5C6UA

Rv3722c aminotransferase from mycobacterium tuberculosis
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
427
structure length
427
Chain Sequence
b'MFDSLSPQELAALHARHQQDYAALQGMKLALDLTRGKPSAEQLDLSNQLLSLPGDDYRDPEGTDTRNYGGQHGLPGLRAIFAELLGIAVPNLIAGNNSSLELMHDIVAFSMLYGGVDSPRPWIQEQDGIKFLCPVPGYDRHFAITETMGIEMIPIPMLQDGPDVDLIEELVAVDPAIKGMWTVPVFGNPSGVTYSWETVRRLVQMRTAAPDFRLFWDNAYAVHTLTLDFPRQVDVLGLAAKAGNPNRPYVFASTSKITFAGGGVSFFGGSLGNIAWYLQYAGKKSIGPDKVNQLRHLRFFGDADGVRLHMLRHQQILAPKFALVAEVLDQRLSESKIASWTEPKGGYFISLDVLPGTARRTVALAKDVGIAVTEAGASFPYRKDPDDKNIRIAPSFPSVPDLRNAVDGLATCALLAATETLLNQGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aminotransferase
publication title Rv3722c aminotransferase from Mycobacterium tuberculosis.
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Transferase
total genus 143
structure length 427
sequence length 427
ec nomenclature
pdb deposition date 2015-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12897 Aminotran_MocR Alanine-glyoxylate amino-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5c6uA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5c6uA01
1DGDA 3B1CA 2ZY4A 2ZUKA 1O61A 4PVFA 4ZAHA 3FZ8A 2FYFA 3AELA 3I4JA 4N0BA 2QB3A 3A9YA 3EZSA 1AJSA 5K8BA 1AMQA 4IYOA 3RCHA 8AATA 1FG3A 5HXXA 2F8JA 1B9IA 4JE5A 4WYFA 3JWAA 4ZDPA 2ZC0A 3FSLA 1IX6A 1AY4A 1AX4A 3A9XA 1W3UA 3MC6C 3WX9A 4IXZA 3FFRA 1W7LA 3ASBA 2EGYA 1N31A 2WK8A 3R4TA 3MBBA 4BHDA 2AATA 4JEVA 3NX3A 1OXPA 4LC3A 1BJNA 3LVJA 4ITXA 4A0HA 4RJYA 1I48A 1QITA 3BS8A 1LC5A 2HUUA 3RBLA 1QIRA 1OHWA 4M2KA 3T32A 1D7RA 4M2JA 4LNJA 1BT4A 2R5CA 4OBUA 3I16A 2Z61A 4OYTA 1TASA 3DRDA 1W23A 1W7NA 2DKBA 4ATQA 2X3LA 1I43A 1B4XA 4GRXA 2FNIA 3DU4A 2W8VA 3DC1A 5J8QA 2VYCA 1EJIA 1SF2A 4ZWVA 2AY3A 2BI9A 3MKJA 1CQ8A 4IXSA 1AHXA 1IAXA 3AENA 1WKGA 2ZSLA 4WBTA 4N0WA 2Z1ZA 3FDBA 4WYAA 1MLZA 4ZM3A 3BN1A 4RIZA 2O0RA 4O6ZA 1KL2A 1GC2A 3MEBA 2CSTA 2CTZA 5EAVA 1M0NA 3A9ZA 1DTYA 3ZRPA 1GDEA 2E7JA 3NRAA 4K2MA 4EB7A 3AV7A 3UWCA 2HUIA 3NNKA 3QHXA 3PJ0A 1GC3A 1X29A 1XI9A 2OGEA 2VGUA 1V2DA 1G7WA 2HP2A 3ASAA 3MADA 1B8GA 1WYUA 5G4JA 4A0FA 5C6UA 4ATPA 4XQ2A 3PDXA 1D7UA 1MDOA 1AAMA 2BWNA 4H51A 2TPLA 4HF8A 2WK7A 3UE8A 3PD6A 1CQ6A 4R5FA 1DGEA 3VOMA 1RVYA 3BB8A 1M6SA 3E77A 4UOYA 2VGTA 3ZZJA 2HZPA 1AKCA 1PMOA 2R5EA 5G2QA 4GDYA 3H7FA 4DBCA 2EZ2A 4W5KA 5EUEA 3BCAA 2BIEA 1CZCA 3MAFA 1QZ9A 1D2FA 4F5LA 3FQAA 1AKAA 2CJGA 5EUDA 1SZSA 1M4NA 4A0GA 2ZY3A 3PDBB 5G4IA 2WK9A 2CINA 4P7YA 3BCBA 3B1EA 1UKJA 3FZ7A 2W8TA 3MAUA 5EIGB 4B98A 1RVUA 4BA5A 2DGKA 1V72A 3AEPA 3E2YA 1BS0A 4EFFA 5M46A 2BI2A 4XJOA 2VMSA 1IX7A 3NUIA 3CQ6A 2V1PA 1GCKA 1YJZA 4IX8A 1LC8A 4EU1A 4CBSA 4W1XA 3DR4A 3Q8NA 5BJ3A 1ASFA 3ZZKA 3EZ1A 1WSTA 4BQ0A 2YKUA 4WP0A 3FVUA 2D7ZA 3B46A 2VMYA 3RQ1A 2CJHA 2HOYA 2C7TA 3PPLA 2X5DA 1ASNA 4FL0A 3N0LA 2W7DA 3VK2A 1SVVA 4OCAA 4IXOA 2AY2A 1BJWA 3FRKA 3BC8A 3E2ZA 4A00A 1U08A 3AEOA 4ZDOA 2VGZA 2D65A 3AOVA 3QBOA 2VMXA 2Z9XA 2AEVA 5BJ4A 3E9KA 2W7GA 4ZASA 1CZEA 4B9BA 1BW0A 4Q31A 1BJOA 3BV0A 3EI6A 1LKCA 2NMPA 4TV7A 5G09A 4CBRA 3AOWA 4E3QA 4WYEA 2X5FA 1E5FA 4Y0DA 2RFVA 4P3MA 3JZLA 1I41A 1S06A 3AEJA 3VAXA 2V0YA 3NYSA 4RKDA 2QMAA 1CJ0A 1YJYA 1YIYA 3NTJA 4WXFA 3HVYA 2Z20A 3PA9A 1WYVB 1C7GA 1CL1A 2EH6A 3R9AA 2OATA 1GEYA 2YCTA 1YOOA 1SFFA 1ORDA 5F9SA 2OQXA 2CFBA 5DX5A 4WB0A 3WGBA 2D61A 3JTXA 4ZSYA 2XH1A 3NU8A 1IUGA 3WGCA 4JE5D 2BHXA 2BYLA 2W7MA 5FT4A 1GBNA 2AY1A 2QA3A 2VMZA 3K40A 3OKSA 1YJSA 4MY5A 3WKRA 4HVKA 1X2AA 5E5IA 3HMUA 1UU2A 2DKJA 2FNUA 3DXWA 3K7YA 2W7EA 1ARGA 3KGXA 4RJ0A 2YRRA 3FFHA 2VI8A 3NUBA 1VP4A 2FQ6A 3JWBA 4WD2A 3W1IA 1ASLA 1AJSB 5G0AA 4F4EA 3AATA 3F6TA 1MAQA 1C7NA 2HOXA 1SZUA 3AEMA 3JW9A 3HLMA 2Z1YA 2BI3A 4WYCA 3II0A 1D7VA 2VMWA 3RCHB 4ADEA 1LS3A 4A6RA 4AZKA 3AEJC 2Z9VA 3VK4A 4MGRA 4TN4A 1S08A 4BMKA 2OGAA 4WXBA 4UHMA 4RM1A 3FTBA 3A2BA 1AJRA 1S09A 3DYDA 3ELEA 3LVKA 1AMAA 1ASBA 3CBFA 4W1VA 1AKBA 1W7MA 2HORA 4XJLA 1M32A 1TOJA 4MQRA 4DGTA 2XBNA 1B9HA 2ZSMA 4JEXA 3VP6A 1ASEA 1BQAA 1QISA 4ADCA 1H1CA 3CQ4A 2BWPA 3OP7A 4CVQA 2JG2A 2CB1A 1X0MA 5HDMA 1M0QA 3PDBA 1LK9A 1OATA 4ITGA 2R5CB 5FT6A 3BCXA 2BKWA 5EIGA 3HL2A 5M4DA 2HOZA 4PFFA 1MAPA 2QBTA 3TFTA 1IVRA 1PMMA 1VEFA 1IX8A 5M49A 3FQ7A 5EFSA 4MSOA 1Z3ZA 3P1TA 3FZ6A 2W8JA 2DGMA 1TOEA 1TPLA 4OC9A 1O4SA 2CH1A 4E1OA 1OHYA 2VMRA 1IBJA 1TOKA 1WYTA 3GETA 3HBXA 3FVSA 3AEMC 5E3KA 1AY5A 1KMJA 5G2PA 4J5UA 4XAUA 1C0NA 1IJIA 1GEWA 1LW5A 1GEXA 1Y4IA 1BKGA 4RAEA 3LV2A 2AY5A 2C81A 2X8UA 4ZLVA 4LNMA 4CXRA 1O62A 1ZC9A 3GSBA 2VIBA 4Y0IA 4BA4A 1YIZA 2C0RA 4U1TA 3W1HA 4MKJA 2FN6A 4ZSWA 1S07A 4KAMA 4E77A 4F5IA 5IWQA 3DR7A 3E6GA 1TOIA 5M4BA 1MDXA 1X28A 4U2HA 3LVLB 4AZJA 1TATA 4QGRA 4A6UA 3W1JA 4KYOA 3TQXA 2BIAA 5DJ1A 4WYDA 2ZY5A 4A72A 2JISA 2YCNA 2BIGA 3LG0A 1AAWA 1DKAA 2VMNA 4R5ZA 5LHAA 4AO4A 1AIAA 3EUCA 4TMRA 1OHVA 2BI5A 1SZKA 4Q75A 3CQ5A 1PFFA 4K2BA 4RLGA 1AHGA 2BYJA 1AHEA 2VMOA 4F5GA 2VMVA 1ASCA 4ADBA 1DJUA 1UU1A 2Z9UA 4W91A 3L8AA 2YOBA 3KGWA 4AOAA 4CXQA 2JJHA 3DXVA 3ZRQA 1KKJA 2AEUA 1GC4A 2VLHA 3LY1A 1ARTA 1CS1A 4MQPA 1FG7A 1JS6A 1T3IA 2CJDA 2GB3A 2Z9WA 3QPGA 3FQ8A 4GSAA 3WKSA 3JU7A 4GEBA 3TCMA 4J8LA 5DB5A 2ZY2A 4M2MA 4DQ6A 2ZP7A 3EIAA 3QI6A 2BI1A 2D64A 5E4ZA 2DR1A 3B8XA 4ISYA 3NYUA 4UHOA 2YKYA 1SPAA 4F5FA 1C9CA 2EPJA 1Z7DA 2R0TA 3VK3A 5HHYA 3WCNA 1KMKA 3NYTA 1ASAA 3LVMA 2W7IA 4R2NA 1XEYA 4F5HA 2YKVA 2VLFA 3COGA 4MKKA 2DGLA 3LWSA 1N8PA 4RKCA 2OKKA 2ZJGA 2DOUA 4GE7A 5LH9A 2W8UA 3RI6A 3BWNA 4OMAA 1G7XA 3GZCA 5FT5A 2JJEA 1M0OA 1V2FA 3FKDA 4GE4A 1DFOA 2AY4A 4F5MA 3DZZA 4GE9A 4AO9A 3PGYA 2AY6A 3IHJA 2HUFA 3E2ZB 1J04A 1M7YA 1P3WA 1JS3A 2E7IA 1DJEA 3NU7A 3E2FA 2ORDA 3NDNA 4UHNA 4Q76A 1E5EA 2Q7WA 1AIBA 1MLYA 4W1WA 4XEWA 4IYOB 3FCRA 3EIBA 1ASMA 3G8MA 4XK1A 1BJOB 5D95A 1C7OA 5TF5A 2W7KA 1AHYA 4IY7A 3TATA 4RITA 3GWPA 1MGVA 1EG5A 1LC7A 2JJFA 4L0OA 5EAAA 4JEWA 4W8IA 2E7UA 1AMSA 2EZ1A 3GJUA 1LW4A 2GQNA 1QGNA 4I8AA 1V2EA 3PIUA 5EQCA 4OBVA 2EO5A 3WCOA 2VMQA 2CANA 1TOGA 2CY8A 4EB5A 1AICA 2CH2A 2JGTA 3TFUA 4WLJA 5AX8A 2E54A 5FT8A 1OXOA 3K28A 3G0TA 1M0PA 3PAAA 2VMUA 1CL2A 3BWNC 3HQTA 4WB0B 2C44A 2W7HA 2R2NA 2QLRA 4PIWA 4LW4A 1TARA 5JAYA 1PG8A 1QJ3A 3GZDA 2OKJA 2HP1A 3I5TA 4IW7A 2W7JA 3F9TA 2VIAA 1DJ9A 2BWOA 2JJGA 3EI5A 1CQ7A 1KL1A 4JEYA 1RV3A 4XJPA 4EMYA 4A6TA 2VMTA 3N75A 3KE3A 4K2IA 2W7LA 1C4KA 3WZFA 4E3RA 2PB2A 4WYGA 4ZDLA 2VI9A 2QB2A 3FD0A 5F8VA 3AENB 3GR9A 2O7CA 3FVXA 1O69A 5D5SA 3BWOA 2FM1A 1JF9A 4MQQA 4NOGA 1B5OA 3HDOA 4ZWMA 2PB0A 3ECDA 3RUYA 1QJ5A 3WLXA 1ARSA 4OTLA 1ZOBA 7AATA 1ARIA 1BQDA 4A0RA 2G6WA 4PFNA 4UQVA 1IAYA 1MDZA 4Y0HA 3UAKA 2O1BA 5I92A 1J32A 1JG8A 5DJ9A 3ATHA 3GBXA 1WYUB 1ELUA 3QM2A 1ASGA 9AATA 2Z67A 4R8DA 4F5JA 3GZDC 4ADDA 1ZODA 3ISLA 4XJMA 3P6KA 1VJOA 2YHKA 2YRIA 2GMUA 2D66A 2VMPA 4OT8A 1RV4A 3PD6B 1D7SA 4JEZA 2AY7A 2WKAA 3H14A 1ELQA 1ECXA 2D5YA 3CAIA 4JF1A 2D7YA 1GC0A 1I29A 4WXGA 2VGVA 3EI8A 1GD9A 3F0HA 3USFA 4LW2A 1ARHA 2ZYJA 3A8UX 3G7QA 1YAAA 2D63A 4JF0A 4F5KA 1EQBA 3ZRRA 4LNLA 3MC6A 1G4VA 5EUNA 1FC4A 1BJ4A 1WYTB 2YCPA 1WYVA 1ASDA 3EI7A 2W7FA 1AHFA 3MAFB 3FDDA 3WY7A 1WKHA 1AY8A 3KKIA 2PO3A 3N5MA 3QGUA 2GSAA 1YNUA 1G4XA 4ZM4A 1B5PA 2AY9A 3ELPA 1H0CA 2VGWA 3EI9A 3QN6A 4Q6RA 2GMSA 2VGSA 3HT4A 3B1DA 3ACZA 2YKXA 3RBFA 2W8WA 1S0AA 4WLHA 4AH3A 3L44A 3IF2A 1KKPA 1AMRA 1N2TA 3M5UA 4FFCA 4KXKA 3DODA 2AY8A 1UU0A 3D6KA
chains in the Genus database with same CATH superfamily
1DGDA 3B1CA 2ZY4A 2ZUKA 1O61A 4PVFA 4ZAHA 3FZ8A 2FYFA 3AELA 3I4JA 4N0BA 2QB3A 3A9YA 3EZSA 1AJSA 5K8BA 1AMQA 4IYOA 3RCHA 8AATA 1FG3A 5HXXA 2F8JA 1B9IA 4JE5A 4WYFA 3JWAA 4ZDPA 2ZC0A 3FSLA 1IX6A 1AY4A 1AX4A 3A9XA 1W3UA 3MC6C 3WX9A 4IXZA 3FFRA 1W7LA 3ASBA 2EGYA 1N31A 2WK8A 3R4TA 3MBBA 4BHDA 2AATA 3N4XA 4JEVA 3NX3A 1OXPA 4LC3A 1BJNA 3LVJA 4ITXA 4A0HA 4RJYA 1I48A 1QITA 3BS8A 1LC5A 2HUUA 3RBLA 1QIRA 1OHWA 4M2KA 3T32A 1D7RA 4M2JA 4LNJA 1BT4A 2R5CA 4OBUA 3I16A 2Z61A 4OYTA 1TASA 3DRDA 1W23A 1W7NA 2DKBA 4ATQA 2X3LA 1I43A 1B4XA 4GRXA 2FNIA 3DU4A 2W8VA 3DC1A 5J8QA 2VYCA 1EJIA 1SF2A 4ZWVA 2AY3A 2BI9A 3MKJA 1CQ8A 4IXSA 1AHXA 1IAXA 3AENA 1WKGA 2ZSLA 4WBTA 4N0WA 2Z1ZA 3FDBA 4WYAA 1MLZA 4ZM3A 3BN1A 4RIZA 2O0RA 4O6ZA 1KL2A 1GC2A 3MEBA 2CSTA 2CTZA 5EAVA 1M0NA 3A9ZA 1DTYA 3ZRPA 2A1VA 1GDEA 2E7JA 2KFPA 3NRAA 4K2MA 4EB7A 3AV7A 3UWCA 2HUIA 3NNKA 3QHXA 3PJ0A 1GC3A 1X29A 1XI9A 2OGEA 2VGUA 1V2DA 1G7WA 2HP2A 3ASAA 3MADA 1B8GA 1WYUA 5G4JA 4A0FA 5C6UA 4ATPA 4XQ2A 3PDXA 1D7UA 1MDOA 1AAMA 2BWNA 4H51A 2TPLA 4HF8A 2WK7A 3UE8A 3PD6A 1CQ6A 4R5FA 1DGEA 3VOMA 1RVYA 3BB8A 1M6SA 3E77A 4UOYA 3N4RA 2VGTA 3ZZJA 2HZPA 1AKCA 1PMOA 2R5EA 5G2QA 4GDYA 3H7FA 4DBCA 2EZ2A 4W5KA 5EUEA 3BCAA 2BIEA 1CZCA 3MAFA 4H63Q 1QZ9A 1D2FA 2FKIA 4F5LA 3FQAA 1AKAA 2CJGA 5EUDA 1SZSA 1M4NA 4A0GA 2ZY3A 3PDBB 5G4IA 2WK9A 2CINA 4P7YA 3BCBA 3B1EA 1UKJA 3FZ7A 2W8TA 3MAUA 5EIGB 4B98A 1RVUA 4BA5A 2DGKA 1V72A 3AEPA 3E2YA 1BS0A 4EFFA 5M46A 2BI2A 4XJOA 2VMSA 1IX7A 3NUIA 3CQ6A 2V1PA 1GCKA 1YJZA 4IX8A 1LC8A 4EU1A 4CBSA 4W1XA 3DR4A 3Q8NA 5BJ3A 1ASFA 3ZZKA 3EZ1A 1WSTA 4BQ0A 2YKUA 4WP0A 3FVUA 2D7ZA 3B46A 2VMYA 3RQ1A 2CJHA 2HOYA 2C7TA 3PPLA 2X5DA 1ASNA 4FL0A 3N0LA 2W7DA 3VK2A 1SVVA 4OCAA 4IXOA 2AY2A 1BJWA 3FRKA 3BC8A 3E2ZA 4A00A 1U08A 3AEOA 4ZDOA 2VGZA 2D65A 3AOVA 3QBOA 2VMXA 2Z9XA 2AEVA 5BJ4A 3E9KA 2W7GA 4ZASA 1CZEA 4B9BA 1BW0A 4Q31A 1BJOA 3BV0A 3EI6A 1LKCA 2NMPA 4TV7A 5G09A 4CBRA 3AOWA 4E3QA 4WYEA 2X5FA 1E5FA 4Y0DA 2RFVA 4P3MA 3JZLA 1I41A 1S06A 3AEJA 3VAXA 2V0YA 3NYSA 4RKDA 2QMAA 1CJ0A 1YJYA 3N4SA 1YIYA 3NTJA 4WXFA 3HVYA 2Z20A 3PA9A 1WYVB 1C7GA 1CL1A 2EH6A 3R9AA 2OATA 1GEYA 2YCTA 1YOOA 1SFFA 1ORDA 5F9SA 2OQXA 2CFBA 5DX5A 4WB0A 3WGBA 2D61A 3JTXA 4ZSYA 2XH1A 3NU8A 1IUGA 3WGCA 4JE5D 2BHXA 2BYLA 2W7MA 5FT4A 1GBNA 2AY1A 2QA3A 2VMZA 3K40A 3OKSA 1YJSA 4MY5A 3WKRA 4HVKA 1X2AA 5E5IA 3HMUA 1UU2A 2DKJA 2FNUA 3DXWA 3K7YA 2W7EA 1ARGA 3KGXA 4RJ0A 2YRRA 3FFHA 2VI8A 3NUBA 1VP4A 2FQ6A 3JWBA 4WD2A 3W1IA 1ASLA 1AJSB 5G0AA 4F4EA 3AATA 3F6TA 1MAQA 1C7NA 2HOXA 1SZUA 3AEMA 3JW9A 3HLMA 2Z1YA 2BI3A 4WYCA 3II0A 1D7VA 2VMWA 3RCHB 4ADEA 1LS3A 4A6RA 4AZKA 3AEJC 2Z9VA 3VK4A 4MGRA 4TN4A 1S08A 4BMKA 2OGAA 4WXBA 4UHMA 4RM1A 3FTBA 3A2BA 1AJRA 1S09A 3DYDA 3ELEA 3LVKA 1AMAA 1ASBA 3CBFA 4W1VA 1AKBA 1W7MA 2HORA 4XJLA 1M32A 1TOJA 4MQRA 4DGTA 2XBNA 1B9HA 2ZSMA 4JEXA 3VP6A 1ASEA 1BQAA 1QISA 4ADCA 1H1CA 3CQ4A 2BWPA 3OP7A 4CVQA 3N7NA 2JG2A 2CB1A 1X0MA 5HDMA 1M0QA 3PDBA 1LK9A 1OATA 4ITGA 2R5CB 5FT6A 3BCXA 2BKWA 5EIGA 3HL2A 5M4DA 2HOZA 4PFFA 1MAPA 2QBTA 3TFTA 1IVRA 1PMMA 1VEFA 1IX8A 5M49A 3FQ7A 5EFSA 4MSOA 1Z3ZA 3P1TA 3FZ6A 2W8JA 2DGMA 1TOEA 1TPLA 4OC9A 1O4SA 2CH1A 4E1OA 1OHYA 2VMRA 1IBJA 1TOKA 1WYTA 3GETA 3HBXA 3FVSA 3AEMC 5E3KA 1AY5A 1KMJA 5G2PA 2WB6A 4J5UA 4XAUA 1C0NA 1IJIA 1GEWA 1LW5A 1GEXA 1Y4IA 1BKGA 4RAEA 4K05A 3LV2A 2AY5A 2C81A 2X8UA 4ZLVA 4LNMA 4CXRA 1O62A 1ZC9A 3GSBA 2VIBA 4Y0IA 4BA4A 1YIZA 2C0RA 1KAFA 4U1TA 3W1HA 4MKJA 2FN6A 4ZSWA 1S07A 4KAMA 4E77A 4F5IA 5IWQA 3DR7A 3E6GA 1TOIA 5M4BA 1MDXA 1X28A 4U2HA 3LVLB 4AZJA 1TATA 4QGRA 4A6UA 3W1JA 4KYOA 3TQXA 2BIAA 5DJ1A 4WYDA 2ZY5A 4A72A 2JISA 2YCNA 2BIGA 3LG0A 1AAWA 1DKAA 2VMNA 4R5ZA 5LHAA 2EYQA 4AO4A 1AIAA 3EUCA 4TMRA 1OHVA 2BI5A 1SZKA 4Q75A 3CQ5A 1PFFA 4K2BA 4RLGA 1AHGA 2BYJA 2QSRA 1AHEA 2VMOA 4F5GA 2VMVA 1ASCA 4ADBA 1DJUA 1UU1A 2Z9UA 4W91A 3L8AA 2YOBA 3KGWA 4AOAA 4CXQA 2JJHA 3DXVA 3ZRQA 1KKJA 2AEUA 1GC4A 2VLHA 3LY1A 1ARTA 1CS1A 4MQPA 1FG7A 1JS6A 1T3IA 2CJDA 2GB3A 2Z9WA 3QPGA 3FQ8A 4GSAA 3WKSA 3JU7A 4GEBA 3TCMA 4J8LA 5DB5A 2ZY2A 4M2MA 4DQ6A 2ZP7A 3EIAA 3QI6A 2BI1A 2D64A 5E4ZA 2DR1A 3B8XA 4ISYA 3NYUA 4UHOA 2YKYA 1SPAA 4F5FA 1C9CA 2EPJA 1Z7DA 2R0TA 3VK3A 5HHYA 3WCNA 1KMKA 3NYTA 1ASAA 3LVMA 2W7IA 4R2NA 1XEYA 4F5HA 2YKVA 2VLFA 3COGA 4MKKA 2DGLA 3LWSA 1N8PA 4RKCA 2OKKA 2ZJGA 2DOUA 4GE7A 5LH9A 2W8UA 3RI6A 3BWNA 4OMAA 1G7XA 3GZCA 5FT5A 2JJEA 1M0OA 1V2FA 3FKDA 4GE4A 3H9XA 1DFOA 2AY4A 4F5MA 3DZZA 4GE9A 4AO9A 3PGYA 2AY6A 3IHJA 2HUFA 3E2ZB 1J04A 1M7YA 1P3WA 1JS3A 2E7IA 1DJEA 3NU7A 3E2FA 2ORDA 3NDNA 4UHNA 4Q76A 1E5EA 2Q7WA 1AIBA 1MLYA 4W1WA 4XEWA 4IYOB 3FCRA 3EIBA 1ASMA 3G8MA 4XK1A 1BJOB 5D95A 1C7OA 5TF5A 2W7KA 1AHYA 4IY7A 3TATA 4RITA 3GWPA 1MGVA 1EG5A 2G7JA 1LC7A 2JJFA 4L0OA 5EAAA 4JEWA 4W8IA 2E7UA 1AMSA 2EZ1A 3GJUA 1LW4A 2GQNA 1QGNA 4I8AA 1V2EA 3PIUA 5EQCA 4OBVA 2EO5A 3WCOA 2VMQA 2CANA 1TOGA 2CY8A 4EB5A 1AICA 2CH2A 2JGTA 5KTBA 3TFUA 4WLJA 5AX8A 2E54A 5FT8A 1OXOA 3K28A 3G0TA 1M0PA 3PAAA 2VMUA 1CL2A 3BWNC 3HQTA 4WB0B 2C44A 2W7HA 2R2NA 2QLRA 4PIWA 4LW4A 1TARA 5JAYA 1PG8A 1QJ3A 3GZDA 2OKJA 2HP1A 3I5TA 4IW7A 2W7JA 3F9TA 2VIAA 1DJ9A 2BWOA 2JJGA 3EI5A 1CQ7A 1KL1A 4JEYA 1RV3A 4XJPA 4EMYA 4A6TA 2VMTA 3N75A 3KE3A 4K2IA 2W7LA 1C4KA 3WZFA 4E3RA 2PB2A 4WYGA 4ZDLA 2VI9A 2QB2A 3FD0A 5F8VA 3AENB 3GR9A 2O7CA 3FVXA 1O69A 5D5SA 3BWOA 2FM1A 1JF9A 4MQQA 4NOGA 1B5OA 3HDOA 4ZWMA 2PB0A 3ECDA 3RUYA 1QJ5A 3WLXA 1ARSA 4OTLA 1ZOBA 7AATA 1ARIA 1BQDA 4A0RA 2G6WA 4PFNA 4UQVA 1IAYA 1MDZA 4Y0HA 3UAKA 2O1BA 5I92A 1J32A 1JG8A 5DJ9A 3ATHA 3GBXA 1WYUB 1ELUA 3QM2A 1ASGA 9AATA 2Z67A 4R8DA 4F5JA 3GZDC 4ADDA 1ZODA 3ISLA 4XJMA 3P6KA 1VJOA 2YHKA 2YRIA 2GMUA 2D66A 2VMPA 4OT8A 1RV4A 3PD6B 1D7SA 4JEZA 2AY7A 2WKAA 3H14A 1ELQA 1ECXA 2D5YA 3CAIA 4JF1A 2D7YA 1GC0A 1I29A 4WXGA 2VGVA 3EI8A 1GD9A 3F0HA 3USFA 4LW2A 1ARHA 2ZYJA 3A8UX 3G7QA 1YAAA 2D63A 4JF0A 4F5KA 1EQBA 3ZRRA 4LNLA 3MC6A 1G4VA 5EUNA 1FC4A 1BJ4A 1WYTB 2YCPA 1WYVA 1ASDA 3EI7A 2W7FA 1AHFA 3MAFB 3FDDA 3WY7A 1WKHA 1AY8A 3KKIA 2PO3A 3N5MA 3QGUA 2GSAA 1YNUA 1G4XA 4ZM4A 1B5PA 2AY9A 3ELPA 1H0CA 2VGWA 3EI9A 3QN6A 4Q6RA 2GMSA 2VGSA 3HT4A 3B1DA 3ACZA 2YKXA 3RBFA 2W8WA 1S0AA 4WLHA 4AH3A 3L44A 3IF2A 1KKPA 1AMRA 1N2TA 3M5UA 4FFCA 4KXKA 3DODA 2AY8A 1UU0A 3D6KA
chains in the Genus database with same CATH topology
1DGDA 3B1CA 2ZY4A 2ZUKA 1O61A 4PVFA 4ZAHA 3FZ8A 2FYFA 3AELA 3I4JA 4N0BA 2QB3A 3A9YA 3EZSA 1AJSA 5K8BA 1AMQA 4IYOA 3RCHA 8AATA 1FG3A 5HXXA 2F8JA 1B9IA 4JE5A 4WYFA 3JWAA 4ZDPA 2ZC0A 3FSLA 1IX6A 1AY4A 1AX4A 3A9XA 1W3UA 3MC6C 3WX9A 4IXZA 3FFRA 1W7LA 3ASBA 2EGYA 1N31A 2WK8A 3R4TA 3MBBA 4BHDA 2AATA 3N4XA 4JEVA 3NX3A 1OXPA 4LC3A 1BJNA 3LVJA 4ITXA 4A0HA 4RJYA 1I48A 1QITA 3BS8A 1LC5A 2HUUA 3RBLA 1QIRA 1OHWA 4M2KA 3T32A 1D7RA 4M2JA 4LNJA 1BT4A 2R5CA 4OBUA 3I16A 2Z61A 4OYTA 1TASA 3DRDA 1W23A 1W7NA 2DKBA 4ATQA 2X3LA 1I43A 1B4XA 4GRXA 2FNIA 3DU4A 2W8VA 3DC1A 5J8QA 2VYCA 1EJIA 1SF2A 4ZWVA 2AY3A 2BI9A 3MKJA 1CQ8A 4IXSA 1AHXA 1IAXA 3AENA 1WKGA 2ZSLA 4WBTA 4N0WA 2Z1ZA 3FDBA 4WYAA 1MLZA 4ZM3A 3BN1A 4RIZA 2O0RA 4O6ZA 1KL2A 1GC2A 3MEBA 2CSTA 2CTZA 5EAVA 1M0NA 3A9ZA 1DTYA 3ZRPA 2A1VA 1GDEA 2E7JA 2KFPA 3NRAA 4K2MA 4EB7A 3AV7A 3UWCA 2HUIA 3NNKA 3QHXA 3PJ0A 1GC3A 1X29A 1XI9A 2OGEA 2VGUA 1V2DA 1G7WA 2HP2A 3ASAA 3MADA 1B8GA 1WYUA 5G4JA 4A0FA 5C6UA 4ATPA 4XQ2A 3PDXA 1D7UA 1MDOA 1AAMA 2BWNA 4H51A 2TPLA 4HF8A 2WK7A 3UE8A 3PD6A 1CQ6A 4R5FA 1DGEA 3VOMA 1RVYA 3BB8A 1M6SA 3E77A 4UOYA 3N4RA 2VGTA 3ZZJA 2HZPA 1AKCA 1PMOA 2R5EA 5G2QA 4GDYA 3H7FA 4DBCA 2EZ2A 4W5KA 5EUEA 3BCAA 2BIEA 1CZCA 3MAFA 4H63Q 1QZ9A 1D2FA 2FKIA 4F5LA 3FQAA 1AKAA 2CJGA 5EUDA 1SZSA 1M4NA 4A0GA 2ZY3A 3PDBB 5G4IA 2WK9A 2CINA 4P7YA 3BCBA 3B1EA 1UKJA 3FZ7A 2W8TA 3MAUA 5EIGB 4B98A 1RVUA 4BA5A 2DGKA 1V72A 3AEPA 3E2YA 1BS0A 4EFFA 5M46A 2BI2A 4XJOA 2VMSA 1IX7A 3NUIA 3CQ6A 2V1PA 1GCKA 1YJZA 4IX8A 1LC8A 4EU1A 4CBSA 4W1XA 3DR4A 3Q8NA 5BJ3A 1ASFA 3ZZKA 3EZ1A 1WSTA 4BQ0A 2YKUA 4WP0A 3FVUA 2D7ZA 3B46A 2VMYA 3RQ1A 2CJHA 2HOYA 2C7TA 3PPLA 2X5DA 1ASNA 4FL0A 3N0LA 2W7DA 3VK2A 1SVVA 4OCAA 4IXOA 2AY2A 1BJWA 3FRKA 3BC8A 3E2ZA 4A00A 1U08A 3AEOA 4ZDOA 2VGZA 2D65A 3AOVA 3QBOA 2VMXA 2Z9XA 2AEVA 5BJ4A 3E9KA 2W7GA 4ZASA 1CZEA 4B9BA 1BW0A 4Q31A 1BJOA 3BV0A 3EI6A 1LKCA 2NMPA 4TV7A 5G09A 4CBRA 3AOWA 4E3QA 4WYEA 2X5FA 1E5FA 4Y0DA 2RFVA 4P3MA 3JZLA 1I41A 1S06A 3AEJA 3VAXA 2V0YA 3NYSA 4RKDA 2QMAA 1CJ0A 1YJYA 3N4SA 1YIYA 3NTJA 4WXFA 3HVYA 2Z20A 3PA9A 1WYVB 1C7GA 1CL1A 2EH6A 3R9AA 2OATA 1GEYA 2YCTA 1YOOA 1SFFA 1ORDA 5F9SA 2OQXA 2CFBA 5DX5A 4WB0A 3WGBA 2D61A 3JTXA 4ZSYA 2XH1A 3NU8A 1IUGA 3WGCA 4JE5D 2BHXA 2BYLA 2W7MA 5FT4A 1GBNA 2AY1A 2QA3A 2VMZA 3K40A 3OKSA 1YJSA 4MY5A 3WKRA 4HVKA 1X2AA 5E5IA 3HMUA 1UU2A 2DKJA 2FNUA 3DXWA 3K7YA 2W7EA 1ARGA 3KGXA 4RJ0A 2YRRA 3FFHA 2VI8A 3NUBA 1VP4A 2FQ6A 3JWBA 4WD2A 3W1IA 1ASLA 1AJSB 5G0AA 4F4EA 3AATA 3F6TA 1MAQA 1C7NA 2HOXA 1SZUA 3AEMA 3JW9A 3HLMA 2Z1YA 2BI3A 4WYCA 3II0A 1D7VA 2VMWA 3RCHB 4ADEA 1LS3A 4A6RA 4AZKA 3AEJC 2Z9VA 3VK4A 4MGRA 4TN4A 1S08A 4BMKA 2OGAA 4WXBA 4UHMA 4RM1A 3FTBA 3A2BA 1AJRA 1S09A 3DYDA 3ELEA 3LVKA 1AMAA 1ASBA 3CBFA 4W1VA 1AKBA 1W7MA 2HORA 4XJLA 1M32A 1TOJA 4MQRA 4DGTA 2XBNA 1B9HA 2ZSMA 4JEXA 3VP6A 1ASEA 1BQAA 1QISA 4ADCA 1H1CA 3CQ4A 2BWPA 3OP7A 4CVQA 3N7NA 2JG2A 2CB1A 1X0MA 5HDMA 1M0QA 3PDBA 1LK9A 1OATA 4ITGA 2R5CB 5FT6A 3BCXA 2BKWA 5EIGA 3HL2A 5M4DA 2HOZA 4PFFA 1MAPA 2QBTA 3TFTA 1IVRA 1PMMA 1VEFA 1IX8A 5M49A 3FQ7A 5EFSA 4MSOA 1Z3ZA 3P1TA 3FZ6A 2W8JA 2DGMA 1TOEA 1TPLA 4OC9A 1O4SA 2CH1A 4E1OA 1OHYA 2VMRA 1IBJA 1TOKA 1WYTA 3GETA 3HBXA 3FVSA 3AEMC 5E3KA 1AY5A 1KMJA 5G2PA 2WB6A 4J5UA 4XAUA 1C0NA 1IJIA 1GEWA 1LW5A 1GEXA 1Y4IA 1BKGA 4RAEA 4K05A 3LV2A 2AY5A 2C81A 2X8UA 4ZLVA 4LNMA 4CXRA 1O62A 1ZC9A 3GSBA 2VIBA 4Y0IA 4BA4A 1YIZA 2C0RA 4U1TA 3W1HA 4MKJA 2FN6A 4ZSWA 1S07A 4KAMA 4E77A 4F5IA 5IWQA 3DR7A 3E6GA 1TOIA 5M4BA 1MDXA 1X28A 4U2HA 3LVLB 4AZJA 1TATA 4QGRA 4A6UA 3W1JA 4KYOA 3TQXA 2BIAA 5DJ1A 4WYDA 2ZY5A 4A72A 2JISA 2YCNA 2BIGA 3LG0A 1AAWA 1DKAA 2VMNA 4R5ZA 5LHAA 2EYQA 4AO4A 1AIAA 3EUCA 4TMRA 1OHVA 2BI5A 1SZKA 4Q75A 3CQ5A 1PFFA 4K2BA 4RLGA 1AHGA 2BYJA 2QSRA 1AHEA 2VMOA 4F5GA 2VMVA 1ASCA 4ADBA 1DJUA 1UU1A 2Z9UA 4W91A 3L8AA 2YOBA 3KGWA 4AOAA 4CXQA 2JJHA 3DXVA 3ZRQA 1KKJA 2AEUA 1GC4A 2VLHA 3LY1A 1ARTA 1CS1A 4MQPA 1FG7A 1JS6A 1T3IA 2CJDA 2GB3A 2Z9WA 3QPGA 3FQ8A 4GSAA 3WKSA 3JU7A 4GEBA 3TCMA 4J8LA 5DB5A 2ZY2A 4M2MA 4DQ6A 2ZP7A 3EIAA 3QI6A 2BI1A 2D64A 5E4ZA 2DR1A 3B8XA 4ISYA 3NYUA 4UHOA 2YKYA 1SPAA 4F5FA 1C9CA 2EPJA 1Z7DA 2R0TA 3VK3A 5HHYA 3WCNA 1KMKA 3NYTA 1ASAA 3LVMA 2W7IA 4R2NA 1XEYA 4F5HA 2YKVA 2VLFA 3COGA 4MKKA 2DGLA 3LWSA 1N8PA 4RKCA 2OKKA 2ZJGA 2DOUA 4GE7A 5LH9A 2W8UA 3RI6A 3BWNA 4OMAA 1G7XA 3GZCA 5FT5A 2JJEA 1M0OA 1V2FA 3FKDA 4GE4A 3H9XA 1DFOA 2AY4A 4F5MA 3DZZA 4GE9A 4AO9A 3PGYA 2AY6A 3IHJA 2HUFA 3E2ZB 1J04A 1M7YA 1P3WA 1JS3A 2E7IA 1DJEA 3NU7A 3E2FA 2ORDA 3NDNA 4UHNA 4Q76A 1E5EA 2Q7WA 1AIBA 1MLYA 4W1WA 4XEWA 4IYOB 3FCRA 3EIBA 1ASMA 3G8MA 4XK1A 1BJOB 5D95A 1C7OA 5TF5A 2W7KA 1AHYA 4IY7A 3TATA 4RITA 3GWPA 1MGVA 1EG5A 2G7JA 1LC7A 2JJFA 4L0OA 5EAAA 4JEWA 4W8IA 2E7UA 1AMSA 2EZ1A 3GJUA 1LW4A 2GQNA 1QGNA 4I8AA 1V2EA 3PIUA 5EQCA 4OBVA 2EO5A 3WCOA 2VMQA 2CANA 1TOGA 2CY8A 4EB5A 1AICA 2CH2A 2JGTA 5KTBA 3TFUA 4WLJA 5AX8A 2E54A 5FT8A 1OXOA 3K28A 3G0TA 1M0PA 3PAAA 2VMUA 1CL2A 3BWNC 3HQTA 4WB0B 2C44A 2W7HA 2R2NA 2QLRA 4PIWA 4LW4A 1TARA 5JAYA 1PG8A 1QJ3A 3GZDA 2OKJA 2HP1A 3I5TA 4IW7A 2W7JA 3F9TA 2VIAA 1DJ9A 2BWOA 2JJGA 3EI5A 1CQ7A 1KL1A 4JEYA 1RV3A 4XJPA 4EMYA 4A6TA 2VMTA 3N75A 3KE3A 4K2IA 2W7LA 1C4KA 3WZFA 4E3RA 2PB2A 4WYGA 4ZDLA 2VI9A 2QB2A 3FD0A 5F8VA 3AENB 3GR9A 2O7CA 3FVXA 1O69A 5D5SA 3BWOA 2FM1A 1JF9A 4MQQA 4NOGA 1B5OA 3HDOA 4ZWMA 2PB0A 3ECDA 3RUYA 1QJ5A 3WLXA 1ARSA 4OTLA 1ZOBA 7AATA 1ARIA 1BQDA 4A0RA 2G6WA 4PFNA 4UQVA 1IAYA 1MDZA 4Y0HA 3UAKA 2O1BA 5I92A 1J32A 1JG8A 5DJ9A 3ATHA 3GBXA 1WYUB 1ELUA 3QM2A 1ASGA 9AATA 2Z67A 4R8DA 4F5JA 3GZDC 4ADDA 1ZODA 3ISLA 4XJMA 3P6KA 1VJOA 2YHKA 2YRIA 2GMUA 2D66A 2VMPA 4OT8A 1RV4A 3PD6B 1D7SA 4JEZA 2AY7A 2WKAA 3H14A 1ELQA 1ECXA 2D5YA 3CAIA 4JF1A 2D7YA 1GC0A 1I29A 4WXGA 2VGVA 3EI8A 1GD9A 3F0HA 3USFA 4LW2A 1ARHA 2ZYJA 3A8UX 3G7QA 1YAAA 2D63A 4JF0A 4F5KA 1EQBA 3ZRRA 4LNLA 3MC6A 1G4VA 5EUNA 1FC4A 1BJ4A 1WYTB 2YCPA 1WYVA 1ASDA 3EI7A 2W7FA 1AHFA 3MAFB 3FDDA 3WY7A 1WKHA 1AY8A 3KKIA 2PO3A 3N5MA 3QGUA 2GSAA 1YNUA 1G4XA 4ZM4A 1B5PA 2AY9A 3ELPA 1H0CA 2VGWA 3EI9A 3QN6A 4Q6RA 2GMSA 2VGSA 3HT4A 3B1DA 3ACZA 2YKXA 3RBFA 2W8WA 1S0AA 4WLHA 4AH3A 3L44A 3IF2A 1KKPA 1AMRA 1N2TA 3M5UA 4FFCA 4KXKA 3DODA 2AY8A 1UU0A 3D6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGD A;  3B1C A;  2ZY4 A;  2ZUK A;  1O61 A;  4PVF A;  4ZAH A;  3FZ8 A;  2FYF A;  3AEL A;  3I4J A;  4N0B A;  2QB3 A;  3A9Y A;  3EZS A;  1AJS A;  5K8B A;  1AMQ A;  4IYO A;  3RCH A;  8AAT A;  1FG3 A;  5HXX A;  2F8J A;  1B9I A;  4JE5 A;  4WYF A;  3JWA A;  4ZDP A;  2ZC0 A;  3FSL A;  1IX6 A;  1AY4 A;  1AX4 A;  3A9X A;  1W3U A;  3MC6 C;  3WX9 A;  4IXZ A;  3FFR A;  1W7L A;  3ASB A;  2EGY A;  1N31 A;  2WK8 A;  3R4T A;  3MBB A;  4BHD A;  2AAT A;  4JEV A;  3NX3 A;  1OXP A;  4LC3 A;  1BJN A;  3LVJ A;  4ITX A;  4A0H A;  4RJY A;  1I48 A;  1QIT A;  3BS8 A;  1LC5 A;  2HUU A;  3RBL A;  1QIR A;  1OHW A;  4M2K A;  3T32 A;  1D7R A;  4M2J A;  4LNJ A;  1BT4 A;  2R5C A;  4OBU A;  3I16 A;  2Z61 A;  4OYT A;  1TAS A;  3DRD A;  1W23 A;  1W7N A;  2DKB A;  4ATQ A;  2X3L A;  1I43 A;  1B4X A;  4GRX A;  2FNI A;  3DU4 A;  2W8V A;  3DC1 A;  5J8Q A;  2VYC A;  1EJI A;  1SF2 A;  4ZWV A;  2AY3 A;  2BI9 A;  3MKJ A;  1CQ8 A;  4IXS A;  1AHX A;  1IAX A;  3AEN A;  1WKG A;  2ZSL A;  4WBT A;  4N0W A;  2Z1Z A;  3FDB A;  4WYA A;  1MLZ A;  4ZM3 A;  3BN1 A;  4RIZ A;  2O0R A;  4O6Z A;  1KL2 A;  1GC2 A;  3MEB A;  2CST A;  2CTZ A;  5EAV A;  1M0N A;  3A9Z A;  1DTY A;  3ZRP A;  1GDE A;  2E7J A;  3NRA A;  4K2M A;  4EB7 A;  3AV7 A;  3UWC A;  2HUI A;  3NNK A;  3QHX A;  3PJ0 A;  1GC3 A;  1X29 A;  1XI9 A;  2OGE A;  2VGU A;  1V2D A;  1G7W A;  2HP2 A;  3ASA A;  3MAD A;  1B8G A;  1WYU A;  5G4J A;  4A0F A;  5C6U A;  4ATP A;  4XQ2 A;  3PDX A;  1D7U A;  1MDO A;  1AAM A;  2BWN A;  4H51 A;  2TPL A;  4HF8 A;  2WK7 A;  3UE8 A;  3PD6 A;  1CQ6 A;  4R5F A;  1DGE A;  3VOM A;  1RVY A;  3BB8 A;  1M6S A;  3E77 A;  4UOY A;  2VGT A;  3ZZJ A;  2HZP A;  1AKC A;  1PMO A;  2R5E A;  5G2Q A;  4GDY A;  3H7F A;  4DBC A;  2EZ2 A;  4W5K A;  5EUE A;  3BCA A;  2BIE A;  1CZC A;  3MAF A;  1QZ9 A;  1D2F A;  4F5L A;  3FQA A;  1AKA A;  2CJG A;  5EUD A;  1SZS A;  1M4N A;  4A0G A;  2ZY3 A;  3PDB B;  5G4I A;  2WK9 A;  2CIN A;  4P7Y A;  3BCB A;  3B1E A;  1UKJ A;  3FZ7 A;  2W8T A;  3MAU A;  5EIG B;  4B98 A;  1RVU A;  4BA5 A;  2DGK A;  1V72 A;  3AEP A;  3E2Y A;  1BS0 A;  4EFF A;  5M46 A;  2BI2 A;  4XJO A;  2VMS A;  1IX7 A;  3NUI A;  3CQ6 A;  2V1P A;  1GCK A;  1YJZ A;  4IX8 A;  1LC8 A;  4EU1 A;  4CBS A;  4W1X A;  3DR4 A;  3Q8N A;  5BJ3 A;  1ASF A;  3ZZK A;  3EZ1 A;  1WST A;  4BQ0 A;  2YKU A;  4WP0 A;  3FVU A;  2D7Z A;  3B46 A;  2VMY A;  3RQ1 A;  2CJH A;  2HOY A;  2C7T A;  3PPL A;  2X5D A;  1ASN A;  4FL0 A;  3N0L A;  2W7D A;  3VK2 A;  1SVV A;  4OCA A;  4IXO A;  2AY2 A;  1BJW A;  3FRK A;  3BC8 A;  3E2Z A;  4A00 A;  1U08 A;  3AEO A;  4ZDO A;  2VGZ A;  2D65 A;  3AOV A;  3QBO A;  2VMX A;  2Z9X A;  2AEV A;  5BJ4 A;  3E9K A;  2W7G A;  4ZAS A;  1CZE A;  4B9B A;  1BW0 A;  4Q31 A;  1BJO A;  3BV0 A;  3EI6 A;  1LKC A;  2NMP A;  4TV7 A;  5G09 A;  4CBR A;  3AOW A;  4E3Q A;  4WYE A;  2X5F A;  1E5F A;  4Y0D A;  2RFV A;  4P3M A;  3JZL A;  1I41 A;  1S06 A;  3AEJ A;  3VAX A;  2V0Y A;  3NYS A;  4RKD A;  2QMA A;  1CJ0 A;  1YJY A;  1YIY A;  3NTJ A;  4WXF A;  3HVY A;  2Z20 A;  3PA9 A;  1WYV B;  1C7G A;  1CL1 A;  2EH6 A;  3R9A A;  2OAT A;  1GEY A;  2YCT A;  1YOO A;  1SFF A;  1ORD A;  5F9S A;  2OQX A;  2CFB A;  5DX5 A;  4WB0 A;  3WGB A;  2D61 A;  3JTX A;  4ZSY A;  2XH1 A;  3NU8 A;  1IUG A;  3WGC A;  4JE5 D;  2BHX A;  2BYL A;  2W7M A;  5FT4 A;  1GBN A;  2AY1 A;  2QA3 A;  2VMZ A;  3K40 A;  3OKS A;  1YJS A;  4MY5 A;  3WKR A;  4HVK A;  1X2A A;  5E5I A;  3HMU A;  1UU2 A;  2DKJ A;  2FNU A;  3DXW A;  3K7Y A;  2W7E A;  1ARG A;  3KGX A;  4RJ0 A;  2YRR A;  3FFH A;  2VI8 A;  3NUB A;  1VP4 A;  2FQ6 A;  3JWB A;  4WD2 A;  3W1I A;  1ASL A;  1AJS B;  5G0A A;  4F4E A;  3AAT A;  3F6T A;  1MAQ A;  1C7N A;  2HOX A;  1SZU A;  3AEM A;  3JW9 A;  3HLM A;  2Z1Y A;  2BI3 A;  4WYC A;  3II0 A;  1D7V A;  2VMW A;  3RCH B;  4ADE A;  1LS3 A;  4A6R A;  4AZK A;  3AEJ C;  2Z9V A;  3VK4 A;  4MGR A;  4TN4 A;  1S08 A;  4BMK A;  2OGA A;  4WXB A;  4UHM A;  4RM1 A;  3FTB A;  3A2B A;  1AJR A;  1S09 A;  3DYD A;  3ELE A;  3LVK A;  1AMA A;  1ASB A;  3CBF A;  4W1V A;  1AKB A;  1W7M A;  2HOR A;  4XJL A;  1M32 A;  1TOJ A;  4MQR A;  4DGT A;  2XBN A;  1B9H A;  2ZSM A;  4JEX A;  3VP6 A;  1ASE A;  1BQA A;  1QIS A;  4ADC A;  1H1C A;  3CQ4 A;  2BWP A;  3OP7 A;  4CVQ A;  2JG2 A;  2CB1 A;  1X0M A;  5HDM A;  1M0Q A;  3PDB A;  1LK9 A;  1OAT A;  4ITG A;  2R5C B;  5FT6 A;  3BCX A;  2BKW A;  5EIG A;  3HL2 A;  5M4D A;  2HOZ A;  4PFF A;  1MAP A;  2QBT A;  3TFT A;  1IVR A;  1PMM A;  1VEF A;  1IX8 A;  5M49 A;  3FQ7 A;  5EFS A;  4MSO A;  1Z3Z A;  3P1T A;  3FZ6 A;  2W8J A;  2DGM A;  1TOE A;  1TPL A;  4OC9 A;  1O4S A;  2CH1 A;  4E1O A;  1OHY A;  2VMR A;  1IBJ A;  1TOK A;  1WYT A;  3GET A;  3HBX A;  3FVS A;  3AEM C;  5E3K A;  1AY5 A;  1KMJ A;  5G2P A;  4J5U A;  4XAU A;  1C0N A;  1IJI A;  1GEW A;  1LW5 A;  1GEX A;  1Y4I A;  1BKG A;  4RAE A;  3LV2 A;  2AY5 A;  2C81 A;  2X8U A;  4ZLV A;  4LNM A;  4CXR A;  1O62 A;  1ZC9 A;  3GSB A;  2VIB A;  4Y0I A;  4BA4 A;  1YIZ A;  2C0R A;  4U1T A;  3W1H A;  4MKJ A;  2FN6 A;  4ZSW A;  1S07 A;  4KAM A;  4E77 A;  4F5I A;  5IWQ A;  3DR7 A;  3E6G A;  1TOI A;  5M4B A;  1MDX A;  1X28 A;  4U2H A;  3LVL B;  4AZJ A;  1TAT A;  4QGR A;  4A6U A;  3W1J A;  4KYO A;  3TQX A;  2BIA A;  5DJ1 A;  4WYD A;  2ZY5 A;  4A72 A;  2JIS A;  2YCN A;  2BIG A;  3LG0 A;  1AAW A;  1DKA A;  2VMN A;  4R5Z A;  5LHA A;  4AO4 A;  1AIA A;  3EUC A;  4TMR A;  1OHV A;  2BI5 A;  1SZK A;  4Q75 A;  3CQ5 A;  1PFF A;  4K2B A;  4RLG A;  1AHG A;  2BYJ A;  1AHE A;  2VMO A;  4F5G A;  2VMV A;  1ASC A;  4ADB A;  1DJU A;  1UU1 A;  2Z9U A;  4W91 A;  3L8A A;  2YOB A;  3KGW A;  4AOA A;  4CXQ A;  2JJH A;  3DXV A;  3ZRQ A;  1KKJ A;  2AEU A;  1GC4 A;  2VLH A;  3LY1 A;  1ART A;  1CS1 A;  4MQP A;  1FG7 A;  1JS6 A;  1T3I A;  2CJD A;  2GB3 A;  2Z9W A;  3QPG A;  3FQ8 A;  4GSA A;  3WKS A;  3JU7 A;  4GEB A;  3TCM A;  4J8L A;  5DB5 A;  2ZY2 A;  4M2M A;  4DQ6 A;  2ZP7 A;  3EIA A;  3QI6 A;  2BI1 A;  2D64 A;  5E4Z A;  2DR1 A;  3B8X A;  4ISY A;  3NYU A;  4UHO A;  2YKY A;  1SPA A;  4F5F A;  1C9C A;  2EPJ A;  1Z7D A;  2R0T A;  3VK3 A;  5HHY A;  3WCN A;  1KMK A;  3NYT A;  1ASA A;  3LVM A;  2W7I A;  4R2N A;  1XEY A;  4F5H A;  2YKV A;  2VLF A;  3COG A;  4MKK A;  2DGL A;  3LWS A;  1N8P A;  4RKC A;  2OKK A;  2ZJG A;  2DOU A;  4GE7 A;  5LH9 A;  2W8U A;  3RI6 A;  3BWN A;  4OMA A;  1G7X A;  3GZC A;  5FT5 A;  2JJE A;  1M0O A;  1V2F A;  3FKD A;  4GE4 A;  1DFO A;  2AY4 A;  4F5M A;  3DZZ A;  4GE9 A;  4AO9 A;  3PGY A;  2AY6 A;  3IHJ A;  2HUF A;  3E2Z B;  1J04 A;  1M7Y A;  1P3W A;  1JS3 A;  2E7I A;  1DJE A;  3NU7 A;  3E2F A;  2ORD A;  3NDN A;  4UHN A;  4Q76 A;  1E5E A;  2Q7W A;  1AIB A;  1MLY A;  4W1W A;  4XEW A;  4IYO B;  3FCR A;  3EIB A;  1ASM A;  3G8M A;  4XK1 A;  1BJO B;  5D95 A;  1C7O A;  5TF5 A;  2W7K A;  1AHY A;  4IY7 A;  3TAT A;  4RIT A;  3GWP A;  1MGV A;  1EG5 A;  1LC7 A;  2JJF A;  4L0O A;  5EAA A;  4JEW A;  4W8I A;  2E7U A;  1AMS A;  2EZ1 A;  3GJU A;  1LW4 A;  2GQN A;  1QGN A;  4I8A A;  1V2E A;  3PIU A;  5EQC A;  4OBV A;  2EO5 A;  3WCO A;  2VMQ A;  2CAN A;  1TOG A;  2CY8 A;  4EB5 A;  1AIC A;  2CH2 A;  2JGT A;  3TFU A;  4WLJ A;  5AX8 A;  2E54 A;  5FT8 A;  1OXO A;  3K28 A;  3G0T A;  1M0P A;  3PAA A;  2VMU A;  1CL2 A;  3BWN C;  3HQT A;  4WB0 B;  2C44 A;  2W7H A;  2R2N A;  2QLR A;  4PIW A;  4LW4 A;  1TAR A;  5JAY A;  1PG8 A;  1QJ3 A;  3GZD A;  2OKJ A;  2HP1 A;  3I5T A;  4IW7 A;  2W7J A;  3F9T A;  2VIA A;  1DJ9 A;  2BWO A;  2JJG A;  3EI5 A;  1CQ7 A;  1KL1 A;  4JEY A;  1RV3 A;  4XJP A;  4EMY A;  4A6T A;  2VMT A;  3N75 A;  3KE3 A;  4K2I A;  2W7L A;  1C4K A;  3WZF A;  4E3R A;  2PB2 A;  4WYG A;  4ZDL A;  2VI9 A;  2QB2 A;  3FD0 A;  5F8V A;  3AEN B;  3GR9 A;  2O7C A;  3FVX A;  1O69 A;  5D5S A;  3BWO A;  2FM1 A;  1JF9 A;  4MQQ A;  4NOG A;  1B5O A;  3HDO A;  4ZWM A;  2PB0 A;  3ECD A;  3RUY A;  1QJ5 A;  3WLX A;  1ARS A;  4OTL A;  1ZOB A;  7AAT A;  1ARI A;  1BQD A;  4A0R A;  2G6W A;  4PFN A;  4UQV A;  1IAY A;  1MDZ A;  4Y0H A;  3UAK A;  2O1B A;  5I92 A;  1J32 A;  1JG8 A;  5DJ9 A;  3ATH A;  3GBX A;  1WYU B;  1ELU A;  3QM2 A;  1ASG A;  9AAT A;  2Z67 A;  4R8D A;  4F5J A;  3GZD C;  4ADD A;  1ZOD A;  3ISL A;  4XJM A;  3P6K A;  1VJO A;  2YHK A;  2YRI A;  2GMU A;  2D66 A;  2VMP A;  4OT8 A;  1RV4 A;  3PD6 B;  1D7S A;  4JEZ A;  2AY7 A;  2WKA A;  3H14 A;  1ELQ A;  1ECX A;  2D5Y A;  3CAI A;  4JF1 A;  2D7Y A;  1GC0 A;  1I29 A;  4WXG A;  2VGV A;  3EI8 A;  1GD9 A;  3F0H A;  3USF A;  4LW2 A;  1ARH A;  2ZYJ A;  3A8U X;  3G7Q A;  1YAA A;  2D63 A;  4JF0 A;  4F5K A;  1EQB A;  3ZRR A;  4LNL A;  3MC6 A;  1G4V A;  5EUN A;  1FC4 A;  1BJ4 A;  1WYT B;  2YCP A;  1WYV A;  1ASD A;  3EI7 A;  2W7F A;  1AHF A;  3MAF B;  3FDD A;  3WY7 A;  1WKH A;  1AY8 A;  3KKI A;  2PO3 A;  3N5M A;  3QGU A;  2GSA A;  1YNU A;  1G4X A;  4ZM4 A;  1B5P A;  2AY9 A;  3ELP A;  1H0C A;  2VGW A;  3EI9 A;  3QN6 A;  4Q6R A;  2GMS A;  2VGS A;  3HT4 A;  3B1D A;  3ACZ A;  2YKX A;  3RBF A;  2W8W A;  1S0A A;  4WLH A;  4AH3 A;  3L44 A;  3IF2 A;  1KKP A;  1AMR A;  1N2T A;  3M5U A;  4FFC A;  4KXK A;  3DOD A;  2AY8 A;  1UU0 A;  3D6K A; 
#chains in the Genus database with same CATH topology
 1DGD A;  3B1C A;  2ZY4 A;  2ZUK A;  1O61 A;  4PVF A;  4ZAH A;  3FZ8 A;  2FYF A;  3AEL A;  3I4J A;  4N0B A;  2QB3 A;  3A9Y A;  3EZS A;  1AJS A;  5K8B A;  1AMQ A;  4IYO A;  3RCH A;  8AAT A;  1FG3 A;  5HXX A;  2F8J A;  1B9I A;  4JE5 A;  4WYF A;  3JWA A;  4ZDP A;  2ZC0 A;  3FSL A;  1IX6 A;  1AY4 A;  1AX4 A;  3A9X A;  1W3U A;  3MC6 C;  3WX9 A;  4IXZ A;  3FFR A;  1W7L A;  3ASB A;  2EGY A;  1N31 A;  2WK8 A;  3R4T A;  3MBB A;  4BHD A;  2AAT A;  3N4X A;  4JEV A;  3NX3 A;  1OXP A;  4LC3 A;  1BJN A;  3LVJ A;  4ITX A;  4A0H A;  4RJY A;  1I48 A;  1QIT A;  3BS8 A;  1LC5 A;  2HUU A;  3RBL A;  1QIR A;  1OHW A;  4M2K A;  3T32 A;  1D7R A;  4M2J A;  4LNJ A;  1BT4 A;  2R5C A;  4OBU A;  3I16 A;  2Z61 A;  4OYT A;  1TAS A;  3DRD A;  1W23 A;  1W7N A;  2DKB A;  4ATQ A;  2X3L A;  1I43 A;  1B4X A;  4GRX A;  2FNI A;  3DU4 A;  2W8V A;  3DC1 A;  5J8Q A;  2VYC A;  1EJI A;  1SF2 A;  4ZWV A;  2AY3 A;  2BI9 A;  3MKJ A;  1CQ8 A;  4IXS A;  1AHX A;  1IAX A;  3AEN A;  1WKG A;  2ZSL A;  4WBT A;  4N0W A;  2Z1Z A;  3FDB A;  4WYA A;  1MLZ A;  4ZM3 A;  3BN1 A;  4RIZ A;  2O0R A;  4O6Z A;  1KL2 A;  1GC2 A;  3MEB A;  2CST A;  2CTZ A;  5EAV A;  1M0N A;  3A9Z A;  1DTY A;  3ZRP A;  2A1V A;  1GDE A;  2E7J A;  2KFP A;  3NRA A;  4K2M A;  4EB7 A;  3AV7 A;  3UWC A;  2HUI A;  3NNK A;  3QHX A;  3PJ0 A;  1GC3 A;  1X29 A;  1XI9 A;  2OGE A;  2VGU A;  1V2D A;  1G7W A;  2HP2 A;  3ASA A;  3MAD A;  1B8G A;  1WYU A;  5G4J A;  4A0F A;  5C6U A;  4ATP A;  4XQ2 A;  3PDX A;  1D7U A;  1MDO A;  1AAM A;  2BWN A;  4H51 A;  2TPL A;  4HF8 A;  2WK7 A;  3UE8 A;  3PD6 A;  1CQ6 A;  4R5F A;  1DGE A;  3VOM A;  1RVY A;  3BB8 A;  1M6S A;  3E77 A;  4UOY A;  3N4R A;  2VGT A;  3ZZJ A;  2HZP A;  1AKC A;  1PMO A;  2R5E A;  5G2Q A;  4GDY A;  3H7F A;  4DBC A;  2EZ2 A;  4W5K A;  5EUE A;  3BCA A;  2BIE A;  1CZC A;  3MAF A;  4H63 Q;  1QZ9 A;  1D2F A;  2FKI A;  4F5L A;  3FQA A;  1AKA A;  2CJG A;  5EUD A;  1SZS A;  1M4N A;  4A0G A;  2ZY3 A;  3PDB B;  5G4I A;  2WK9 A;  2CIN A;  4P7Y A;  3BCB A;  3B1E A;  1UKJ A;  3FZ7 A;  2W8T A;  3MAU A;  5EIG B;  4B98 A;  1RVU A;  4BA5 A;  2DGK A;  1V72 A;  3AEP A;  3E2Y A;  1BS0 A;  4EFF A;  5M46 A;  2BI2 A;  4XJO A;  2VMS A;  1IX7 A;  3NUI A;  3CQ6 A;  2V1P A;  1GCK A;  1YJZ A;  4IX8 A;  1LC8 A;  4EU1 A;  4CBS A;  4W1X A;  3DR4 A;  3Q8N A;  5BJ3 A;  1ASF A;  3ZZK A;  3EZ1 A;  1WST A;  4BQ0 A;  2YKU A;  4WP0 A;  3FVU A;  2D7Z A;  3B46 A;  2VMY A;  3RQ1 A;  2CJH A;  2HOY A;  2C7T A;  3PPL A;  2X5D A;  1ASN A;  4FL0 A;  3N0L A;  2W7D A;  3VK2 A;  1SVV A;  4OCA A;  4IXO A;  2AY2 A;  1BJW A;  3FRK A;  3BC8 A;  3E2Z A;  4A00 A;  1U08 A;  3AEO A;  4ZDO A;  2VGZ A;  2D65 A;  3AOV A;  3QBO A;  2VMX A;  2Z9X A;  2AEV A;  5BJ4 A;  3E9K A;  2W7G A;  4ZAS A;  1CZE A;  4B9B A;  1BW0 A;  4Q31 A;  1BJO A;  3BV0 A;  3EI6 A;  1LKC A;  2NMP A;  4TV7 A;  5G09 A;  4CBR A;  3AOW A;  4E3Q A;  4WYE A;  2X5F A;  1E5F A;  4Y0D A;  2RFV A;  4P3M A;  3JZL A;  1I41 A;  1S06 A;  3AEJ A;  3VAX A;  2V0Y A;  3NYS A;  4RKD A;  2QMA A;  1CJ0 A;  1YJY A;  3N4S A;  1YIY A;  3NTJ A;  4WXF A;  3HVY A;  2Z20 A;  3PA9 A;  1WYV B;  1C7G A;  1CL1 A;  2EH6 A;  3R9A A;  2OAT A;  1GEY A;  2YCT A;  1YOO A;  1SFF A;  1ORD A;  5F9S A;  2OQX A;  2CFB A;  5DX5 A;  4WB0 A;  3WGB A;  2D61 A;  3JTX A;  4ZSY A;  2XH1 A;  3NU8 A;  1IUG A;  3WGC A;  4JE5 D;  2BHX A;  2BYL A;  2W7M A;  5FT4 A;  1GBN A;  2AY1 A;  2QA3 A;  2VMZ A;  3K40 A;  3OKS A;  1YJS A;  4MY5 A;  3WKR A;  4HVK A;  1X2A A;  5E5I A;  3HMU A;  1UU2 A;  2DKJ A;  2FNU A;  3DXW A;  3K7Y A;  2W7E A;  1ARG A;  3KGX A;  4RJ0 A;  2YRR A;  3FFH A;  2VI8 A;  3NUB A;  1VP4 A;  2FQ6 A;  3JWB A;  4WD2 A;  3W1I A;  1ASL A;  1AJS B;  5G0A A;  4F4E A;  3AAT A;  3F6T A;  1MAQ A;  1C7N A;  2HOX A;  1SZU A;  3AEM A;  3JW9 A;  3HLM A;  2Z1Y A;  2BI3 A;  4WYC A;  3II0 A;  1D7V A;  2VMW A;  3RCH B;  4ADE A;  1LS3 A;  4A6R A;  4AZK A;  3AEJ C;  2Z9V A;  3VK4 A;  4MGR A;  4TN4 A;  1S08 A;  4BMK A;  2OGA A;  4WXB A;  4UHM A;  4RM1 A;  3FTB A;  3A2B A;  1AJR A;  1S09 A;  3DYD A;  3ELE A;  3LVK A;  1AMA A;  1ASB A;  3CBF A;  4W1V A;  1AKB A;  1W7M A;  2HOR A;  4XJL A;  1M32 A;  1TOJ A;  4MQR A;  4DGT A;  2XBN A;  1B9H A;  2ZSM A;  4JEX A;  3VP6 A;  1ASE A;  1BQA A;  1QIS A;  4ADC A;  1H1C A;  3CQ4 A;  2BWP A;  3OP7 A;  4CVQ A;  3N7N A;  2JG2 A;  2CB1 A;  1X0M A;  5HDM A;  1M0Q A;  3PDB A;  1LK9 A;  1OAT A;  4ITG A;  2R5C B;  5FT6 A;  3BCX A;  2BKW A;  5EIG A;  3HL2 A;  5M4D A;  2HOZ A;  4PFF A;  1MAP A;  2QBT A;  3TFT A;  1IVR A;  1PMM A;  1VEF A;  1IX8 A;  5M49 A;  3FQ7 A;  5EFS A;  4MSO A;  1Z3Z A;  3P1T A;  3FZ6 A;  2W8J A;  2DGM A;  1TOE A;  1TPL A;  4OC9 A;  1O4S A;  2CH1 A;  4E1O A;  1OHY A;  2VMR A;  1IBJ A;  1TOK A;  1WYT A;  3GET A;  3HBX A;  3FVS A;  3AEM C;  5E3K A;  1AY5 A;  1KMJ A;  5G2P A;  2WB6 A;  4J5U A;  4XAU A;  1C0N A;  1IJI A;  1GEW A;  1LW5 A;  1GEX A;  1Y4I A;  1BKG A;  4RAE A;  4K05 A;  3LV2 A;  2AY5 A;  2C81 A;  2X8U A;  4ZLV A;  4LNM A;  4CXR A;  1O62 A;  1ZC9 A;  3GSB A;  2VIB A;  4Y0I A;  4BA4 A;  1YIZ A;  2C0R A;  1KAF A;  4U1T A;  3W1H A;  4MKJ A;  2FN6 A;  4ZSW A;  1S07 A;  4KAM A;  4E77 A;  4F5I A;  5IWQ A;  3DR7 A;  3E6G A;  1TOI A;  5M4B A;  1MDX A;  1X28 A;  4U2H A;  3LVL B;  4AZJ A;  1TAT A;  4QGR A;  4A6U A;  3W1J A;  4KYO A;  3TQX A;  2BIA A;  5DJ1 A;  4WYD A;  2ZY5 A;  4A72 A;  2JIS A;  2YCN A;  2BIG A;  3LG0 A;  1AAW A;  1DKA A;  2VMN A;  4R5Z A;  5LHA A;  2EYQ A;  4AO4 A;  1AIA A;  3EUC A;  4TMR A;  1OHV A;  2BI5 A;  1SZK A;  4Q75 A;  3CQ5 A;  1PFF A;  4K2B A;  4RLG A;  1AHG A;  2BYJ A;  2QSR A;  1AHE A;  2VMO A;  4F5G A;  2VMV A;  1ASC A;  4ADB A;  1DJU A;  1UU1 A;  2Z9U A;  4W91 A;  3L8A A;  2YOB A;  3KGW A;  4AOA A;  4CXQ A;  2JJH A;  3DXV A;  3ZRQ A;  1KKJ A;  2AEU A;  1GC4 A;  2VLH A;  3LY1 A;  1ART A;  1CS1 A;  4MQP A;  1FG7 A;  1JS6 A;  1T3I A;  2CJD A;  2GB3 A;  2Z9W A;  3QPG A;  3FQ8 A;  4GSA A;  3WKS A;  3JU7 A;  4GEB A;  3TCM A;  4J8L A;  5DB5 A;  2ZY2 A;  4M2M A;  4DQ6 A;  2ZP7 A;  3EIA A;  3QI6 A;  2BI1 A;  2D64 A;  5E4Z A;  2DR1 A;  3B8X A;  4ISY A;  3NYU A;  4UHO A;  2YKY A;  1SPA A;  4F5F A;  1C9C A;  2EPJ A;  1Z7D A;  2R0T A;  3VK3 A;  5HHY A;  3WCN A;  1KMK A;  3NYT A;  1ASA A;  3LVM A;  2W7I A;  4R2N A;  1XEY A;  4F5H A;  2YKV A;  2VLF A;  3COG A;  4MKK A;  2DGL A;  3LWS A;  1N8P A;  4RKC A;  2OKK A;  2ZJG A;  2DOU A;  4GE7 A;  5LH9 A;  2W8U A;  3RI6 A;  3BWN A;  4OMA A;  1G7X A;  3GZC A;  5FT5 A;  2JJE A;  1M0O A;  1V2F A;  3FKD A;  4GE4 A;  3H9X A;  1DFO A;  2AY4 A;  4F5M A;  3DZZ A;  4GE9 A;  4AO9 A;  3PGY A;  2AY6 A;  3IHJ A;  2HUF A;  3E2Z B;  1J04 A;  1M7Y A;  1P3W A;  1JS3 A;  2E7I A;  1DJE A;  3NU7 A;  3E2F A;  2ORD A;  3NDN A;  4UHN A;  4Q76 A;  1E5E A;  2Q7W A;  1AIB A;  1MLY A;  4W1W A;  4XEW A;  4IYO B;  3FCR A;  3EIB A;  1ASM A;  3G8M A;  4XK1 A;  1BJO B;  5D95 A;  1C7O A;  5TF5 A;  2W7K A;  1AHY A;  4IY7 A;  3TAT A;  4RIT A;  3GWP A;  1MGV A;  1EG5 A;  2G7J A;  1LC7 A;  2JJF A;  4L0O A;  5EAA A;  4JEW A;  4W8I A;  2E7U A;  1AMS A;  2EZ1 A;  3GJU A;  1LW4 A;  2GQN A;  1QGN A;  4I8A A;  1V2E A;  3PIU A;  5EQC A;  4OBV A;  2EO5 A;  3WCO A;  2VMQ A;  2CAN A;  1TOG A;  2CY8 A;  4EB5 A;  1AIC A;  2CH2 A;  2JGT A;  5KTB A;  3TFU A;  4WLJ A;  5AX8 A;  2E54 A;  5FT8 A;  1OXO A;  3K28 A;  3G0T A;  1M0P A;  3PAA A;  2VMU A;  1CL2 A;  3BWN C;  3HQT A;  4WB0 B;  2C44 A;  2W7H A;  2R2N A;  2QLR A;  4PIW A;  4LW4 A;  1TAR A;  5JAY A;  1PG8 A;  1QJ3 A;  3GZD A;  2OKJ A;  2HP1 A;  3I5T A;  4IW7 A;  2W7J A;  3F9T A;  2VIA A;  1DJ9 A;  2BWO A;  2JJG A;  3EI5 A;  1CQ7 A;  1KL1 A;  4JEY A;  1RV3 A;  4XJP A;  4EMY A;  4A6T A;  2VMT A;  3N75 A;  3KE3 A;  4K2I A;  2W7L A;  1C4K A;  3WZF A;  4E3R A;  2PB2 A;  4WYG A;  4ZDL A;  2VI9 A;  2QB2 A;  3FD0 A;  5F8V A;  3AEN B;  3GR9 A;  2O7C A;  3FVX A;  1O69 A;  5D5S A;  3BWO A;  2FM1 A;  1JF9 A;  4MQQ A;  4NOG A;  1B5O A;  3HDO A;  4ZWM A;  2PB0 A;  3ECD A;  3RUY A;  1QJ5 A;  3WLX A;  1ARS A;  4OTL A;  1ZOB A;  7AAT A;  1ARI A;  1BQD A;  4A0R A;  2G6W A;  4PFN A;  4UQV A;  1IAY A;  1MDZ A;  4Y0H A;  3UAK A;  2O1B A;  5I92 A;  1J32 A;  1JG8 A;  5DJ9 A;  3ATH A;  3GBX A;  1WYU B;  1ELU A;  3QM2 A;  1ASG A;  9AAT A;  2Z67 A;  4R8D A;  4F5J A;  3GZD C;  4ADD A;  1ZOD A;  3ISL A;  4XJM A;  3P6K A;  1VJO A;  2YHK A;  2YRI A;  2GMU A;  2D66 A;  2VMP A;  4OT8 A;  1RV4 A;  3PD6 B;  1D7S A;  4JEZ A;  2AY7 A;  2WKA A;  3H14 A;  1ELQ A;  1ECX A;  2D5Y A;  3CAI A;  4JF1 A;  2D7Y A;  1GC0 A;  1I29 A;  4WXG A;  2VGV A;  3EI8 A;  1GD9 A;  3F0H A;  3USF A;  4LW2 A;  1ARH A;  2ZYJ A;  3A8U X;  3G7Q A;  1YAA A;  2D63 A;  4JF0 A;  4F5K A;  1EQB A;  3ZRR A;  4LNL A;  3MC6 A;  1G4V A;  5EUN A;  1FC4 A;  1BJ4 A;  1WYT B;  2YCP A;  1WYV A;  1ASD A;  3EI7 A;  2W7F A;  1AHF A;  3MAF B;  3FDD A;  3WY7 A;  1WKH A;  1AY8 A;  3KKI A;  2PO3 A;  3N5M A;  3QGU A;  2GSA A;  1YNU A;  1G4X A;  4ZM4 A;  1B5P A;  2AY9 A;  3ELP A;  1H0C A;  2VGW A;  3EI9 A;  3QN6 A;  4Q6R A;  2GMS A;  2VGS A;  3HT4 A;  3B1D A;  3ACZ A;  2YKX A;  3RBF A;  2W8W A;  1S0A A;  4WLH A;  4AH3 A;  3L44 A;  3IF2 A;  1KKP A;  1AMR A;  1N2T A;  3M5U A;  4FFC A;  4KXK A;  3DOD A;  2AY8 A;  1UU0 A;  3D6K A; 
#chains in the Genus database with same CATH homology
 1DGD A;  3B1C A;  2ZY4 A;  2ZUK A;  1O61 A;  4PVF A;  4ZAH A;  3FZ8 A;  2FYF A;  3AEL A;  3I4J A;  4N0B A;  2QB3 A;  3A9Y A;  3EZS A;  1AJS A;  5K8B A;  1AMQ A;  4IYO A;  3RCH A;  8AAT A;  1FG3 A;  5HXX A;  2F8J A;  1B9I A;  4JE5 A;  4WYF A;  3JWA A;  4ZDP A;  2ZC0 A;  3FSL A;  1IX6 A;  1AY4 A;  1AX4 A;  3A9X A;  1W3U A;  3MC6 C;  3WX9 A;  4IXZ A;  3FFR A;  1W7L A;  3ASB A;  2EGY A;  1N31 A;  2WK8 A;  3R4T A;  3MBB A;  4BHD A;  2AAT A;  3N4X A;  4JEV A;  3NX3 A;  1OXP A;  4LC3 A;  1BJN A;  3LVJ A;  4ITX A;  4A0H A;  4RJY A;  1I48 A;  1QIT A;  3BS8 A;  1LC5 A;  2HUU A;  3RBL A;  1QIR A;  1OHW A;  4M2K A;  3T32 A;  1D7R A;  4M2J A;  4LNJ A;  1BT4 A;  2R5C A;  4OBU A;  3I16 A;  2Z61 A;  4OYT A;  1TAS A;  3DRD A;  1W23 A;  1W7N A;  2DKB A;  4ATQ A;  2X3L A;  1I43 A;  1B4X A;  4GRX A;  2FNI A;  3DU4 A;  2W8V A;  3DC1 A;  5J8Q A;  2VYC A;  1EJI A;  1SF2 A;  4ZWV A;  2AY3 A;  2BI9 A;  3MKJ A;  1CQ8 A;  4IXS A;  1AHX A;  1IAX A;  3AEN A;  1WKG A;  2ZSL A;  4WBT A;  4N0W A;  2Z1Z A;  3FDB A;  4WYA A;  1MLZ A;  4ZM3 A;  3BN1 A;  4RIZ A;  2O0R A;  4O6Z A;  1KL2 A;  1GC2 A;  3MEB A;  2CST A;  2CTZ A;  5EAV A;  1M0N A;  3A9Z A;  1DTY A;  3ZRP A;  2A1V A;  1GDE A;  2E7J A;  2KFP A;  3NRA A;  4K2M A;  4EB7 A;  3AV7 A;  3UWC A;  2HUI A;  3NNK A;  3QHX A;  3PJ0 A;  1GC3 A;  1X29 A;  1XI9 A;  2OGE A;  2VGU A;  1V2D A;  1G7W A;  2HP2 A;  3ASA A;  3MAD A;  1B8G A;  1WYU A;  5G4J A;  4A0F A;  5C6U A;  4ATP A;  4XQ2 A;  3PDX A;  1D7U A;  1MDO A;  1AAM A;  2BWN A;  4H51 A;  2TPL A;  4HF8 A;  2WK7 A;  3UE8 A;  3PD6 A;  1CQ6 A;  4R5F A;  1DGE A;  3VOM A;  1RVY A;  3BB8 A;  1M6S A;  3E77 A;  4UOY A;  3N4R A;  2VGT A;  3ZZJ A;  2HZP A;  1AKC A;  1PMO A;  2R5E A;  5G2Q A;  4GDY A;  3H7F A;  4DBC A;  2EZ2 A;  4W5K A;  5EUE A;  3BCA A;  2BIE A;  1CZC A;  3MAF A;  4H63 Q;  1QZ9 A;  1D2F A;  2FKI A;  4F5L A;  3FQA A;  1AKA A;  2CJG A;  5EUD A;  1SZS A;  1M4N A;  4A0G A;  2ZY3 A;  3PDB B;  5G4I A;  2WK9 A;  2CIN A;  4P7Y A;  3BCB A;  3B1E A;  1UKJ A;  3FZ7 A;  2W8T A;  3MAU A;  5EIG B;  4B98 A;  1RVU A;  4BA5 A;  2DGK A;  1V72 A;  3AEP A;  3E2Y A;  1BS0 A;  4EFF A;  5M46 A;  2BI2 A;  4XJO A;  2VMS A;  1IX7 A;  3NUI A;  3CQ6 A;  2V1P A;  1GCK A;  1YJZ A;  4IX8 A;  1LC8 A;  4EU1 A;  4CBS A;  4W1X A;  3DR4 A;  3Q8N A;  5BJ3 A;  1ASF A;  3ZZK A;  3EZ1 A;  1WST A;  4BQ0 A;  2YKU A;  4WP0 A;  3FVU A;  2D7Z A;  3B46 A;  2VMY A;  3RQ1 A;  2CJH A;  2HOY A;  2C7T A;  3PPL A;  2X5D A;  1ASN A;  4FL0 A;  3N0L A;  2W7D A;  3VK2 A;  1SVV A;  4OCA A;  4IXO A;  2AY2 A;  1BJW A;  3FRK A;  3BC8 A;  3E2Z A;  4A00 A;  1U08 A;  3AEO A;  4ZDO A;  2VGZ A;  2D65 A;  3AOV A;  3QBO A;  2VMX A;  2Z9X A;  2AEV A;  5BJ4 A;  3E9K A;  2W7G A;  4ZAS A;  1CZE A;  4B9B A;  1BW0 A;  4Q31 A;  1BJO A;  3BV0 A;  3EI6 A;  1LKC A;  2NMP A;  4TV7 A;  5G09 A;  4CBR A;  3AOW A;  4E3Q A;  4WYE A;  2X5F A;  1E5F A;  4Y0D A;  2RFV A;  4P3M A;  3JZL A;  1I41 A;  1S06 A;  3AEJ A;  3VAX A;  2V0Y A;  3NYS A;  4RKD A;  2QMA A;  1CJ0 A;  1YJY A;  3N4S A;  1YIY A;  3NTJ A;  4WXF A;  3HVY A;  2Z20 A;  3PA9 A;  1WYV B;  1C7G A;  1CL1 A;  2EH6 A;  3R9A A;  2OAT A;  1GEY A;  2YCT A;  1YOO A;  1SFF A;  1ORD A;  5F9S A;  2OQX A;  2CFB A;  5DX5 A;  4WB0 A;  3WGB A;  2D61 A;  3JTX A;  4ZSY A;  2XH1 A;  3NU8 A;  1IUG A;  3WGC A;  4JE5 D;  2BHX A;  2BYL A;  2W7M A;  5FT4 A;  1GBN A;  2AY1 A;  2QA3 A;  2VMZ A;  3K40 A;  3OKS A;  1YJS A;  4MY5 A;  3WKR A;  4HVK A;  1X2A A;  5E5I A;  3HMU A;  1UU2 A;  2DKJ A;  2FNU A;  3DXW A;  3K7Y A;  2W7E A;  1ARG A;  3KGX A;  4RJ0 A;  2YRR A;  3FFH A;  2VI8 A;  3NUB A;  1VP4 A;  2FQ6 A;  3JWB A;  4WD2 A;  3W1I A;  1ASL A;  1AJS B;  5G0A A;  4F4E A;  3AAT A;  3F6T A;  1MAQ A;  1C7N A;  2HOX A;  1SZU A;  3AEM A;  3JW9 A;  3HLM A;  2Z1Y A;  2BI3 A;  4WYC A;  3II0 A;  1D7V A;  2VMW A;  3RCH B;  4ADE A;  1LS3 A;  4A6R A;  4AZK A;  3AEJ C;  2Z9V A;  3VK4 A;  4MGR A;  4TN4 A;  1S08 A;  4BMK A;  2OGA A;  4WXB A;  4UHM A;  4RM1 A;  3FTB A;  3A2B A;  1AJR A;  1S09 A;  3DYD A;  3ELE A;  3LVK A;  1AMA A;  1ASB A;  3CBF A;  4W1V A;  1AKB A;  1W7M A;  2HOR A;  4XJL A;  1M32 A;  1TOJ A;  4MQR A;  4DGT A;  2XBN A;  1B9H A;  2ZSM A;  4JEX A;  3VP6 A;  1ASE A;  1BQA A;  1QIS A;  4ADC A;  1H1C A;  3CQ4 A;  2BWP A;  3OP7 A;  4CVQ A;  3N7N A;  2JG2 A;  2CB1 A;  1X0M A;  5HDM A;  1M0Q A;  3PDB A;  1LK9 A;  1OAT A;  4ITG A;  2R5C B;  5FT6 A;  3BCX A;  2BKW A;  5EIG A;  3HL2 A;  5M4D A;  2HOZ A;  4PFF A;  1MAP A;  2QBT A;  3TFT A;  1IVR A;  1PMM A;  1VEF A;  1IX8 A;  5M49 A;  3FQ7 A;  5EFS A;  4MSO A;  1Z3Z A;  3P1T A;  3FZ6 A;  2W8J A;  2DGM A;  1TOE A;  1TPL A;  4OC9 A;  1O4S A;  2CH1 A;  4E1O A;  1OHY A;  2VMR A;  1IBJ A;  1TOK A;  1WYT A;  3GET A;  3HBX A;  3FVS A;  3AEM C;  5E3K A;  1AY5 A;  1KMJ A;  5G2P A;  2WB6 A;  4J5U A;  4XAU A;  1C0N A;  1IJI A;  1GEW A;  1LW5 A;  1GEX A;  1Y4I A;  1BKG A;  4RAE A;  4K05 A;  3LV2 A;  2AY5 A;  2C81 A;  2X8U A;  4ZLV A;  4LNM A;  4CXR A;  1O62 A;  1ZC9 A;  3GSB A;  2VIB A;  4Y0I A;  4BA4 A;  1YIZ A;  2C0R A;  4U1T A;  3W1H A;  4MKJ A;  2FN6 A;  4ZSW A;  1S07 A;  4KAM A;  4E77 A;  4F5I A;  5IWQ A;  3DR7 A;  3E6G A;  1TOI A;  5M4B A;  1MDX A;  1X28 A;  4U2H A;  3LVL B;  4AZJ A;  1TAT A;  4QGR A;  4A6U A;  3W1J A;  4KYO A;  3TQX A;  2BIA A;  5DJ1 A;  4WYD A;  2ZY5 A;  4A72 A;  2JIS A;  2YCN A;  2BIG A;  3LG0 A;  1AAW A;  1DKA A;  2VMN A;  4R5Z A;  5LHA A;  2EYQ A;  4AO4 A;  1AIA A;  3EUC A;  4TMR A;  1OHV A;  2BI5 A;  1SZK A;  4Q75 A;  3CQ5 A;  1PFF A;  4K2B A;  4RLG A;  1AHG A;  2BYJ A;  2QSR A;  1AHE A;  2VMO A;  4F5G A;  2VMV A;  1ASC A;  4ADB A;  1DJU A;  1UU1 A;  2Z9U A;  4W91 A;  3L8A A;  2YOB A;  3KGW A;  4AOA A;  4CXQ A;  2JJH A;  3DXV A;  3ZRQ A;  1KKJ A;  2AEU A;  1GC4 A;  2VLH A;  3LY1 A;  1ART A;  1CS1 A;  4MQP A;  1FG7 A;  1JS6 A;  1T3I A;  2CJD A;  2GB3 A;  2Z9W A;  3QPG A;  3FQ8 A;  4GSA A;  3WKS A;  3JU7 A;  4GEB A;  3TCM A;  4J8L A;  5DB5 A;  2ZY2 A;  4M2M A;  4DQ6 A;  2ZP7 A;  3EIA A;  3QI6 A;  2BI1 A;  2D64 A;  5E4Z A;  2DR1 A;  3B8X A;  4ISY A;  3NYU A;  4UHO A;  2YKY A;  1SPA A;  4F5F A;  1C9C A;  2EPJ A;  1Z7D A;  2R0T A;  3VK3 A;  5HHY A;  3WCN A;  1KMK A;  3NYT A;  1ASA A;  3LVM A;  2W7I A;  4R2N A;  1XEY A;  4F5H A;  2YKV A;  2VLF A;  3COG A;  4MKK A;  2DGL A;  3LWS A;  1N8P A;  4RKC A;  2OKK A;  2ZJG A;  2DOU A;  4GE7 A;  5LH9 A;  2W8U A;  3RI6 A;  3BWN A;  4OMA A;  1G7X A;  3GZC A;  5FT5 A;  2JJE A;  1M0O A;  1V2F A;  3FKD A;  4GE4 A;  3H9X A;  1DFO A;  2AY4 A;  4F5M A;  3DZZ A;  4GE9 A;  4AO9 A;  3PGY A;  2AY6 A;  3IHJ A;  2HUF A;  3E2Z B;  1J04 A;  1M7Y A;  1P3W A;  1JS3 A;  2E7I A;  1DJE A;  3NU7 A;  3E2F A;  2ORD A;  3NDN A;  4UHN A;  4Q76 A;  1E5E A;  2Q7W A;  1AIB A;  1MLY A;  4W1W A;  4XEW A;  4IYO B;  3FCR A;  3EIB A;  1ASM A;  3G8M A;  4XK1 A;  1BJO B;  5D95 A;  1C7O A;  5TF5 A;  2W7K A;  1AHY A;  4IY7 A;  3TAT A;  4RIT A;  3GWP A;  1MGV A;  1EG5 A;  2G7J A;  1LC7 A;  2JJF A;  4L0O A;  5EAA A;  4JEW A;  4W8I A;  2E7U A;  1AMS A;  2EZ1 A;  3GJU A;  1LW4 A;  2GQN A;  1QGN A;  4I8A A;  1V2E A;  3PIU A;  5EQC A;  4OBV A;  2EO5 A;  3WCO A;  2VMQ A;  2CAN A;  1TOG A;  2CY8 A;  4EB5 A;  1AIC A;  2CH2 A;  2JGT A;  5KTB A;  3TFU A;  4WLJ A;  5AX8 A;  2E54 A;  5FT8 A;  1OXO A;  3K28 A;  3G0T A;  1M0P A;  3PAA A;  2VMU A;  1CL2 A;  3BWN C;  3HQT A;  4WB0 B;  2C44 A;  2W7H A;  2R2N A;  2QLR A;  4PIW A;  4LW4 A;  1TAR A;  5JAY A;  1PG8 A;  1QJ3 A;  3GZD A;  2OKJ A;  2HP1 A;  3I5T A;  4IW7 A;  2W7J A;  3F9T A;  2VIA A;  1DJ9 A;  2BWO A;  2JJG A;  3EI5 A;  1CQ7 A;  1KL1 A;  4JEY A;  1RV3 A;  4XJP A;  4EMY A;  4A6T A;  2VMT A;  3N75 A;  3KE3 A;  4K2I A;  2W7L A;  1C4K A;  3WZF A;  4E3R A;  2PB2 A;  4WYG A;  4ZDL A;  2VI9 A;  2QB2 A;  3FD0 A;  5F8V A;  3AEN B;  3GR9 A;  2O7C A;  3FVX A;  1O69 A;  5D5S A;  3BWO A;  2FM1 A;  1JF9 A;  4MQQ A;  4NOG A;  1B5O A;  3HDO A;  4ZWM A;  2PB0 A;  3ECD A;  3RUY A;  1QJ5 A;  3WLX A;  1ARS A;  4OTL A;  1ZOB A;  7AAT A;  1ARI A;  1BQD A;  4A0R A;  2G6W A;  4PFN A;  4UQV A;  1IAY A;  1MDZ A;  4Y0H A;  3UAK A;  2O1B A;  5I92 A;  1J32 A;  1JG8 A;  5DJ9 A;  3ATH A;  3GBX A;  1WYU B;  1ELU A;  3QM2 A;  1ASG A;  9AAT A;  2Z67 A;  4R8D A;  4F5J A;  3GZD C;  4ADD A;  1ZOD A;  3ISL A;  4XJM A;  3P6K A;  1VJO A;  2YHK A;  2YRI A;  2GMU A;  2D66 A;  2VMP A;  4OT8 A;  1RV4 A;  3PD6 B;  1D7S A;  4JEZ A;  2AY7 A;  2WKA A;  3H14 A;  1ELQ A;  1ECX A;  2D5Y A;  3CAI A;  4JF1 A;  2D7Y A;  1GC0 A;  1I29 A;  4WXG A;  2VGV A;  3EI8 A;  1GD9 A;  3F0H A;  3USF A;  4LW2 A;  1ARH A;  2ZYJ A;  3A8U X;  3G7Q A;  1YAA A;  2D63 A;  4JF0 A;  4F5K A;  1EQB A;  3ZRR A;  4LNL A;  3MC6 A;  1G4V A;  5EUN A;  1FC4 A;  1BJ4 A;  1WYT B;  2YCP A;  1WYV A;  1ASD A;  3EI7 A;  2W7F A;  1AHF A;  3MAF B;  3FDD A;  3WY7 A;  1WKH A;  1AY8 A;  3KKI A;  2PO3 A;  3N5M A;  3QGU A;  2GSA A;  1YNU A;  1G4X A;  4ZM4 A;  1B5P A;  2AY9 A;  3ELP A;  1H0C A;  2VGW A;  3EI9 A;  3QN6 A;  4Q6R A;  2GMS A;  2VGS A;  3HT4 A;  3B1D A;  3ACZ A;  2YKX A;  3RBF A;  2W8W A;  1S0A A;  4WLH A;  4AH3 A;  3L44 A;  3IF2 A;  1KKP A;  1AMR A;  1N2T A;  3M5U A;  4FFC A;  4KXK A;  3DOD A;  2AY8 A;  1UU0 A;  3D6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...