4RA 4O4HA 3ULKA 4YAUA 1VIDA 1ZVQA 3B8HA 2DBZA 3A32A 1O89A 3NI2A 4H7IA 5AHKA 5HM8A 4OUDA 2X6QA 3D6VA 2P5SA 3MS2A 3BMOB 1KDRA 4K05A 2GBPA 2NZXA 4IIFA 1I4OA 4TV8F 2OM6A 4KIFA 2O2EA 4ZPJA 3ZG6A 4MAFA 4IIGA 5EXTA 1HMPA 2K87A 3ES9A 4CMGA 2ZE6A 3HWRA 5A9SA 1LF0A 3B2QA 5A4KA 2WQ7A 4OMDA 3IP7A 4G4SP 1XDWA 2CW5A 4I5FA 5JAUA 2BGRA 1E8NA 2IY7A 2LIVA 4KXVA 1JEYA 3EZYA 3EE6A 3AY7A 1SERA 1WKVA 3W6ZA 2FX3A 3LCMA 5AT1A 3MFQA 1E7RA 3V9AA 4F2HA 1GITA 2YZNA 3GB9A 2WSIA 3RS4A 3DKRA 2IODA 2BH2A 1CJKC 2A78A 4ZAVA 3W5VA 1O95A 5C8YB 3T0FA 1DMRA 5GZ1A 3W5CA 4FK8A 4DA6A 2FNAA 2MTBA 2ZBDA 4JROA 3CVXA 3AV3A 3H2BA 1CY8A 5JVDF 1TADA 3KR1A 3QNMA 4KH1A 1ZVKA 1WCV1 3ROZA 4EDFA 1ZRSA 3DP9A 1VJCA 3IPRA 4J3JA 1ZD9A 4BGVA 3FDFA 2GYUA 4GLJA 2P0AA 2XDQB 4JLSA 4AF7A 2WV7A 2JHGA 2VTVA 3IA2A 1CR2A 1X55A 1RMTA 2C8JA 5EWMB 3CURA 3ZE9A 2VG8A 1JS1X 3REXA 1WUTA 5JFOA 3K2QA 4CLDA 2OAP1 2Z04A 4DMGA 1WG8A 3L4GA 1QFXA 2JK0A 2R1VA 4YJGA 2YXNA 2J0UA 4GE3A 4CCWA 4I55F 5CW1A 1QDUA 2EX4A 1SIOA 4L75A 5JFTA 3RTCA 3OZ7A 5M5BA 4D9FA 1G7SA 5C7OO 3NAGA 5CDFE 3FSRA 2F59A 3OLQA 3R0JA 4U2KA 2GYVA 4J4BA 2C42A 3AW8A 5C52B 3UK1A 1US8B 2FZCA 2QRNA 1QDEA 3TEJA 2R8BA 3HH8A 1OYYA 2CVFA 2RGYA 1O94D 2N47A 1J9ZA 3DAPA 2IEYA 3ZI4A 4WD3A 1N2HA 3ER6A 2YTZA 4YA6A 1QB7A 2JCXA 2I9PA 1R8QA 3COWA 5HGJA 1W19A 2D5BA 4YDSA 3ZBPA 4F8EA 5KEIA 5IUKC 1UKEA 3BE6A 4O59O 1OYOA 3I2KA 4Y1GA 4AG3A 1V8ZA 2HL6A 3KVOA 4UJ5A 4TPKA 5F76A 1I3OA 2XKBA 1UOPA 3G23A 5FV7A 5LZ2A 5JH7B 4MJXA 4WN9A 2OGUA 2X2OA 8GPBA 2Z1DA 2FZ4A 4F1KA 4F9GA 2C97A 2JIBA 3QVTA 1B76A 1SBHA 2G3YA 4YMHA 5KYNA 1RRCA 1YQXA 1XMVA 1W49A 2QTWB 3BHNA 2DPHA 4A36A 3VQWA 1CLEA 2R62A 3DO8A 5I9MA 5GINE 4OI2A 4D8TA 3LY7A 2BHNA 4EHLA 4QSHA 1M8JA 4MV1A 5L9AA 1D7AA 3O3OB 1NNHA 4I4TB 4YO8A 2FZLA 3AL0C 3HCAA 2C5LA 2VTBA 2FOXA 3QTLA 1Z62A 3ZWVA 5IC5A 4R8SA 1DOAA 1LZLA 4RMHA 1R5NA 2JJ1D 1R2QA 3IOYA 2Y1CA 2ZVJA 4MHOA 1JU9A 3KYJB 1N8KA 3OZGA 4PRZA 2H2GA 3FMOB 4DB2A 1Z2PX 4N3AA 3R7WA 1KI6A 5K05A 1EBFA 1Q91A 2GHTA 1GLGA 1SQ5A 3F9RA 4DA8A 4G3XA 5JS6A 4YCCA 2CFTA 3AEQB 4BEBA 5KJCA 1Q44A 3C74A 3QQPA 3UXMA 1I2DA 3KSUA 4M83A 3VUFA 3T7JA 4ESEA 3R7WB 1PT8A 2I3AA 3FTFA 3PHHA 4I9HA 4QYMA 5A5GA 4BNKA 2GWHA 5HOQA 3I9V6 4F5ZA 3UYLA 1RZUA 3U4DA 5AWFC 2DEUA 2EATA 1QIIA 2XD4A 2YH2A 3FCSB 4LCBA 3JAWB 1ODCA 2QU7A 4U7JA 4W9MC 2R7KA 3K1ZA 4JJ4A 4X1IB 4AROA 3DMTC 3TQSA 2ZJOA 3FOAA 4OBWA 3BN3A 4WZBE 1Q19A 3K94A 4KN5A 3L79A 3SS8A 4KFSA 4EABA 4GHWA 3LLSA 5IYZF 3RUFA 2M98A 3P2KA 1N3YA 4HAUA 4UNIA 1NYQA 4DBVO 1EKXA 2PTHA 1J42A 4OH1A 3TXXA 2PL5A 4TYPA 3UJ8A 2BFOA 2AMYA 2BH9A 2FG6C 1VB3A 1GZ7A 1C7EA 4MYTA 5E1DA 2YIJA 1G20A 3TIVA 2OHHA 1FP4A 3TK1A 2WF5A 1SKYE 3T3EA 1HRKA 3TZ6A 3U3MA 1DVRA 1YOVB 2CLCX 3SM3A 4QXRA 1TYZA 2O2GA 1ZN7A 4TLBA 1M34B 1WZEA 4F7DA 2WUWE 1YS1X 1FP4B 2I3BA 3N7TA 1WEHA 3F7MA 4PGMA 2G8LA 2W2LD 3FTDA 4MVJF 4KEAA 4RQUA 3VKWA 2H52A 2AZDA 2QAGC 2M6KA 3RSSA 4DJJA 5DE3A 4IOMA 1E59A 1ZUNA 1L3IA 2POQX 2YASA 1C81A 2J85A 2ZE5A 3DKKA 3IO3A 4J75A 3N58A 3QBDA 3K0KA 4B6OA 1BHSA 3G02A 3MPUA 4MR9A 4O1MA 3JD3A 3MJFA 4UCQA 4V0ME 2WA2A 1UIRA 2B8NA 5B6PA 4YT5A 5FO1A 3I92A 4AT1A 4BWGA 3MAAC 1UJ6A 4BP9A 4UQOA 1FMLA 3EUAA 3FH0A 1ZUNB 1RQRA 1R8JA 2RGDA 5K03A 1LA2A 3IUMA 1F14A 4OG2A 1WQ4A 5DGIA 3WL8A 3BDVA 1W4CA 4C21A 4Y9TA 2I7VA 1XQWA 1ZWKA 3A05A 1WL8A 2VK1A 2LCQA 1W8DA 2Q2QA 4S1NA 1UJ4A 1XRLA 2OGWA 1C4KA 1O9BA 2Q5EA 3IS3A 5HQJA 5I9BA 2J4FA 4ZEXA 3TD9A 1NUAA 3QLTA 5F33A 1U1CA 3AGQA 3TW0A 3QV1A 1HFJA 4AY3A 4BO2A 4ZGBA 4CETA 1GEGA 3KFXA 1OIVA 1V8PA 5AKZA 1DB3A 3H5VA 1JQDA 3OPVA 1EHYA 1EUDA 1O8CA 4RJIA 1EVQA 4ID9A 3O8CA 1F9AA 4F3CA 2Z5VA 2RHDA 3MTBA 3K9BA 1M1ZA 2QRVA 4HWGA 4QOJA 3HZRA 3MG9A 4EFLA 4ZT6A 3LDGA 1MUUA 3O95A 5CXUA 2XWSA 2JFYA 2VDLB 2X76A 5H4HA 3WGZA 3ANNA 5HVNA 4ZVMA 4DCGA 3I64A 3SBXA 1SK8A 5ERGB 2C7GA 2C4WA 3OX1A 1D6MA 3I5MA 1MA3A 1Q3KA 5FLYA 1JNYA 2J5RA 3AG5A 1FFXA 1NR7A 3WL6A 4FFOA 1ABBA 2QN8A 4KVZA 4A0FA 4EW3A 4PZAA 2X19A 3KKLA 2I55A 2I22A 4JQZA 3U4AA 3ECAA 3KU1A 3QW2A 5DT2A 3A7AA 3UIEA 2R7LA 2V5VA 3PE6A 3WY9A 5IJ0B 4JVNA 1UJBA 4HLUC 2ZVDA 4KRXA 1J0BA 1S1CA 4S0XA 4Y6PA 4NYIR 1U8CB 1XU9A 5J2UF 3QMMA 5CYOA 6ABPA 1AX9A 1N1DA 2PMCA 4LISA 4MUIA 4DF3A 3DE0X 4RPCA 1PLKA 2QR2A 3F5QA 4GXTA 5E2BA 1MOPA 2B4AA 4LMAA 4BO6A 3KYDA 4QOSA 3F73A 3AB8A 1FU7A 3E9HA 5A06A 4J0GA 4EFDA 2KW5A 4PX5A 1VPVA 5AVUA 5HUJA 2J87A 2QMUA 4D8YA 1MO4A 4GUDA 3IYLW 4R8RA 2QQEA 1QGUA 1DC3A 2LUOA 1YO6A 2YWEA 3PPIA 4L4UA 3JXEA 1X1DA 4GRDA 2DTIA 2V9CA 1Y8RB 3EVNA 3G0GA 4P82A 1JTFA 3V4LA 1UK8A 2Z9BA 4Q9JA 1PN3A 4I1YA 2REXB 4CUKA 2IE8A 3M83A 3IRVA 3OO0A 1LPNA 3UKJA 4EMUA 2GN6A 2BEUB 2R48A 1EX1A 3ZY5A 5HOEA 1R0ZA 4B6GA 4BYGA 2X7JA 3O7MA 3HXVA 2CXUA 5KYUB 1KC3A 3THYB 2JAXA 4LRTB 3HXMA 1NJ1A 1EB9A 1O97D 2B5OA 2X4DA 3AY0A 3V8VA 3CF2A 4QG7A 4KFTA 4M8IA 1H0KA 5AOBA 2E4VA 1Z0AA 5JSQA 1CXZA 3ITEA 4BC1A 3A9CA 2CLEB 3LRTA 2QS9A 1UOQA 3EC1A 3EMVA 2PK3A 2DBQA 4NMWA 4IGEA 2YWXA 3DM5A 3GVIA 4K86A 4HDOB 4CE6A 3PTZA 5CM2Z 4E1VA 1Q92A 3K53A 1GL9B 3NDRA 4R1UA 4RTRA 2C1XA 5FBRB 4P4UA 5B30A 2PKXA 4XVHA 3EXHC 4DWWA 2AMCB 9LDBA 3DWEX 1IEVA 3OIGA 4MVJD 3QENA 4I3FA 4IPTA 1UDBA 3M34A 3WYCA 5AW1A 1N6RA 3O4HA 1M33A 4FDLA 1JU4A 3WWYA 1HZZC 4TQDA 5KVVA 4TLEA 2VSFA 5HSGA 1GZ6A 2CB0A 1DJMA 5C9ZA 1Y6QA 5BMOA 3JQEA 1GGFA 1M9NA 1OWPA 3HDGA 4D98A 4EB6A 4F0JA 3NHKA 1WHSB 1PJQA 2PPLA 1R9JA 3A2LA 3B7PA 2WNHA 3URMA 3DL0A 3Q0TA 3QUQA 3K09C 2Q5OA 3F71A 4LVNA 5CT9A 4CHGA 2Y66A 3S2YA 1MJGA 2K4MA 4GC9A 3DBLB 3EZNA 3KQWA 5TY0A 1LPPA 2Q50A 3CLKA 4GPEA 2B4TO 1EWQA 1TJPB 2QVGA 2GM5A 4DMUB 4EJ0A 3EA5A 4LXQA 1RFLA 3F6EX 2GF2A 4JGBA 1EXWA 1QPBA 3E84A 5A7GA 2YY7A 3T9DA 4EHDA 4XIGS 2GN2A 1QG2A 3JZAA 3RJ5A 4EVSA 5KC9A 2DPXA 1RXIA 5I7VA 1BFUA 3PXCX 2C59A 1GTZA 2JIQA 4KR0A 4MRNA 3J81A 3KEQA 4FC6A 4OQXA 5CFZA 4B33A 4A5OA 5K8TA 1DV1A 3D2LA 1N0UA 5EJ4A 4ZWNA 3A9UA 1P2GA 1XDGA 4AICA 3QEAZ 1Q17A 1Q21A 1Z36A 2JGKA 3HEAA 3ITKA 5A62A 3KD2A 2AEFA 3ZHXA 1CDOA 5KI6A 4M49A 1ENZA 1B26A 4GIBA 3WS7A 3QXSA 5A3SA 4CXMA 2O5EA 4YMTA 5C5DA 5LOVB 1Y3DE 3WG9A 1RP7A 1PJCA 2H1HA 1YU9A 1EGVB 1QK3A 1YL6A 2QJWA 4LZLA 4EOGA 1ULTA 2ZREA 4X84A 1Z4OA