5C9JA

Human cd1c with ligands in a' and f' channel
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
281
structure length
281
Chain Sequence
EHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVKPEAWLSSGPSPGPGRLQLVCHVSGFYPKPVWVMWMRGEQEQQGTQLGDILPNANWTWYLRATLDVADGEAAGLSCRVKHSSLEGQDIILYWGPGSGGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T-cell surface glycoprotein CD1c,T-cell surface glycoprotein
publication title Cholesteryl esters stabilize human CD1c conformations for recognition by self-reactive T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 281
sequence length 281
ec nomenclature
pdb deposition date 2015-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5c9jA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 5c9jA01
4YHKH 1VDGA 4U1LB 1U8KA 4R4NC 2OX5A 5HDQL 4H8WH 5HHXH 1HZHH 1Q9WA 3DXAE 3GJEA 4LEXL 5DC4B 1YN7B 3M17B 4HJ0C 3LB6D 5I1LB 4JJ5A 5BOZG 1A6VH 2WIIA 2JB5H 1YMMB 1C1EH 2GQHA 1MJJB 1MREL 4HKBB 2FIKA 2I07A 3VFOB 3M8OL 3OHXB 3BP5B 5D96C 1YNKH 1A8JH 5ITFB 2BNRE 2ARWA 3BD4A 4HXAL 5ID0B 4P2QA 2DBJA 3PNWA 2W07A 4OZGF 4BSWB 4HIJA 4OF6A 1RV6X 3GBLA 3P9LA 2X4PB 1F6LL 3QH3B 5DVKA 2NR6C 2LQRA 3CCHA 2UVEA 4PJCB 2VQ1B 5TE6H 4RAVA 2XZAH 1JUFB 4DAGH 2VC2L 2X70B 3U7YL 1A4KA 3KXFD 4D9LL 3FQWB 2PW2B 2YN3A 1XF2B 2CMRL 5CSZA 5FDWA 3WSQL 1MCJA 4JDTL 3UAJC 1RIVH 1A47A 2FJHB 5EUOA 4DK6A 3LKNB 1NAML 4Z7QE 3I9GH 2DLEA 4DN4H 5EA0L 1QG3A 1V05A 1C5DB 3O81A 2A6KB 3WN5C 5I1GL 2OTWB 3JV4A 1CT8A 3D1MC 5JTWA 1FFOB 1LEGB 2J12B 2FSEA 3CLFL 1P53A 3HE6C 1BQHA 5DR5L 4HUVB 1F3DJ 3U2SA 5DQJB 2X40A 4XCYB 4OZHE 1RU9L 5KSBE 3DURB 4WW1B 5CZKA 3P40A 2QSQA 4C56A 4GKZB 2KUTA 1IGMH 3V79C 2P8LA 4P9HH 3SE4C 3VGEA 4DJMA 5HHQB 2FX9L 3TESA 5ADOH 1NANH 4X5LA 3C9NB 5B38A 4P3DA 5AG9A 1WEJH 1JTPA 4A6YL 4KKCC 4OUUA 3LRSB 3PL6B 5IJKA 1P9MA 2HKHH 1N0XL 3TV3L 3UX9B 4QXTA 2P8MA 4TVPH 5K33A 5IJVA 5SX5K 4WEBH 3HN3A 5C0GA 1GSMA 3MLVH 2Y5EA 4UIMA 1A1OB 4EXKA 4YXHL 3MRIB 1SQ2N 1OAXL 2NY3C 3HPLB 4JN1L 3EZ8A 5FUOL 1NJ9A 3SDAB 1MVFA 3SGJC 4YHML 2MCG1 2NY6C 3FQRA 4JB9H 3TNNA 5C6WH 4Q6IA 1HKLL 2NXYD 5ENWB 4QWWC 2HAZA 5DUBB 4OZFB 1CVSC 3ET9F 4IS6B 5MEOA 5BV7H 4NWUH 4TVPE 5GS2D 4WEMB 4ZUTA 2XWBB 4OD2B 1HHGA 4FQHB 4OAWA 3O4LD 4ZFFA 3D39B 4WVRA 3ARGB 1W8OA 2D03H 2HVJA 3K8MA 2GITB 2ZUUA 3QUZB 4OF8A 3K2UH 2W0KA 4GXVH 4MAYC 3TVMA 4J8RB 1FG2A 4CVZB 1ACYL 4KROB 5E8NA 1FH5H 2OM5A 4MA1C 3MJ7B 3VWJB 4NQXA 3PP3H 4G6MH 4X80H 5B8CA 1NCCL 2WK2A 1Z9LA 2Q7NA 1F97A 1X3DA 1ACZA 2F54A 4RMUA 5A1AA 1D5MB 1XCTA 3IDNA 5D7LB 5MI0B 5K59E 5GZOD 4WHTB 4L9LC 3QNYB 3ESVF 1W72A 5D2NA 5DI8B 2VDML 3OJ2C 4LFHD 4ZFZB 3U9PL 3IGAB 2Y06L 5F3BA 4L4VD 2J6EH 3SHSA 3MRQB 4PLNC 4BM7A 3VFNA 1WICA 2AGJL 2W60B 4W4NA 1NMAH 4HUXB 4JFOA 4QHUB 5FFLA 4JAMA 3TN0C 3QA3A 1FRGL 1LK3L 3SEPA 3AMKA 2C1PA 4OZGE 2XA8H 1A7NH 4JKPH 1IRAY 3BEVA 3LPGA 3NZ8A 4XXCC 2UWEA 1KXTB 3GMPA 4N1EA 3LN4B 3HNVL 4Z77B 4HS6A 3V8CA 2AK1H 3QULB 4JRYA 1OP5H 1ZLWK 2AJVL 1YYMH 4PB0H 2MHAB 4XPFH 3LKQB 1H3TA 4P4RA 3RTQC 1HN1A 5F1OB 3DX7B 4P2RA 2BHUA 2XWTA 2Z9TA 4YDVB 3S35H 3QEQB 5DHYA 5IB4B 4PFEA 4NN6C 4NKIH 4PJBB 1JPGB 3MA7A 1MI5D 2VOTA 5DYOA 4CU6A 2YXFA 5HVFB 2VH5L 2HLAA 3VG9C 3GBNH 5E5RB 1AO7D 1NUGA 3UPRA 4XI5D 2YUVA 4MQXC 2UV3A 5GGSA 4IRJC 3T2PA 3MLZH 5D7JA 4JFDB 4QCIA 5CHNB 1EDQA 4K8RH 2X44D 1H8SA 3GBML 4JZNA 3NABH 4I9WE 2EE2A 2X4OA 4H0IA 1LDPL 2ZWLT 5I18H 2H2SD 3CFJB 3NPZB 3O8XD 4JREB 4OJFL 1QRNA 5D6DC 4EDWH 3MNVB 1KLGA 3EO0A 1OT2A 2P5EB 1FZKA 1HYRC 5LGJA 2OR7A 4MJ6A 4U1IB 3CSPA 4XWOD 1BBJB 2VLJA 5E9DA 1W0VB 3V4PH 3SGKC 4F3FB 3U36A 3IFLL 3TT1H 3V0VB 1FV1A 2ICES 5JOFA 2PXYB 5JO5A 1JF1B 5K93A 12E8L 4LVNC 1WFUA 5I9QC 5IM7B 4NZRH 2I9TA 2EZ0D 5FDYA 4DKFL 1T1ZB 2RB8A 2EDXA 4O58H 3BPOB 3N9GH 1R3KA 4OI9A 3QNXB 1P6AB 1ADQL 4YLQT 4PRAA 2Z31D 1UGNA 3RKDC 2WQRA 1LEKB 5TQ0L 2BNQB 3TO4C 5EZIH 1CBVL 4WO4D 3VXSA 3UZVB 3DSNA 2CXGA 4QRRE 3RIFK 3RWFB 4MXVF 4NT6A 2O5ZH 2OLDA 4KKNA 4PRIA 4Z8FH 2YPLD 2HG5B 4NQDD 5D96B 3EFFB 3B5TA 4M7LH 1CS6A 2NZ9D 3PDGA 4L8DB 3EGSB 4ZXBC 3TBSB 3H6JA 1MQKH 1BAFL 3HZKB 1QR1B 1QBLH 3LZFL 4RGND 2C3XA 2R69H 2D0GA 3SY0B 1CICA 2X4RB 3QFDB 2R1YA 4H1LA 4NQVB 4HZLB 1IVLA 3NIGF 1N6QL 4O9HL 4F33B 1I9JH 3GMMB 3CK0L 1S8DA 3LKRA 3M1BB 3EDKA 3MV8E 4BUHA 3TYGL 5DO2C 3EW3B 1TNNA 2RAMA 2OJZL 3ARBC 2ICWJ 1NAKL 4LSTL 1KYOJ 3V5KA 3FMGH 2BCKB 2C3VB 4KI1A 2MPAL 5H94B 1OSPH 1HH6A 2B8OT 4JPIA 5IROA 3AB0C 1CFTB 3MQIA 3WN5B 1S7UA 1R5VA 1YEDB 5D1XD 3RY6C 4M6MH 3HE6B 1BJMA 5C0EA 4FTVA 1UH4A 3MUHL 3EJZD 4Z7OF 5IEKA 2EE9A 1BQSA 3I3BA 5ESVA 3ARFD 3E6HA 4HS3B 1YNTB 5GS3A 5LWYH 3VE0B 3R06A 3MRRB 1XGTA 5JORA 2OCFD 4OIAA 1S3KH 1MCHA 4KQ4H 2JTDA 2DYPD 4ODSL 5HPOA 1IJ9A 2NY3B 1IC5H 4J6RL 1HNGA 4G80A 1DJSA 2V9RA 3PQYD 4KHXL 2LE9A 2NY6B 2PKDA 3WIIL 1DANT 2HJLB 2I24N 4OCXH 2HWZH 1KB5B 1M7DB 1KJVA 4QRPE 1MFDL 1CIUA 3RHWF 2FGWH 4NQCE 1BX2B 2VSDA 4WW2F 5D1QA 3WL9A 2PW1B 2D7PA 1OOAA 5IV2A 3EFDL 3EIFA 4MQTB 3MRBB 4QHNA 1A7OL 4LBEB 5D5ME 2OBGA 2HFGH 2P7TA 2VXTL 2Y5TB 3D6GA 4MAYB 1U8OB 4MA1B 5LKNA 5E1HB 5HPMA 3KYMB 2G75A 3N85H 4G3YL 1HDMA 1GGBH 1IGFH 5E56A 2SEBB 1CR9H 3O3BB 4Z7UB 4JGJA 1KIRB 1HINH 1EXUB 3K8KA 3CIQA 1DR9A 3OAUL 2HRPL 3QHFL 5HDBF 5T1MB 4X6BA 1T04B 4L9LB 4MNQB 5FA4B 4AMKL 4LLMB 5I8KH 5EU4A 1S7TB 1GL4B 3ERYA 1ZEAH 4M6OL 4RBPK 4HPOH 4QHLB 5C09B 2ZPKL 2WW8A 2IFGA 2H3NA 2Q86A 1DUZA 2R15A 2Y7QA 4GRLD 1OAUL 3TN0B 1U58B 3EUUA 4C57C 2Z93B 5A16A 1HXMB 1NLDL 3NFNB 3CX2A 4OLWH 4TSCL 4JPKL 3JBG7 5IESH 4YHYC 5CZVH 4J4PD 4HV8A 1QACA 2OS7A 3G6JA 3GEWB 5C0CA 3ZLQC 3RTQB 1AI1L 1J1PL 1I85A 3OR6A 4XP4L 3HC4H 3KR3L 2EXWC 1SEBB 1RJZB 1MCEA 2WBJB 4PBXA 1JNHB 3PJSB 2X4PA 3OAZK 4LCYB 1IKNA 1N7MH 4OLVL 4ZOBA 2VWEC 1JGEA 2DQTL 3GSNA 1MCSA 4NN6B 3QJHB 2O61A 1UKTA 4FQIL 4H88L 1KNOA 2EH7H 4YHPA 1AXTL 5JW3L 3QWOB 2BERA 4U6VH 3VG9B 3RWDA 4XHQA 5CJBA 4Z7OE 3BJ91 4ZDHB 4IRJB 4MCZB 3B5GA 1MJUL 4NO5B 1RUML 1YQVL 2YMXH 1PJ9A 3FL7A 4LCWE 4N0CA 1OP9A 3BN9C 1LNUA 1SEQL 2DQDH 4GAJH 5DEZA 1J05A 4YUEL 5D2LA 5FB8A 3BPLC 3RPIB 5LG1A 1FYTA 1MJ8L 1I1CA 4CW1B 4LPCA 3H9YA 4LLYA 1WBYA 5ANMB 1X9QA 2YUWA 1S7RA 4GG6E 4PS4H 3QZWA 1FVDB 5HHMB 2PO6A 2IANB 5EZOL 1KCRH 3NACH 4M7JL 4F7MA 1UJ3A 3HI6H 5ERWA 4X8XA 4YHNB 4N5EC 2AI0L 1BIHA 4YEFA 1K4DB 4LVNB 2IADB 5I9QB 2O5XH 1NCUA 5E95B 1FLRL 1NGQH 3SDAA 3IDUA 2Z8WC 3JV6B 1ND0A 5F7DB 2W0LA 3DMMD 4W4OC 5BQ7B 4JM2A 3QDMB 3S3JA 3RNKA 5IVXE 3TO4B 1IAOA 3U4BL 4KTDL 4JM4H 4K23H 5JQHC 5LGKA 1PEZA 3JWDC 2Z91B 4ZG1A 3EO9H 4U1NB 1T80A 3VGGA 1U8HB 1EEZA 1WCQA 4RFOL 1YEEH 2DIAA 1XR8A 4JRXB 4X6DB 2FCBA 1G9MC 3QQ4A 4PRHB 4NKDA 3SE8L 3C09C 5HDQH 3HI1B 2F58L 1X5FA 2YC1A 4LEXH 1OWRM 4ZXBB 4CN4A 1FCCA 2FEEI 4OV6F 4E41A 1J0ZA 3WFBH 5EDXA 4L8SC 1U8MB 1LO4L 5I1CL 1IC4H 3F7QA 4AT6A 1CDUA 1R5WB 4Y5YC 1OTTC 4MZ3A 4YBQD 1EGJA 1LP9A 5GRZA 4L29B 1CFSB 2PTTB 4BA8A 5TQ2L 2Z35A 1KTKE 5H37G 2B1AL 2EDBA 1IM9D 2NY4C 4ZUSB 1VENA 4L5FL 2HN7B 3ARBB 1X4ZA 1JMXA 3VFUB 1BFSA 1S7WA 1EEQA 1RZ8B 1XGPB 2VC2H 4HUXA 3U7YH 3T4AA 3CPLB 5HDOA 3QPQC 3AB0B 4X6CA 4D9LH 5JUEH 2DQCL 3FT2B 5GRXG 2FYYA 3GSVA 4R7NA 2CMRH 3ARTA 2VLRA 3BWUC 4Z76B 5I6XC 3KXFE 4I3GA 5GGTL 3WSQH 4JDTH 3L3OA 1K85A 3CDGB 1BLNB 2FR4B 5KS9A 3JUZA 5GXBB 3TZVC 3CFIC 1NAMH 3STLA 3LEXA 2AXGA 1DBKL 5FK9A 3C2SA 3ZKXC 3T08A 4EIZC 1HQRA 1ZK9A 5EA0H 4XNQB 5IW1A 3OKLA 5I1GH 4KK6D 4MWFA 3BOVA 1TFHA 2VAAA 4JANA 3CLFH 4MD0B 5DR5H 2Q8AL 3BPCA 3N1MC 3OXRA 1UYWL 4X7TB 3TFKC 1RU9H 1ZA3A 1A7BA 3AGVA 2VKWA 1EIBA 1OAQH 2XQBL 3DROA 4MB5A 4WY7L 4ONGL 4Y19D 3VD4A 2VDLL 2FX9H 1NMCC 3PABB 3VFRA 2EO1A 4XBGA 4BSVA 2G60L 5EU6A 5AYUL 3ZE0F 4A6YH 5M95B 1N0XH 2ZOLB 3TV3H 1Y18B 1YY9D 5FGCB 4G8GB 4UMGA 1F45A 2OTUA 5GS2H 1OAXH 2DWEA 3L3IA 4JN1H 5FUOH 3H0TA 4UQ3A 1CXHA 4MD5B 1Q9OA 1S7SB 2JJWA 4YHMH 5DK0B 1WVZA 2HFEB 1KIPB 5EU7C 1KYOK 3PE9A 2KQNA 1HKLH 5IF0A 4ZOCA 4R96A 3KYNA 2VXSL 3HKFA 4RX4D 3LQMA 4U3CA 3WS3B 5KVMC 5FM5O 5CMAB 4M48L 5F6HJ 4RMTA 2GJZA 3ILQD 1C12B 4XGZA 2YK1L 3O4LE 1J7VR 1MHCA 5DJ6A 2R23B 2W0PA 5IMMB 3FQNA 1E6JL 1HSAB 2VXVL 1ACYH 4XMKL 1F3JA 4LEOB 4D0BA 4KGLA 5F71A 1NCCH 4PGCB 4BZ1L 5IG7A 1MFEL 2CGRL 4PRBA 3QUYC 3L6FA 1X5YA 3S8WA 1WAAA 1Q0YL 4FFWC 2WWMD 2VABA 1Z5LB 2OXHA 2V7HA 3CVHB 4ODBD 4FFYH 1NQBA 1U3JA 2D9CA 2VDMH 5INCA 5C9JA 2A38A 1MLCB 2D2OA 3FONA 4OZIA 1KJ2L 3U9PH 2R4SL 2Y06H 4WV1B 5EZLA 3QUKA 5E8PA 1FVEA 1NGWB 3FN3A 3HHRB 4ISVB 2IWGA 3FFCB 4TQEL 4U3XA 2LFGA 1W0WB 5DJAB 1J86A 2AGJH 3IS0X 4YHYB 1FRGH 1LK3H 1IZKA 5KVFL 3HLAB 1NDMA 2FECI 4HIHB 5CEZL 2ICEA 1NCWL 2X1WL 4JZJA 1EV2E 1LO0L 4N8VA 4QKXB 1NL0L 5IKCA 2YZ1A 3PWJB 3VXTA 3F6LA 4W70A 4PJGA 2CO6B 3HNVH 4LSRH 5DJYA 5HHOA 1WBXB 1AKJD 2ADIB 4J23A 1DQQA 5DRNA 2AJVH 5DRZB 1TCRA 1SBBA 2EC9U 4K3HA 3CSYA 4WUUA 5CEZD 5M94B 5C8JB 1NCAH 4LDLB 5ICYB 1RVFL 5IBUB 3U4AA 4G8IB 5LAXA 4I3SL 4NN5C 2WBWB 4GBXC 5CJXA 3RA7L 4LHUG 3T65B 1BZ9B 4X9FA 1KN2L 1JL8A 3HZVA 1JK8B 4AG4L 2VH5H 1YA5A 3HNTL 4GLRH 3O6LL 43C9A 1G0DA 1MY7A 4RAHA 1U91B 3TGXA 4KMTL 1KXQE 2YWZA 1AE6L 4HD9A 3BPLB 4P23D 4PP1D 1WBZB 1AO7E 1UXSA 1EUUA 4TULH 1NMBH 1WJ3A 4FG6C 3GBMH 3RX5A 5DJ8B 4DVRL 4MXWL 5FO9A 3GSOA 1LDPH 4Y1AB 4EIGB 2V7NB 3ZE0E 4JHBA 4H8WC 2YR3A 4S2SB 3BGAA 2KZ1B 2XXMB 3BWAA 4YIQA 5BOPA 2E27L 3MV9A 3O11A 4OJFH 5ACMA 1I8IB 1VACB 3QUMB 3NN8B 3U0PB 1T83A 4ZPTA 1NFIA 4GMTL 3BESR 1XH3B 4NQSB 4Y4KD 4EI5C 1TZHB 4UBDC 3FQTA 4N5UA 1EFXD 5F3HB 2ESVD 1G7JB 4GRWH 3KPRD 2NTFB 4QTIL 5L2KB 4JFFA 4DZBA 3LN9A 4I4WB 2J8UE 1BOYA 3IFLH 4FFVD 4NYLA 1BF2A 2HJLA 4WWID 3RZCD 4X4YA 2LU4A 4BH8A 12E8H 4Z7VB 1ZT1B 3KPNA 4UOW1 5F9OL 2DLTA 4DKFH 2PYFB 5DLML 4UQ2B 5CLTA 1JPTL 1MAJA 4HGWB 3T0DA 4LSPL 1ADQH 5EBLA 4WIQA 1BWWA 1Q72L 2FX7H 3C2AH 3CFBA 3C09B 4XNMB 5TQ0H 1CBVH 1EHNA 5GGRB 2X4QB 4F37F 4P57A 3GHBH 1U8IB 5HD8D 4L8SB 4QT5B 3MRMA 1NBYB 3F7YB 3FFDA 3RVTC 3B2VL 4Y5YB 4YDKL 4QO1A 1KIRA 3LKOA 3MRHB 4JCLA 1EXUA 3S5LA 3VRIB 1IEBA 1ZLSH 5EBWB 4O2FB 3FT4A 1MCWW 1W8NA 5C0BA 4WFFD 5L8KB 2YPLE 4CADA 4NQDE 2G2RB 1BAFH 3OB0H 2DQJL 3DX9B 3LZFH 2NY4B 2X4UB 4XP5L 1D5ZA 4GQPH 4RGNE 4P9HC 5JA9A 3B2UD 3HZYB 4MZ2A 4O9HH 1SJVA 1N6QH 5GGUA 3QQ3A 4GUPB 3E6FB 1U95A 3QG6B 1YMMD 1JYWA 5I6XB 5ADPL 2OJZH 3RWIB 5J9PA 4LSTH 4PY7A 2W1NA 3TZVB 3MJ9A 4WFEE 1QTYT 3UYPA 2PTUA 2X09A 3RI5F 3OL2A 2MPAH 4ZYKA 1CD9B 4DKDC 4G8EB 1NFDF 4WDIB 4Y4FD 3ZKXB 2BK8A 5CP7A 3KLAB 4N0UB 1TVBA 3X12A 2FJFA 2X4SA 3G6DL 5MEND 5IMKB 4BZYA 4XBEL 4RGMC 3SJVB 4P2OC 3BP7B 5BV7C 1KPUB 4RRPA 2BC4A 2ZCHL 5J6HA 4EUPG 3BVNB 3RGVA 1UXWB 1P5UA 4HUMB 1MUJA 4NUJB 1OARL 1D7FA 2XXCB 3C08L 1YEJL 1S9VB 1NMCB 3ECBA 3FT3B 4LRIA 1KIUA 3PV6A 4M1CD 3OKYA 3MLYH 1WITA 3LV3A 3SGEI 4ODSH 4GXUM 1OGAB 3AY4A 3MV7A 3ZSTA 4J6RH 5JOEA 1BZQK 2YRPA 3AM8C 3VRLF 2JKXA 1D9KA 2EXYC 4KHXH 1WFNA 3WIIH 4PR5A 5CBEB 4WWKA 3RVUD 1R3LA 3NA9L 2HT2C 3PQYE 4JY6B 3DTXB 1QLEL 3FRUA 2JCCA 1MFDH 1Q94A 2P5WB 3KPSB 2YUZA 4X4ME 2GY7B 2FLBT 4KZDL 1GHFL 4ZTPL 1P7QB 5F88B 3UBXA 1NGZB 1M1SA 2IGFL 3EFDH 2WBKA 5FA3A 4TNWK 3BW9A 1A7OH 5C07B 1RQ5A 2WMPA 2IBBA 2VXTH 3C8HA 4U33A 5DSCA 2CDFB 2CDGA 3J7HA 2VMFA 5IT2L 5D4QA 2A6JB 2D7QA 1P1ZA 4G3YH 4AL8L 3TWCL 4U1JA 2P24B 1FGVL 2XNAA 3QYCA 2FZ3A 1RZIB 4KQ3L 3QCUL 2Q6WB 3N1GC 5DHXB 3QUYB 3SDXB 3P73A 3OAUH 4HWNA 2HRPH 1QZ1A 1A6UL 4J12A 3QHFH 5TPWL 5BS0D 3BZDA 1OQOA 1K3ZA 4AMKH 4JEGB 3L7EB 5SWZA 1B9ZA 2V5MA 2EIBA 2YPVL 3A6BL 3P0YL 4Z0BL 4WI9A 3QUZD 4PYHA 2GCYA 4M6OH 2AK4B 3U1SL 3V2AR 5GRUL 4KROD 3A6CL 4HKJB 2DI8A 2GSIB 2UYLB 4NDMA 3OKOA 1HSBB 4WEUD 1OAUH 1XIWC 5IK3A 1LDSA 3GRWL 1FJ1A 3RWCA 1A9EB 2EYTB 2OMNA 4XAWL 1CXEA 3HI5H 4NO0B 5F9AC 2DWDB 3O4OC 1JPST 1NLDH 1T89A 4K8RC 3IJYB 4X0KB 5HHVH 1BIIB 4TSCH 4CMMB 4KDWA 7CGTA 5HYSG 1JWUA 4EUPH 3BO8A 3CH1A 4HUUB 3C6LA 1AI1H 4UU9B 1J1PH 5IFJB 1NUDA 4XP4H 5EG6C 2I9LA 3KR3H 3RVXD 4ODWB 3SN6N 1T0MA 1YECL 3HAEA 3VRJB 4OLVH 5DDHA 1VGKB 4MCYB 4O02L 2DQTH 3SE3A 3VXRB 4IMLA 4NFDA 4NN5B 1FL6B 4GBXB 4FQIH 4TN9A 4UUJB 2NY1C 1AXTH 4NJ9L 5JW3H 3VXNB 2AJZA 4XXDB 3BKYH 3MRDA 2DQFB 3TPKA 5DC0A 3WXVL 1NCDL 2EIDA 5F9WB 1V7NH 4OCYL 3PWUA 5HXMA 3MREB 5TDPB 4LKXB 5E00B 3CMOL 1RUMH 1YQVH 4K71C 5EIVA 4UI2A 4XTRD 3QB7C 3IU3A 1HHHB 5DQDL 3WFZA 1KTLA 3L5WB 5TH2A 4LLDB 2BNRB 2EDEA 1EBPA 1SEQH 2MSPA 4TUJB 3BDYL 3QEQD 4MSWB 5JPMA 3GKWL 1D3CA 2W59A 2V2WB 5D93C 1MJ8H 3G6AB 1MWAL 3BUTA 4P5TA 2VIRB 1JVKA 3O6ML 1NC2B 1FGNL 4EI5B 3D5OF 1JTOA 4WGWB 4OLYL 3TYFA 4FXGB 2E9IA 3BISA 3RL1B 5FM5M 3WS6C 2DI9A 1OLLA 5CWSB 2HMIC 3TJHA 2AI0H 1G7HB 2CIKA 1NBQA 4JFPB 4MJID 2DLFL 4WFGD 2CKBL 1JWMB 3WO3B 3GFUA 1B2WL 5DC9B 3FZUC 1FLRH 4U1KB 2N7AA 1ETZB 4PJDF 3PDOB 3A0OA 3S6CA 1UM6H 2BSSA 3HZMA 5EUKB 2AV7B 1NC4B 2DD8L 3ARPA 3TCXA 1X5ZA 2BOBA 2HJFA 2F19L 3B6SB 1T1WA 4KTDH 5H35A 1K5NB 5HGAA 5FECA 4OZHB 2FBJL 3QFJE 4LPVA 5IB2A 3BZFA 3U9UA 3B9KD 1GIGL 1MCQA 3L5IA 4LPUA 4RFOH 4PJFE 3AU1A 2CRYA 4Q9RL 4UDTB 3ARUA 5GRWA 2F58H 2BVPA 4WNQA 4QRTA 2VDOL 3KS0J 1MIML 5EU5B 1DQJA 3CUPA 3MOQA 5JXED 4Y4HC 2HJKA 5I1CH 1BJ8A 2DLIA 1KTDB 3JVGA 4R4ND 4YX2L 4MLSA 3SKUD 5D1ZC 5EC1A 4Y2DA 1ZVYA 3Q3GB 5DQ9A 2ICWI 5LCVL 5TQ2H 4MXQC 1C08A 1Y6MR 3NBNA 1XR9A 3JSSA 2B1AH 4OV5B 1P4IL 4G9FA 4L5FH 5DURB 5J1TC 1ZGLA 4WTZG 1CLZH 3IETB 4PTUA 1J0KA 3DIFB 4N0FA 1IAIH 3SBWA 1EHAA 2HH0L 3C8KB 2DQCH 3GI8H 2R0ZL 3BHBB 2BXYA 1DDHB 4HIHA 1H5BA 1P7HL 4RGMB 5GGTH 3V6OA 3QRGL 3G5YB 3UC0L 4XP9L 3E0GA 4P2OB 5HYQB 5BV7B 1QSFB 3E2HC 1DBKH 5T1LA 4KDTA 4LRIC 4WCYL 1A6PA 3EYFB 4YQXL 1Q1JL 1T21B 2BVYA 5HY9B 3RDTC 1MHHA 4TOYL 5DD0L 3O41B 2AVGA 3VA6A 3MUGB 4L3ED 4ZUVB 4PJ7E 3MGOB 5J13C 5F9DC 2Q8AH 4ELKB 2GK0A 2W65A 1UYWH 2F53A 3KWWB 2XN9D 3V6FA 3IDIB 2GKIA 3OB8A 4DN3L 1ZVHA 2XQBH 1FNHA 4ONGH 4OFDA 3ARDA 3HE6D 2VDLH 4LLUA 3S3PA 2MCPL 1KT2B 2KZWA 3T1WA 3EHBD 4Y19E 2G60H 5AYUH 1A6ZB 4OQTL 4FMKA 5ICXA 1OP3H 5DEFA 1I3VA 5DMGC 1FE8L 3B5HA 5IEHB 4HC1A 3R8BB 1XZ0B 1KCSH 3U7AA 1UWGH 2OSLB 3OKMB 4ZD3L 3HCVB 2FRGP 1TENA 5HGBB 4EQ3A 3CFDA 2R1WB 1IGYA 1YPZB 2P44B 3QO1A 1OLZA 2ZSVA 5EBMB 2B1HL 3VI4F 1S9XB 4HW6A 3P4OA 3RAJL 2L7JA 3AS1A 2MMXA 5HHPA 2VXSH 5L9DH 4XVTL 2BX5A 2NY6D 4M48H 2NX5A 5E6IC 3UTQB 4QWWD 5EH1A 1J18A 2YK1H 4B5EA 5IOPB 3T8XA 3HE7C 4OFKA 3SCMA 1HOCA 2VXVH 4OCSL 2YXMA 3DWTA 4XMKH 3DRTB 5E2UL 2BSTB 1JFMA 3ALWA 2Q3AA 4RNRB 4I8DA 4BZ1H 3GIZL 2ICWA 4JG1L 1MFEH 4HFWB 1E4WL 4MJ5B 4EVNA 2OK0L 4F7EA 1J87A 3LN5B 3WHE0 1Q0YH 4B7LA 5ACLA 5F97E 1A6TA 1XIWB 3BUYA 4LGRB 1FFPA 3HC0A 2GAZA 2R4SH 3BZEB 3O4OB 4P9ML 1NBYA 3EOBA 4TQEH 4MNQD 4Y5XC 3IKCB 1S78C 4NPYA 4MNGA 1HILB 2RJMA 2GYSA 4JKWA 3VH8G 1CGWA 5F7LB 4MX7A 2Y4SA 1K2DA 5KVFH 4Y16C 2K7PA 3QWQB 4GW5A 2X4TB 5C09D 5CEZH 1NCWH 1X44A 1PQZB 3WHXA 3E3QA 5BXFB 1LO0H 4XBPA 1NL0H 4L4TA 1A4JB 1L6ZA 2HFFB 4R2GC 1BVKA 4YPGA 2VUOA 4PJHE 1E28A 4NKOB 3NAAH 4IHOA 32C2B 4GUPA 5D7IE 3VMPA 3VXOA 4MDIA 1OCWH 4MJ4A 1E4JA 2H6PA 5DD6B 5B39A 4NGHH 1GGIL 4QRRB 1J1OL 4OSUL 3RJQB 5CEZE 4WUKH 1U3HD 1ZANL 3W0WE 4PJCF 1HI6A 4K71B 2EDYA 4WDIA 1N5AB 3RA7H 2VZOA 4N0UA 2KBGA 4PJ9C 4MVBA 1KN2H 5SV3A 3UTZA 4AG4H 3HNTH 4Z7WA 1BMGA 3AAZB 4PJXB 1HQ4B 3ES6A 4KMTH 4NRYA 1SMAA 1AE6H 5KN5B 2A73A 5GRYA 1UADC 5D93B 3LB6C 3SO3C 1VCAA 5JQ6L 2BVQA 3OKKB 1WZLA 4PRNA 4PD4K 5DUPL 2H9GA 4DVRH 4RA3A 4MXWH 2Z92A 1OW0C 4YXKL 1NUFA 3CX5J 1M6OB 4IRJD 4HWUA 2GT9B 2E27H 5L2JB 2KKQA 3AREA 3G08A 1C5BL 3NFPB 4JO1H 5ILTL 3SOBL 4IOIB 4QRSB 4EN3D 1L4IA 3MJ8A 4GMTH 4M6NL 2VO5A 4LSUL 3MO1A 1T4KB 1BHGA 2VISB 4QTIH 4YGVA 4GW1A 2PETA 5I1AA 5KZCB 1DVFA 2ESVE 3SGDH 3KPRE 5JPNB 1V3MA 5IB3A 5HHMD 5IFHL 5EC2A 3C87A 1N5YL 3AVEA 4OBRA 3T0BA 5KVDL 1I8KA 4Q7DA 5F9OH 3KPSA 5DLMH 1KCKA 2WLYA 1BD2A 3GIVB 1JPTH 1LD9A 2NW2A 1FAIL 4ELMA 1BFTA 4J2XA 1P7QA 2F8XC 4LSPH 5L6YL 2BXZA 1RUQL 4P0DA 1R3JB 3H9SD 1QFWI 3MROB 1H3PL 3PWPB 4PJIA 3DI3B 3QO0A 3VFSB 5ID1B 1F90L 1UVQB 4R4BB 5DEGB 1Y0LA 4U1MB 3QDMD 3GSXA 2V5YA 5DFTA 3RHWK 4Y4HB 4U6XB 3CZFA 4S1RL 3UTOA 1AQDB 1NGXB 1RZKH 3RKDD 3B2VH 3RNQA 3TO4D 4DOHE 1G6RA 5DD5L 5D1ZB 4DFIA 1ORQB 3WFEL 2FWOB 1YUHB 3OJMB 3ZE1E 1TMCB 2DQJH 2ATKB 4JRXD 1E4KC 4WFFE 5A3ID 4GG8B 4QRPB 4XP5H 3EYUH 4X99B 4NQCB 2R2EA 3BP6B 3MLSL 2VLLB 5ETUA 3GB7B 3EOTL 3F8UB 1P2CB 3X13B 2XTJC 1ZA6A 2JLLA 4UT7L 1LP9F 1U3YA 4FQCL 2BY0A 3U79A 4X9BA 1I7TA 3H7BA 5D5MB 4ZODA 5KSUA 2Z0BA 5IVZB 3OF6A 4FQXC 4PG9B 4IOSD 1OTUC 1H15A 1B6UA 4GAYA 3ZDXF 3E2HB 1D5XA 3A6OA 4MA3B 2BY2A 4V1DA 3VXUA 3DARA 5DO2D 3DX6B 3VGDA 3NCFB 5E8OA 3RDTB 1T7WA 2YEZB 4XBEH 4ZQKA 2YN5A 3JWOL 1K4CB 3EJJX 5MENE 5J13B 4FZ8L 5KS9F 1DANU 2ZCHH 4M3KB 4FZEL 3N1FC 3UDWA 1GZQB 4PJEE 1OARH 2EDKA 3C08H 4UNTA 1J9CT 1YEJH 3MV11 1QHOA 1CE6B 4C56D 2Y36L 2AV1A 3DXAA 3T1FA 4PRDA 5HBBA 15C8L 2GTWA 4MS8A 2DQFA 5IWLC 3TCLB 1QLRA 5C0AE 4MB4A 3BXNA 25C8H 2G9HA 5CFHA 1OAKL 1N64L 3S37H 3TO2B 4ZMAT 3IAGC 4JHAH 4PLKD 2GFBB 4JDVB 4NZDA 4JPWL 4TYUA 1KPVB 2VAJA 3QR2A 4LU5L 4OM1L 2Q3ZA 3NA9H 5F6HI 3Q5OA 5IVNA 1QLEH 1WT5A 2Q1EA 3D2UA 3EDEA 1WCBA 2DTSA 2GJ6E 3FB7A 4ORGB 4KZDH 3CSGA 1GHFH 5E6IB 3UROR 4AYFA 4ZTPH 3HUJA 4G8GD 2IGFH 4YHIB 3P9WB 2X5PA 3HE7B 5DS8B 4YHLH 4UDUA 2B20A 1NLBL 3BH8A 4YK4C 2XPGB 1FO0H 4MD4B 2ZUWA 4EOWL 4JFQA 1PAMA 4MQ7A 4M1DL 1M71A 4N1CA 1B6DA 4U1KA 3FN9A 3TWCH 1ED3B 1FGVH 4CJ0A 4KGJA 4KQ3H 3QCUH 5KAQF 4IRZH 1FZMA 3TBTA 3BEWA 2XRAL 3ZYOA 4YDJA 1WWCA 4HX1B 5TPWH 1A6UH 3L5JA 1I3RA 1R3HA 3CFEB 2NY0C 1U8LA 5BS0E 4ONHA 5KSBA 3A6BH 4Z0BH 2I25N 4GG6B 3U0TA 4DWHA 3U1SH 5GS1A 3DV6B 5GRUH 3A6CH 4Y5XB 1GC1C 1KENH 2DMCA 3KPPB 4HK0B 3O9WA 3MRPB 3HPJA 3O8XC 3GRWH 3ILPA 3OZ9L 5CEYB 1KPRB 4Y16B 3SKNB 4XAWH 1WF5A 1IAII 1ZHLA 3RBGA 1JYXA 4S0SD 1EVTC 2AJXL 1JPSH 4XNXL 3IXTA 4E0RA 3QIBA 5BW7C 1KXVC 4R2GB 4V2BA 1QD0A 3O45B 3GO1L 3BAEL 5IVXB 3S96B 2DQHL 1MVUB 1YEKL 5E94A 4C83B 3BP4B 4R90L 1YMHB 3FFCD 4PG2C 4FOMA 2NMSA 1A14L 4HH9B 3MNWA 3ZDXE 1YECH 5JHLL 1TQBC 1A6AA 4M02A 2EZ0C 4O02H 4K9EH 1U0QA 3V4UH 1CFNA 3RVVD 3AMLA 5MEQB 4PJ9B 4OKVB 1A6WH 1T5XB 1N59B 2EXWD 2DKSA 4NJ9H 4YFLF 3KPOB 4BFIB 1P5VA 4AEFA 1DDHA 2Z31C 3HB3C 1CFVL 1NCDH 4WO4C 4P46A 5EOTA 1HHJB 5DHVA 4PP8C 3CMOH 4X4XA 5DQDH 5D7JD 4X6FB 1WGOA 3V0AC 5C0FA 4DGVL 1U8PB 2XFXA 4F9LA 1JF5A 4GKNB 4GQ9L 3O41A 5EOCJ 1K8IB 4A2LA 3ZSSA 1LE5A 3IDMB 1INEL 3LQZB 4JFYA 1JNJA 4LLQA 1U93B 1MWAH 4HIEB 5JOPD 5IIEB 4PJBE 3BN9D 3O6MH 3PGDA 1FGNH 5I19L 4BH7B 4OLYH 3D18B 2FATL 2V2TA 4HWZA 3QUML 1MAML 2H8PB 3QAZC 3DVIA 4LNRB 4OZGA 1QRKA 1RSFA 5F7KC 5F1IA 3WNOA 4J1UA 2CKBH 5GGRY 4B0MM 1MHEA 4Y1AD 1L7IH 4MJIE 1UH2A 5ISZA 4WFGE 2MTPA 1TVHB 2E7MA 4R7DB 3GUTA 1JBJA 4L8BB 3ESUF 4P4KC 3ZE2F 2R1WA 1S7QA 3MRCA 5EIIB 1X7QA 1HWGB 1S9XA 2DD8H 3G5XA 2E7LE 3GMNB 4HHAB 2F19H 3MOBL 2D7NA 3LQAH 1T0NA 4HUWB 4Y89A 2R2HB 5L2KD 2JB6B 1I3GL 1U8NB 2ZSWA 3HC3L 1NAMB 3RRQA 1GIGH 3VXSD 4KJPC 1G9ML 4I3RL 5I76B 3D48R 5EB9A 3RL2A 4QNPE 5IBLD 1AXIB 1CYGA 4Q74A 4Q9RH 1VEOA 4OI7A 3K80A 5J1SC 3ZL4L 2YD7A 2W9LA 2OL3A 3X11B 4XCFL 3TBWB 1MIMH 2QQNL 1VADB 4ZO9A 3PDDA 4F57L 3CX5K 1OHQA 4YX2H 4Z7UF 1S9WB 2XTJB 3LN5A 3GSUB 4PP2B 4ODXA 1BQUA 1CICD 2BSRB 5LCVH 4YR6B 1QO3B 1QVOA 1M05A 4WRLA 1I1YA 2Z8VC 4NSKA 4YH6A 1T7YA 4A6YB 1ZLUH 4HKXA 1OTTD 3B8YA 1IEAA 4KUZL 4I0CC 3VG0L 1E0OB 1H3GA 4FQXB 1HHKA 4KXZI 3S4SG 8CGTA 1ORSA 3UZEA 1AGFA 4YAQB 1EA9C 2HH0H 2NY4D 3DVNB 2E5EA 3MOAL 1DN0A 1CFQA 3GSRA 2XWJA 3RIFF 1RUAH 4AZ8A 1IL1B 2DJ4A 3QRGH 3UC0H 4XP9H 4QY8A 3UXFA 3MUZ1 4HZAA 2EEDA 4EDXB 4IDLA 2YZ8A 1A9BB 4WCYH 4LSVL 4HIXL 1U3ZA 2PYEB 1Q1JH 3QRFM 1I7ZA 4TOYH 3KPMB 5DD0H 4OT1L 3IDJB 2EIEA 2Q7YA 2W0FB 4O5LL 3VXMA 4L3EE 4Z5RA 1DQLH 4I0PA 1QLFA 5TGBA 1R24B 3O6FC 2IG2H 3SE9H 1N8ZB 1OSZB 1ONQA 2XN9E 4WI8A 1RHHB 1IMHC 1MIEL 1OAZL 5GQBA 4Z95L 1IT9L 4R8WL 1LO3L 2VZSA 2KL6A 3K8LA 3KYOA 3SDCA 1H0DA 4YHZL 4HXBL 3QXAB 3ARZA 5DGRA 1AGDA 1CL7H 2VR5A 5IW6A 4PBWD 1FE8H 1J0JA 2CIIA 3FO1A 1VKXB 5HHNB 1S9YA 3W2DL 1WSST 3U83A 3PHQB 1S7XB 3TA3C 1TITA 2HA1A 4RMWA 2FJGA 3MV8A 2B1HH 3PHOB 5C3TA 5D1QD 3RAJH 1FVCB 1OGAD 3W11C 1FIGL 2VLKA 3VFWB 4QF1B 3S34L 5E4IA 3L3DA 1HHIA 4YK4B 1QQDB 3BIKB 4YNYB 3OR7B 3U82B 1D5BA 3MMEB 4PLJD 4XVTH 1Z2KA 2XZCL 1YEHL 5IQ7L 2KDGA 4M62L 2F8OA 2A83B 4U1GC 3I6LD 3U4EB 1E27B 1FG9C 5FF6B 3WDHA 1UZ8A 3L3JB 1WC7B 3TP4A 5GRJL 3QDGA 3Q6FA 2C3HA 5CS7A 4MA8L 3WJJA 5E2UH 5CGYD 3GHEL 1JI2A 5K9KA 1AO7B 5B3JE 2WUBL 5CIPA 1UG9A 2Q76B 3GIZH 4JG1H 1E4WH 4HULB 1HIML 2CQVA 2OK0H 2JJTC 4MHHG 5JIPA 2P8PA 2EDQA 4FN0A 1TPXC 3RJDA 3O8XB 3QUYD 1ERNA 3IU4L 1L6XA 4YWGL 1RJLA 1IGCL 6FABH 5E99L 4KJYA 4X6DF 3P0VL 4MA7L 1N3NB 5IUSA 3OQ3B 2E6PA 3C5ZC 5FKAB 2IPKB 2YS4A 3IJHA 4MNQE 4PGZA 1JE6A 2J8UB 3O6KL 2ZCKL 4FABL 1IM3A 3D25B 2HT3D 5HI5D 1GGTA 5DTFB 4MNHB 3X14A 1EHLL 4F37K 5C09E 3UP1A 4QYOB 5GSVB 4IRSC 1U8JB 1TQBB 3IJSA 2QBWA 3D9AL 1U9KA 1F4HA 3TM6A 2ARJA 4GRWB 4NO0D 1GAFL 3E8UL 4QHMB 5GRVK 1RZJH 5AUMB 4CU7A 2NLJB 2R1XB 3RX7A 3WUWA 2Z31B 1GGIH 1J1OH 2V17H 4OSUH 3AS2A 4WO4B 2VXQL 4X5XA 1BOGB 4P5KB 3FRPG 5D8JL 5TDNB 3R8QA 3L95A 1I4FB 1FZJB 2CLRA 5J12C 4CN6A 1S5HA 2IC2A 1JHLL 2Y23A 1SYVB 2YPLB 4D0CA 4NQDB 1OD9A 4K3JL 3VXRD 1HK6A 2BOCA 1NEZA 1BQHG 3X3FL 4AENB 5JQ6H 4RGNB 3OMZA 1MCDA 1FYTD 4YO0B 4OGAC 5DUPH 4G59A 1F2XK 2A74B 5J7CC 4ZPVA 4YXKH 3QEGL 5F44A 2HTLD 2XG5A 2PO6D 3QAZB 4NQEB 4YEEA 4Y5VC 5B38G 4L3CB 4FG6D 1C5BH 3SOBH 2EYSA 2BNRD 3WE6A 4D8PA 5IW3A 1XGQB 2P47B 4M6NH 1ZSDB 2R0WL 4LSUH 5CGMA 4BSJA 2JK5B 3VFPA 2XKNB 4P4KB 2DM3A 3C60C 2CLVB 1R5IB 1I75A 4LHUB 4TPRL 1NC2D 3V4VL 4EI5D 3Q2CA 5D9SB 5IFHH 3C5SA 3WFHB 1N5YH 2A6DA 3TEUA 3DUHA 1KN4L 5HHME 3STZB 3F65A 2K7QA 3AROA 4FQ2L 1PG7W 4KI5D 4BKLB 1FL3A 5E6ZA 4E42B 5CCKL 43CAA 1FAIH 2D31A 3FO2A 5JDSA 4M93B 4Z78A 1QYGL 1RUQH 3ARFB 1WIPA 5F1NA 1H3PH 5DVMA 3CU7A 2ITCA 1WZKA 1MFAL 2QKIB 3OX8A 1EGJL 1F90H 3H9SE 2WY3A 2HYMA 5EO1A 4MMXC 4APQC 1KJ3L 3QUXC 5DFWH 1X5XA 2DYPB 1QEWA 2DLGA 2HT4D 3QDME 4LCWA 4FXKB 5IHZB 5IHUH 5FGBC 4LF3A 3WFEH 2AQ1A 3P4NA 4M7KL 3LRGA 3CFEA 3OGCB 2AKRA 4LMQE 3KPQB 4TUKL 4DK3A 3RVTD 1DSFL 1RK1A 4U3HA 2R4RH 3PIQA 4WHYG 3MLSH 3OPZL 4JRXE 3EOTH 3HG1B 2ADJB 5ECJE 3CDYA 3BDXA 4U6YA 4UT7H 3L7FB 5SX4H 3SQOL 5I8EA 3HNSH 3RWGA 5ESQB 3N06B 1PGRB 3LSOB 3CNKA 4DZ8B 1HXYB 3QBTB 2V2XB 3QISA 1AHWA 1DL7L 4WW2A 1RD6A 1KULA 3F62A 1KLUB 5C2UB 4AK1A 4OLZL 2BVTA 4Z0XB 5FYLL 4OGZA 1T20A 2VXUL 1Z9MA 5DURD 3ILQC 3RPKA 5EUOE 1K8DA 2FH6A 4NNXB 5FOBA 3S96A 5FOJA 4KZEL 3MRLB 3O2DA 3JWOH 3VD5A 4JCMA 4FZ8H 1CD1A 2Q87A 1D6VL 1V8HA 3PG2A 4FZEH 5FYLD 5FKPB 2VSCA 3O6FB 2AQ2A 4PJ8A 1U2CA 3DO7B 1N59A 1PY9A 4GXVL 3H9HB 3PWLB 2C3GA 1QSFD 2Y36H 3W9EB 1FH5L 2NY7H 2QQLL 5EOCH 5I17B 15C8H 4R3SB 3UTSA 4C56E 4DGIL 3JXAA 3LKPB 4XRCA 1ES0A 1U36A 3LPWA 4QRQA 3QEHA 1OAKH 2YBRA 1N64H 3EO1B 5CGTA 1RHFA 1ZHBB 2EYRB 1F4WL 4JPWH 5IMLB 3WMSA 3TA3B 2OZ4A 3QEUB 3OKDB 5DMKA 3BRDA 2IBGA 3V5DA 4LU5H 4OM1H 4ENED 4KKAD 1PSKL 5C71A 2R9HC 2CLZA 2FEEL 4O00A 2IAMA 5KVGL 3D85A 4EUPB 4PRPB 4U1GB 3GGWB 4U1SA 5F7WC 2XA8L 1A7NL 1ZE3C 3LS4L 2IMNA 2X1OA 3KXFA 1NLBH 4L1HA 4PJAB 1J0HA 5T1KB 3MYZA 4TRPL 4H5SA 3IVKA 3I75A 2ITDA 1T7ZA 2DMKA 4M1DH 5DK3A 4WHYH 2MKLC 5C0JB 3MA9L 3WHE1 2LAGB 1RZ7L 4K7FA 2XRAH 2IQAA 3RWJA 2DQIL 3CFKB 1YN6B 4HHAA 3T0EA 1A7PL 2J1KA 3U48A 2BDNH 2O26U 3IXAA 4NRZB 1JN6B 4Z7VF 1TPXB 4IEFB 4ZSOB 1MJ7L 1C7TA 5IMOB 1G7MB 1TDQA 5DZOA 3BKML 1OP3K 1DCLA 5BZDA 3IAQA 4BFEA 2YA0A 2F5BL 1IQDB 4RCAA 5D2NE 3GBNL 5EZJA 2P45B 4G7YL 3C5ZB 1JJUA 3MR9A 3QXVA 3OZ9H 4QXWA 4K8RL 2DQUH 4I1NB 3T77B 1A7QL 2EC9T 2AJXH 5BJTB 2R2BA 4XNXH 1XIWD 5I18L 4KVNL 1KB9J 4RDQF 3DVFA 2ADGB 3GO1H 3BAEH 4X83A 5IB5B 4JDZA 3ZKMC 4KFZC 2UWEE 2DQHH 4K8RD 4JLRB 4FFVC 2NY5C 3ARYA 3KDMB 4X5WA 3RZCC 1CDGA 1A14H 3QFJB 3IDXH 2UUDK 4WI5A 3VXPB 3FFCE 2AABL 5JHLH 2OJEB 1IGTB 2IQ9H 2YD3A 2E8ZA 5C0ND 3F5WB 5BVPL 4OCWH 4HIIB 4PJFB 3P9MB 2GTZA 5J12B 3O4LA 3WLWD 4P2RE 3NIFE 4WFHD 3BFOA 4X98B 4H25B 4ESKA 3BYYA 4ERSL 4ODUB 1CFVH 1F6AB 2B0SL 3B3IB 4F58L 2ZNXA 5HGDA 1G84A 1PEWA 2H1PL 1AGEB 1WWBX 2NY1D 3V8OA 2NW3A 1PW3A 1XGRA 1CL7I 4DGVH 2UVFA 5EZIL 5JXAL 3L3HB 2VE6B 4KKBD 5HYSB 2EKJA 4GQ9H 3ROOB 4Y5VB 4LVOC 5EWIL 2AXHA 4N9GA 3MV9D 4RISL 1IM9B 1JV5A 1D5IL 1X5GA 1RZKC 5I19H 5IQ9A 4OZ4A 5JOPE 1QRNE 4L4VA 2FATH 4JFXA 1MAMH 3TIDA 4XH2A 3C60B 1F11A 4R6UA 4MB3A 2IALB 1NSNL 2JJSC 2CUHA 5M7QA 3DX8B 1PZ5B 4ODVL 1B88A 5E9DE 2B5IB 2FHFA 4M9PA 4U1HA 3VD3A 5J6GB 4Y1AE 2HMID 5DJ2B 4EZMA 4UT6L 3S97C 4Y4FC 3TF7A 3L9RA 4HK3J 5AWNL 3S98A 4PJ7B 3MOBH 1M4KA 3UPCA 1O0VA 5C0RL 2FECL 1KSRA 5SWSB 1I3GH 1B0GA 1XGUB 3HC3H 4APQB 3FOMA 3NIDF 3QUXB 4I3RH 5HYJA 1OB1B 1V3JA 5L2KE 5HGHB 3VJ6A 3U6RB 4P2YA 3GSWA 3K4ZA 4RFEA 3VXSE 1E27A 3JV0A 5J11C 3BH9B 3KJ4C 1VFBB 4Y19B 1MI5A 1N2RB 1SMOA 4JQVA 1JFQL 5JDJA 2W9EL 3MRNA 4XCFH 4O2CB 1G7PB 4M1CC 5INDB 1JWSA 4PRIE 4QEGA 5C0BD 1A02N 1XEDA 3ZKNC 3F7VB 3NZHL 3DBXA 3VFTB 1AR1D 3PWPD 3VMNA 3UTTA 3SDXF 1OGTB 4NKMB 2IPUK 3MJ9L 2C1OB 3PGFL 2PCPB 4M7ZC 4Y4HD 3BGMA 4LASL 5EO0B 4LKCB 5DRXB 4PV9A 2F74A 4KUZH 3RVUC 3VG0H 4DUWA 1BVLA 3WJLA 3G9VA 4MXQD 3I50L 1ZHKB 1ZS8A 2Z4QA 3FQXA 5DJZB 5FEBA 1FFNB 3PWVB 5T5NG 4QRPD 5GISL 1BJ1J 2VN7A 3MOAH 3MTRA 3LCYA 4LLWA 3GMRB 4R0LC 2FGWL 1CDBA 1T1YA 4LCCA 3QCVL 5GIRB 2YD6A 3IFOB 4U6HB 1DUYA 2G5BA 3DGCR 1SJEB 2P48B 1T0PB 1URLA 1F4XL 4HKZB 2P42B 2FO4A 4FQPA 3B4NA 4LSVH 3RGVD 1XCQB 3MYJB 2JIXA 5DK2B 3SDDC 1B3JA 4HWBA 4I48B 3MFFA 3VCLA 4OT1H 5C7XL 4MLIA 5FO8A 2UY6A 3BJLA 1INQA 4O5LH 2VDQL 2YD1A 2EC8A 1JHKL 3SKMA 4RZCA 3HMXA 4CVXB 2FO1A 1J12A 1MIEH 1OAZH 3D3VA 4Z95H 3V6ZB 1IT9H 4R8WH 1TZIA 1J8KA 1LO3H 4ZUUA 2XY2A 4YHZH 1BF8A 1TVDA 4HXBH 1WWWX 5FO7B 1D9KD 4LQFH 1UM5L 3D69A 1MAKA 4WWKD 4UV4L 4OI8A 3FAWA 2EIZA 1MF2L 5KG9A 3W2DH 3MLTB 3AXLA 4PJHB 3QZWG 2AXFB 3U0WL 4QRUB 5DMGD 5D7IB 3OJDA 2I5YL 1FIGH 3CC5A 3S34H 1SY6A 1A1MB 4NO3A 4F80A 1OGAE 3NCYS 5EO9B 2QTEA 4LGPB 1BZ7B 2APVA 2XZCH 3FOLB 3W0WB 2YRLA 3VFMB 5IQ7H 5AYQA 1CQYA 5CZVL 4UB0L 4P5MB 1VFAB 1BFOA 3T4YA 4FS0A 5KSAA 4PREB 3I6LE 4F7TB 2LU7A 4IIQA 5D1XA 2GSGB 3NCJL 4MA8H 5MERA 1OM3L 1H8OA 3GHEH 3LIZL 4Z7QF 1B90A 2WUBH 3G5ZB 5ALCL 3HE7D 5J3HC 4K9EC 1EJOL 1HIMH 2BMKA 4KMQA 1JZ8A 3EYSL 3AS0A 1YEGL 3TPUB 3ZYZA 3ARFA 3QDJB 1CVRA 1Q9KB 4PDCE 4K3EL 3DUSA 4OZHF 5AD0A 4NIKB 1BGXL 3FO9A 2APXA 3IU4H 2VL5B 3B9VA 1IGCH 5E99H 2A9NL 5GSRA 3P0VH 1KACB 4MA7H 4HDIB 4GAJL 1XF3A 1ZT4B 4L8CA 5E5MA 1MLBA 5MHSD 1EFXB 4NRXB 2ESVB 3O6KH 3OGCA 2BJML 2ZCKH 4FABH 3PQYA 1BBDL 2D7OA 3GSNH 2ATPA 4PS4L 5I2IB 3OXSA 4I18A 5E2WH 3H7LA 1EHLH 3RZCB 3C6LD 3REWB 4G6AD 4X4MA 1KCRL 1XMWA 3IFPA 3K4DA 5KSVB 4HGMA 4WU7A 3VDAA 3D9AH 5DJ0A 4X6EB 1CG9B 3BDBA 1GAFH 3E8UH 2DJSA 3GSQB 4GH7B 1JHTB 2X4NB 4CNIA 1A3RL 2C7UA 2NNAB 4R2GD 1HEZA 3KLHD 5F72S 4XNUL 1QKZH 1C16B 2VXQH 1WUNT 5D8JH 4U7MA 3DV4A 3B9KC 2X05A 1JHLH 4OCNC 1LO5A 4JM4L 1PKQB 4K3JH 1ZT7A 2OI9A 3LQAC 1RJYA 3VH8B 4LOUD 3EO9L 4LVOB 3QIWC 5SV4A 3VXRE 2YSSB 1CFBA 3MRGA 3FB8A 4XVUD 5EPMA 3KPLA 4KJQD 4KHTL 5K59F 3Q5YA 3WEXB 1FYTE 2AJ3A 3QEGH 4KC3B 3WFBL 3D0VA 4GRLA 3BQUA 1IC4L 1MFBL 5FCSH 1OF2A 1KB9K 4Q6YA 3QWRA 1YY8B 3TJHD 1P4BL 3CFCL 1AGCA 2ED8A 4ETYA 3EO1A 5JW5A 1FN4A 2R0WH 3MRKA 1ZHBA 4JY5L 3KNBA 4R9HA 1P7KB 4KMLB 4DKAA 3CXDL 5GPRA 3B8SA 3NH7L 1FC2D 1NCBL 3EKCA 4Y4FB 5KOVC 1AQKL 3WNNA 1VA9A 2AERT 2APFA 4TPRH 4F7CA 3V4VH 3FB5A 3FCTB 1DE4A 2FL5B 3K4AA 4LCUB 5MENB 1MCKA 3QNZA 4GRMA 1KN4H 4CUCA 1WZ1L 1A1NB 1NFDA 4MDJA 4FQ2H 3BZ4B 4PJEB 4NOFA 3GNML 5CCKH 3D0LA 5JUEL 3QG7L 1YPZF 4WI3A 4DUXA 4KI5E 4LPYA 2YD2A 5DJDB 1MCLA 1KV3A 5J11B 1QYGH 2DM7A 3KJ4B 5JLZB 2WNGA 1FL5B 2CPCA 1NGYB 3IDGA 2GJJA 1MFAH 5C0AB 1EGJH 4XCCL 1C7SA 3GJFB 1KJ3H 1ZHNA 3PGCA 4QGYA 2I26N 1JRHI 4Q2ZB 4ZS7L 4BQCA 2FLRT 4M8QB 4E41E 1KFAL 5F7MC 5MEPB 4LSQL 2BRRL 1QFWM 4OLXL 2W9DL 3I6GA 4M7KH 3EHBC 4Y2DD 4M7ZB 4TUKH 1H3VA 5C6PB 1DSFH 3R1GL 4PJ5B 3DYOA 1ZWIB 2GJ6B 2ZOKA 2Z8SA 1OAQL 2VR4A 3OPZH 3SKOB 3VWKA 2V9TA 4G9FD 3OAYK 5KJRL 3VFVB 4NHUA 3OKEB 2XKSA 3SQOH 2FHCA 3HRZB 2ZUVA 1EH9A 1I8LC 5DRWA 3H3BC 1I7RB 4R0LB 1M7XA 4D0DA 2X9YA 1RMFH 2XTJD 4DQOL 5IGXL 4ZUWB 4PGEA 4PV8B 1DL7H 2VZTA 4WU5A 5GHWL 4X6CE 3RWHB 4OLZH 3RWEB 1SJXA 1FZOA 5FYLH 1P4LA 2VLRE 1I1AA 2VXUH 5H2BB 5JNYB 2WINB 4FQXD 5T1LD 3DMMA 5K9OA 1OTUD 5EFIA 3SDDB 4KZEH 4PGDB 4G43A 4JHZA 5BS0B 4G42A 1Q9LB 3L3KA 5FYJL 1FO0B 1D6VH 3BD5A 2GHWB 1CF8L 2VUYA 5C1MB 1QA9A 1DBMH 5F9JB 2F53D 3UEZA 5FYLE 5HGGS 5LBSL 2QR0B 4HC1L 5F89A 3TNMA 2QQLH 3ARDD 4FRWA 4DGIH 1QSFE 2X1XR 3SPVB 4F8TA 3DO3A 2PYED 4BFGA 3ULVH 5F7EH 3O3EB 3DOSA 1F4WH 1QFUL 1U41A 4F2MA 1G7LB 4EI6B 1UQSA 5F21B 2VE6A 4FFYL 5FXCH 4PJXF 3CDCA 5FM8A 2VRAA 4DFHA 1PYWB 1LK2B 1PSKH 2P49B 3HMWL 3MBXL 2OXGA 4XZUB 3RUGB 2EE6A 5CBAA 1MPAH 5BVJB 1FNGA 3MACL 1AGBB 5KVGH 3QI9A 5KSAC 4Y2OA 5D6CA 3C6SA 4ZAKA 5J4MA 2HVKB 4O51B 5E8DL 2NX5D 3MRJB 1EAPB 1UZ6F 3LS4H 4QTHA 3O2VL 3O3DB 4TRPH 1I1RA 2VITA 4LSRL 3P77B 1WK0A 1U3HC 1YPZE 3OKNA 4QXUL 1AP2B 5ICZB 3MA9H 4HBCL 4PGBA 2OMBA 1TQCC 2QLVB 2LAAA 1RZ7H 3TBYA 3M07A 1DEEB 1NCAL 1T7VA 1RZJC 2DQIH 1IGJA 2AXJA 1A7PH 3I02B 2N4IA 5ESAB 2H26B 4JZOB 4BUGA 1CD0A 4M00A 1MJ7H 1WAAE 2DF3A 3GMLB 3P4MA 3BKMH 4ZFOA 3VXQA 1AIFA 3T0VA 4ZTOL 1GC1L 1R6VA 2F5BH 2NY0D 4O2EA 1F8TL 1AD9A 1JPFB 1KIQB 4G7YH 3JTTB 5TE7L 5EU3B 4ZFGH 4OZIE 3S5LG 3I6KA 3AS3A 3G04B 3ROLB 1JGDB 5BCAA 2X7LA 4TULL 2DTML 1HCFX 1NMBL 1NDGA 5JHDB 2EDTA 1I8MA 4DCQB 1KJMA 4MJIB 1A7QH 1MWAB 2V9QA 4C4KO 4EN3C 1ZVSA 1SYSB 4KVNH 4JN2B 5I16B 4L4TD 5C0DA 1MCOL 5J56B 1IAIM 2XQYK 5BZWB 5HJ3A 4XCEA 2IH3B 3MLXH 1CI5A 1OPGL 2CKBB 2AABH 2CJUL 4NWTL 4PJDA 1QSZA 5BVPH 3ZTJG 2EDJA 4RX4A 1M7IA 5DJCA 1O7SA 1FFNA 1KCLA 3B9KB 2RFXA 3W39B 5C08A 4G9DA 1A21A 4I2XB 1HH9B 5E8EB 3F12A 3MGTB 5D5MF 2GUOA 4ERSH 1T03L 5I8CB 2B0SH 4WFHE 4F58H 3FTGA 3QIWB 5E1AA 2H1PH 3LKSB 1U8QB 4PIRF 5F70A 4RRPG 4AH2B 1B0RA 5CJOH 4IMKA 2FX7L 3C2AL 3ZT6A 3HB3D 5IB1A 1F58H 3ZDYF 5JXAH 5I66B 2PN5A 3EAKA 3GHBL 4POYA 5EWIH 3V0WL 1UKSA 3FN0L 3F58L 1GYAA 5A3IC 4RISH 3ARVA 4A2MA 1D5IH 5HSFA 4F9PA 1I7UA 4X7FC 1ZLSL 3MV9E 1P69B 1NBZA 2MQ3A 3DUUB 3L3GA 1AC6A 4PJXE 4XC3H 2A9ML 5FYKH 5TF1L 5ABDE 4WI4A 4GJTB 4JKLA 2HLFC 1A2YB 1NSNH 1XF5B 1DBAH 4ODVH 1DVFD 1KJ2A 3TIEB 4NQED 3V5HA 2E7BA 4UT6H 1JCKA 3EYOA 4GAFB 4F7PB 4QRUA 2F15A 5D7IA 3V6BR 3QXDA 1UZ6E 2IJ0C 2EKSB 1AKJA 5I1KL 4WFED 5AWNH 4NNYA 2DIBA 3UBXG 1QSEA 3EOAA 5EN2A 3PXJA 1G6RL 3GMOA 3MRFA 1FNEA 1UB6A 3CD4A 2IH1A 4P4KD 5C0RH 4L3EB 1DLHB 4UNUA 3H42L 1UB5A 3GMQB 3HR5B 4LHUD 5D70L 3TJEL 2XN9B 1G1YA 4LARL 3EYVB 3Q48A 4OF3A 4Q97A 1EVUA 1EZVY 5CD3A 5A2KH 3G5VB 3MGAA 4RAUB 4FHBD 1G7QA 3WIFB 1JFQH 2W9EH 2H32A 3JWOC 4KJPD 3VWKC 2XZQL 4M8VA 3BN3B 2BVOB 1JYNA 3NZHH 4WHCA 4P23A 5J57B 5E2JA 3QJFB 5C0BE 5IJKC 1HCVA 1C5CL 1P9MC 3REVA 5AEAA 4W6WB 3GZKA 1G0XA 4HJGA 4GKSA 5A2LH 1T3FB 4PLKC 1SJHB 3ZTJH 3PWPE 5DJXB 4UIKL 2VN4A 4NZJA 1HWHB 3MJ9H 3MLYL 1CU4L 3PGFH 4LASH 5I1DB 4JFEA 4X7DC 5GJSL 2OQJA 5AZ2L 5ACZA 3NOIA 1H9VA 4GG6F 4RQQA 4GW4A 4Q6IC 4KPHL 3I50H 5SWQB 3OF6D 4Y4KA 3UJTL 5CEXB 3U46B 1I1FA 1UA6L 5I0DA 5GISH 4RIRA 4WJ5A 8FABB 1EFXA 5AAMA 4V1DD 2HRLA 3KPRA 1KG0B 3VXUD 2FEDC 1MH5A 1XF4A 2OYPA 3HG1D 1YC8A 2H45A 1T22B 3QCVH 1F42A 4PTTA 5TDOA 4JY4B 1KC5L 3TVMC 1F4XH 4Z7NE 3HAEG 1LEIB 3MCKA 2D7TL 4OBSA 4FQQA 3ULSB 1UH3A 3HS0B 5B8CC 4LPWA 5IVXF 5J1AA 4OTXL 3GKZA 5C7XH 4Y88A 3TBVB 3MBEA 3T3ME 1S9KC 2C5DC 1LE9B 4M43L 3IF1A 4S0UC 3CXHK 3ZHLA 2VDQH 3MNZA 1DFBL 1JHKH 1J8HA 4PY8J 4LP5A 3QIUA 5D2NC 4M61B 3ZDYE 4CVUA 3S4SB 4QOKA 5DFVD 5K9JH 2N56A 4D9QD 5JA8B 1DBBL 1T1XB 1EEYA 1P6FA 3DETC 3O6FD 1GZPA 1QFWL 1PG7H 1UM5H 1AD0A 4LLVB 4UV4H 3IRPX 1EMTL 2BNUB 4U1LA 5FUZL 1MF2H 1PX3A 4S0TD 2BFVH 4S1DD 3U0WH 4X8JB 1YN7A 2JCCE 3M17A 4AM0B 2I5YH 2IBZY 4Z9KB 2LABA 3ZKQD 5I1LA 2H2PD 3HI5L 3HTLX 1NBVH 2YWYA 1L9NA 1YMMA 5HHVL 4K07A 1MCNA 1MJJA 2A6IB 4HKBA 3VFOA 3WXWL 3RFZC 3OHXA 3BP5A 3PWNB 3TA3D 5ITFA 4X9GA 4JQIH 3W11D 5ID0A 1U3HB 1D6EB 2DAVA 1IAKB 4BYHA 4UB0H 4JQXA 3RVVC 1TQCB 4XMLL 1AXSB 5T3XL 1VPOL 5K9QI 4XCNB 4BSWA 3C5JB 4I5BB 3NCJH 3QH3A 4PRPD 1OM3H 3MV01 4PJCA 3LIZH 2VQ1A 4RWYL 1JUFA 5GS0C 5D7KD 5ALCH 4RSVA 2X70A 5BRZB 1EJOH 2D9QB 1RK0B 4TUOB 5KW9L 3FQWA 4G8FB 1T2QL 2PW2A 1XF2A 5T1KD 4BQ6A 3EYSH 3BKYL 5D7JC 1EBAA 1YEGH 5SWZE 1U92B 1F3DH 1CXIA 1NPUA 1XAUA 5ITBL 1GGUA 2FJHA 5E0QA 4MJ2A 3FQUB 3LKNA 1V7NL 3R0NA 4K3EH 5DZLA 4OM0L 1BGXH 1MEXL 1TJHH 4JJHA 1C5DA 2A6KA 3P3YA 2A9NH 2RQ8A 2OTWA 2CDEB 4EN3B 1CDIA 1FFOA 1LEGA 1T5WB 3ISWA 4RBPH 1RZGB 4GS7C 3WLBB 4HUVA 2AJSL 3HAEH 5DQJA 4XCYA 2BJMH 1BBDH 3DURA 4WW1A 5HYFA 3RZWA 5MHSE 5HI4C 4TTGA 5CP3A 1EUTA 3DRQB 4GKZA 4LCIH 3ALXA 2QHLA 3C5ZD 5HHQA 5FGSA 2YPKB 4NO2B 3SGEH 2CUIA 3C9NA 2XIDA 1JZ4A 3LRSA 3PL6A 1G7IB 1FBIH 4Y0GA 1G9EA 4OF7A 4IRSD 4NCC2 1A1OA 1A3RH 1MCPL 3H9SB 3MRIA 1UT9A 3HPLA 5DT1L 1REIA 2CXKA 2QSCL 4XNUH 1V3KA 1U8KB 4GSDL 5FCUH 4H20L 1UM6L 1Q9WB 3GJEB 2D3VA 1KGCD 4P46D 2BSED 3OAZH 3ZTNL 3CAFA 5ENWA 5IBLC 5DUBA 4JJ5B 3B9AA 3QFJD 4OZFA 1B4JL 1JI1A 4IS6A 2WIIB 2WP3O 2XWBA 2FIKB 2I07B 4OD2A 3ZYJA 3OSKA 4FQHA 1Q38A 1NKOA 3ARRA 3D39A 2CK0L 3ARGA 4P2QB 2GITA 3PNWB 3QUZA 4KHTH 3T2QA 4Y8DC 1UEYA 4YZFE 1EZVX 2OR9L 4J8RA 4CVZA 4HIJB 1VFMA 3K7UA 1CICC 3MJ7A 3P9LB 3VWJA 5I1JL 3CCHB 1MFBH 4RAVB 4OGAD 3OG4B 1P4BH 1S5IL 3CFCH 1A4KB 4H0HB 1D5MA 5D7LA 2K1MA 2DJUA 5CSZB 4JY5H 5GGVH 4WHTA 3QNYA 5FDWB 3CXDH 1LMKA 3NH7H 5LGHL 5ISZD 2APBA 1NCBH 5DI8A 5EUOB 4J3WA 1AQKH 4OGXL 3MLPA 4ZFZA 1DLFL 3NA4A 3IGAA 1JNNL 1CLZL 3BRFA 5IROC 3MRQA 2BHZA 1WZ1H 2W60A 3C60D 1CT8B 1IAIL 3JV4B 2OL3L 5B22A 3O2WL 4QHUA 3GNMH 2FSEB 3Q1SH 2VJXA 1BQHB 3GI8L 3QG7H 3U2SB 4XVJL 1G6VK 3OTTA 4C56B 1GGYA 2P8LB 3TLRA 4XCCH 3LN4A 4Z77A 5B38B 4P3DB 2AJYL 3QULA 2HKFL 4ZS7H 4OUUB 2MHAA 1E4XI 3LKQA 4QXTB 2P8MB 1KFAH 4LSQH 5IJVB 4M1GL 2BRRH 1I9EA 4OLXH 3VA2C 5C0GB 5SWSD 2W9DH 4UIMB 1KELL 1MCRA 4YFLI 4APQD 3QUXD 3DX7A 4WTXA 3T0WA 4KRNA 1NJ9B 4RWHA 1ITBB 4YDVA 3R1GH 3QEQA 5IB4A 4PJBA 1JPGA 3FQRB 5C70A 3TNNB 4Q6IB 2YA2A 1SM3L 5KJRH 4POUB 4G9FE 2DBLL 1W2KT 5MEOB 4ZUTB 3A67L 1HHGB 4JFDA 4OAWB 5CHNA 5D1QC 4ZFFB 5IFAL 1KCSL 1UWGL 4DQOH 2VKXA 1EERB 1H3UA 4OKDA 4ORZC 5IGXH 4KAQL 2RR3A 3CH8A 2HVJB 5GHWH 4ZOAA 2XTJE 5T5FL 4PLJC 4K7PY 3TVMB 3CFJA 1FG2B 4PYGA 5E8NB 3MBEC 5JZ7D 2DL2A 2J8UF 2E7LA 4XPHL 4NQXB 3MNVA 2XI9A 5I71C 2IBZX 2P5EA 5B8CB 4XP6L 4R26L 3JTSB 3DGGB 2RHEA 5L9DL 1MFCL 2O5YH 1PVHA 2F54B 5FYJH 3QIUC 5EIQA 1XCTB 2QEJA 3IDNB 2R0KH 4U1IA 1BBJA 1CF8H 5CGYC 5B39G 4LRNL 2EDHA 1W0VA 4OF5A 4F3FA 3INUH 5D2NB 4I0PD 4GRWF 3V0VA 5LBSH 2F53E 2PXYA 4HC1H 1JF1A 5F3BB 5F6IC 5H37H 5IM7A 2BVUA 2V6HA 4K7PL 4OD1L 3CU1A 3VFNB 1T1ZA 4KRPC 3SDCD 5FYJE 4JFOB 3QNXA 4JAMB 3QA3B 5JXEA 2PYEE 2C1PB 5F7YC 1QFUH 1LEKA 3KHQA 4IM8A 2BNQA 4R97C 3T04D 1EK3A 3MX0A 4XNYL 3BEVB 3BIBX 3NZ8B 2UWEB 3RWFA 3GMPB 5GJTL 3HMWH 2HT3C 3MBXH 4HS6B 5HI5C 2VLKD 2HG5A 4UOJA 3MACH 4P4RB 3EFFA 2X9WA 1I85C 4L8DA 3EGSA 3TBSA 1JZ5A 2OR8A 3HZKA 1QR1A 1FDLL 5E8DH 1IKNC 4P2RB 2R9HD 1TETL 1PDKA 2XWTB 5DHYB 3D87B 3SY0A 2NX5E 3O2VH 3MA7B 3WCYA 2X4RA 3QFDA 5DYOB 3QDGD 4NQVA 4HZLA 2HLAB 4F33A 3NAAL 3GMMA 4QXUH 3M1BA 4HBCH 3UPRB 3KYAA 1OCWL 5GGSB 5D7JB 4NGHL 1CQKA 4QCIB 3W0WD 4JZNB 2BCKA 2C3VA 4WUKL 4N0CC 2X4OB 4E5XB 5H94A 1FAKT 2YD5A 2Y6SC 5JIKA 2A0LC 4HS8H 1DZBA 3I2CL 3S3SA 1CFTA 3WN5A 1QRNB 4ZTOH 1GC1H 1YEDA 4HT1L 4D3CL 1KLGB 3EO0B 1F8TH 1FZKB 5TF0A 4ZO7A 5TE7H 4GS7B 3HE6A 1GOGA 2HTLC 5LGJB 2MQ0A 2PO6C 4MJ6B 2DTMH 2VLJB 3LVEA 1UJ3C 4MNGE 5E9DB 4HS3A 3T0XA 3U36B 1YNTA 3QDJD 4N8CH 3SE4A 1FV1B 5DGQA 3VE0A 2X1QA 5JOFB 3MRRA 5JO5B 3E3QE 1CXKA 4HEME 2I9TB 4JO1L 1MCOH 4LHJB 2NY5L 3SDAC 4L4TE 4OQTA 3CVIL 4JM2C 3BKJH 4HG4K 3NMEA 1R3KB 3VGHA 1OPGH 1JGVH 2CJUH 4NWTH 3N0PB 4PRAB 3SGJA 1FQ9C 3ZKMD 3JV5A 4KI5C 3VXSB 4WENB 1KB5A 4NT6B 1M7DA 5FYKU 1EFQA 1T03H 1NCTA 4PRIB 2J8HA 1BX2A 5L0QC 2CUMA 1T2XA 2XYCA 3UPAA 4J3TA 2PW1A 4W81A 4Z7WE 4GRWE 1GCFA 2AW2A 3MRBA 4N0RA 2HT4C 4LBEA 2JJVA 5H8DA 3UBXI 4MAYA 2Y5TA 4Z6AT 4Z18A 1U8OA 1CICB 2YKLL 3KYMA 3V0WH 2R1YB 3FN0H 3F58H 5FAAA 4NFCA 5BMFL 2SEBA 1RZKL 2W92A 3O3BA 4Z7UA 2CH8A 5DD1H 1S8DB 3LKRB 1TTFA 3WDJA 3GDBA 5T1MA 1VGEH 1T04A 4L9LA 4MNQA 5FA4A 4P2CG 4B50A 2A9MH 4LLMA 5TF1H 3V5KB 1S7TA 3EYUL 4RMRA 1ITCA 1HH6B 2GEEA 4JPIB 4QHLA 1JTTA 5C09A 1S7UB 1R5VB 4V2CB 4ZNEE 3TN0A 2PR4H 1U58A 4NQEE 3QXWA 1OQXA 5C0EB 3UJJL 4FTVB 5I1KH 1MCWM 2Z93A 5IEKB 1A0QL 1HXMA 2DQEL 4XXCA 3NFNA 1G6RH 5ESVB 1MQ8A 3E6HB 3TH2T 4ELME 4OB5L 3H42H 4KDVA 3R06B 5D70H 4K7PX 3TJEH 4YDIL 1XGTB 4LARH 5JORB 2Y72A 2KPNA 3RTQA 4TSAL 1SEBA 1RJZA 3UJIL 2WBJA 4PJAF 4HF5L 1JNHA 3PJSA 4LCYA 4EBQL 2XZQH 4HGKC 2R2CA 3EJYC 4G80B 4LSSL 4U6TA 4AIZB 5DD3L 3QJHA 5C2BL 1C5CH 4U0QB 3QWOA 5C0AD 3MODL 1KJVB 3MCG1 4UIKH 4K94H 3UCRA 3ZKND 1CU4H 25C8L 3WKNA 4ZDHA 4IRJA 4MCZA 5GJSH 5AZ2H 4NO5A 2XY1A 4ENEC 5D1QB 3S37L 3WL9B 4JHAL 4KKAC 1MRFL 1I9IL 4RA0C 5IV2B 4KPHH 4QGTA 3ULVC 4QHNB 2DL9A 3O2DL 2QV2A 3UJTH 2P7TB 1UA6H 4KY1L 4D2NA 4PJ5D 2GJ6D 3RPIA 5HPMB 5D6DA 5F7NC 2G75B 4CW1A 1F3RB 5ANMA 1HDMB 4TTDC 3QHZL 4V1DE 4AIXA 3VXUE 4OLEA 1FVDA 3O0RH 5HHMA 3HG1E 2R39A 2IANA 1KC5H 4FXLA 1JNLL 4XHJD 4X6BB 2PXYC 3FAXA 3IT8D 4YHNA 3SGKA 2D7TH 4FMFA 5EU4B 4YHLL 2NYYD 4XWGL 2DRUA 2BZDA 1BM3L 4OTXH 4PJ8D 1FO0L 1K4DA 5F6IB 2IADA 3H9SA 4M43H 3THML 4UT9L 3JV6A 2H3NB 1J88A 4FQ1L 5F7DA 2Q86B 1DFBH 4KRPB 3UTSD 2OZ4L 1DUZB 1IBGL 2Y7QB 2YA1A 4IRZL 5BQ7A 5CD5D 3SDDD 3QDMA 2DM2A 4PJFF 1PKOA 1L0YA 3TO4A 5A16B 4R97B 1BQLL 5JIIA 1QPXA 1DBBH 4D9QE 5F1SA 4C4KT 2Z91A 4U1NA 4J3OC 1QFWH 4POZD 1CCZA 1U8HA 4JRXA 4X6DA 5E6YA 4HV8B 4CL7A 1EMTH 3G6JB 5FUZH 4PRHA 3QT2A 4N90D 5C0CB 3HI1A 1KENL 4JZJC 4LPTA 3OR6B 2ENSA 4ZXBA 3VGAC 4PD4J 2IAMD 3D85D 3VD7A 1U8MA 1JGEB 4W6XB 3LD8C 3GSNB 1R5WA 3QPXL 5L7XH 2O61B 1JPSL 3HUJE 1KNOB 3WXWH 4UTAL 4YHPB 4ACPA 4L29A 1CFSA 2PTTA 4NZTL 5C0NC 3FRPA 3RWDB 4GO6B 4XMLH 4ZUSA 4U4BA 5T3XH 1VPOH 4TSBH 2HN7A 4YFDB 3B43A 3HFML 3ARBA 3WLWC 3ARQA 5CJXC 3VFUA 3T0ED 4K9EL 4RWYH 1RZ8A 1XGPA 3V4UL 3PP3K 1LNUB 2XG4A 4PRPE 3CPLA 1A6WL 5KW9H 1JIBA 1J05B 3FT2A 5D2LB 1T2QH 5D7KE 5FB8B 1FNFA 3EDDA 1FYTB 1QUNA 4Z76A 3RY6A 3TT3L 4LLYB 1WBYB 4PJAE 2D0FA 1LVEA 3CDGA 1BLNA 1S7RB 2B4CL 5ITBH 3QZWB 2FR4A 4PJ7F 5T3XE 2D4FA 4KKBC 5J3HD 2PO6B 4OM0H 1MEXH 4XNQA 1UJ3B 4F7MB 5I1IL 4JFZL 5ERWB 4WHDA 5E4EC 1T83C 3UZQA 4U31A 1VSCA 4MD0A 2AJSH 2F8VA 4X7TA 4ZSOE 1F6FB 1ND0B 4JM2B 1JMZA 3PABA 3PP4H 3QXTA 3RNKB 2A2QT 1QBBA 5C6TH 1IAOB 1VERA 1MY5A 3LS5L 5JHDD 4L1DA 1OP5K 1EJ6A 2ZOLA 5DHVH 4J3SA 1YDPB 1Y18A 3S88L 4NNPL 4G8GA 1EEZB 1L7IL 1MCPH 1XR8B 5DT1H 5AAWA 4ALAL 2QSCH 5L0QB 3QQ4B 2WWKO 4MD5A 1OAYL 5E03A 4NKDB 1S7SA 2AEQL 4GSDH 3VGFA 4H20H 5DK0A 2YC1B 2HFEA 5D7SL 1KIPA 3ZTNH 4KK5D 3BD3A 4E41B 3T09A 3U7WL 4PGJA 1BVZA 1KGCE 4QHKJ 1B4JH 1QR4A 3LQAL 3JTSA 4AT6B 3DGGA 4X7EC 1TJGL 3WS3A 5CMAA 1LP9B 1C12A 4HMDA 2CK0H 1YEIH 2BRQA 2Z35B 1CTNA 1AR1C 2R23A 4M4RA 4P3CL 4F15C 5IMMA 4KK8D 3S37X 3VW3L 1UCBL 5CSGA 4OGYL 1HSAA 2OR9H 3QIWD 3W82A 4K55A 1S7WB 4LEOA 1F4YL 5I1JH 2NY2D 1A22B 4PGCA 3V7AG 5F1KC 1L0QA 3FO0L 5MP6L 1S5IH 3T4AB 4X6CB 4AIOA 4AJ0A 2FYYB 3GSVB 4R7NB 2H41A 2VLRB 2P1YA 2MOVA 4LP4A 1Z5LA 3L3OB 5LGHH 3CVHA 5KS9B 4OGXH 1MLCA 3JWNC 3LEXB 3STLB 4F8QA 2AXGB 1DLFH 5FK9B 5ISZE 1JNNH 4WV1A 1HQRB 1OY3B 3BSZL 1NGWA 5IW1B 4ISVA 3FFCA 3BKCL 3OKLB 1W0WA 4U2ZA 5DJAA 3ALPA 4MWFB 4NBXB 2OL3H 1ZMYA 2VAAB 2L7UA 3O2WH 4JANB 3UTPD 4PJHF 1KCVL 2LVEA 2VB5A 2WBJC 4XVJH 1ZOXA 1RUAL 3BPCB 1IKFL 3HLAA 3OXRB 5D7IF 5TFSL 5HYJD 1BFVH 3VD9A 3RGVC 3WIHL 1ZA3B 3PWJA 3DROB 5I30H 3VFRB 4Y7MA 3GM8A 5A43C 1WBXA 2AJYH 4XBGB 4LGSB 2ADIA 2HKFH 4BSVB 5EU6B 1LO2H 5DRZA 4OFYD 3EZJB 5C8JA 4M1GH 1QOKA 5ICYA 1Z3GL 35C8L 1KELH 3AY4C 3UTTD 5T1DL 2OTUB 2DWEB 3L3IB 4G8IA 1DQLL 3BMVA 3H0TB 4UQ3B 5SWSE 4BK4A 1JZ6A 1Q9OB 1D9KC 4E5XA 2IG2L 3SE9L 2RIKA 4YHOL 5FYJU 3T65A 1BZ9A 1JK8A 1SM3H 4WWKC 5IF0B 4L3AA 1GGCL 3I85A 4R96B 2DBLH 3KYNB 1U91A 1CL7L 3A67H 3NGBC 4I77L 5J8OA 3K46A 1WBZA 2GJZB 5IFAH 4XGZB 4KAQH 5DJ8A 1MHCB 5T3ZL 5DJ6B 4HWBL 1MRDL 5T5FH 4Y1AA 3FQNB 2V7NA 4S2SA 1MCBA 1B0WA 1F3JB 1EX0A 1I8IA 4UAOC 1VACA 3QUMA 4D0BB 3NN8A 3U0PA 4N5EA 4XPHH 3WKML 3HMXL 4XP6H 4R26H 2DB8A 4PY8I 5IG7B 4GMSL 4NQSA 1XH3A 1MFCH 2JIXD 3H9ZA 4PRBB 5T3ZD 1TZHA 3L6FB 1ZV5A 3WUWG 5GGQL 4AEHL 4C58B 4GKOA 5F3HA 4LRNH 1G7JA 2NTFA 5L2KA 4W4OA 2VABB 2V7HB 4WI7A 4I4WA 5INCB 5C9JB 3FONB 3VXME 1UFUA 1VEMA 4OZIB 1BPVA 5EZLB 3QUKB 1T6VN 4Z7VA 1ZT1A 4U7KA 3D3VD 5E8PB 1FVEB 4M5ZL 4K7PH 3S9DB 2L0DA 2PYFA 4OD1H 4UQ2A 3ELAT 4HGWA 5DMYA 4EXPX 1NEZG 3V7AE 4XNMA 1NDMB 1SY6L 2ZP0T 1RUPL 2ICEB 4JZJB 2HTKC 4XNYH 1T89C 4N8VB 5GGRA 3VGAB 3ZE1F 2X4QA 5IKCB 3RU8L 1U8IA 4RFNC 5GJTH 4L8SA 3VXTB 4PPTA 5F7UA 4QT5A 4PJGB 3U30C 5DJYB 4KU1A 3F7YA 6FABL 5HHOB 3LD8B 4Y5YA 3IFNL 2J2ZA 5C0IB 1DQQB 5DRNB 5EULV 3MRHA 3VRIA 1TCRB 4WUUB 3C6LC 5EBWA 3CSYB 4G6AC 4O2FA 2VLKE 4B53A 2ARJQ 2G2RA 3DX9A 1FDLH 5CIPH 4JR9L 1TETH 2X4UA 5LAXB 3SE3C 2FNBA 5KSAD 3HZVB 2CKNA 3KLHC 3HZYA 4KXZH 5D71L 43C9B 3E6FA 3ULUC 2WP3T 3QDGE 1RZJL 2NY1B 3QG6A 2EDNA 4DTGL 1SVCP 4HCRA 1UXSB 1RZFL 3RWIA 2VZ3A 2V17L 3TZVA 5FO9B 3GSOB 3QDAA 1GVIA 4LOUC 4G8EA 1IC1A 3KLAA 2VDPL 3I2CH 4PJEF 3BWAB 4YIQB 4GXUN 3O11B 3MV9B 4XVUC 4FNLL 4HT1H 2XA3A 4KJQC 5IMKA 4D3CH 3IB4A 5E4EB 2COQA 4ZPTB 1NFIB 4P5TC 3SJVA 1K9TA 3BP7A 1YC7A 1KPUA 4NN7C 5BRZD 3HA0A 5DA0B 3TFKA 4X4ZA 1PLGL 3BVNA 1UXWA 3FQTB 4NUJA 4AIZA 4JFFB 4S1QH 4DZBB 1Z9SA 3TJHC 2ZG3A 1K6QL 1S9VA 4XVSL 4NYLB 1SBSL 3FT3A 3TPUE 1X4XA 4X4YB 3QDJE 4BH8B 1IFHL 5B21A 3KPNB 3W81A 1ZTXL 2NY5H 1LQVA 1RUKL 3CVIH 1W0YT 4NQUA 1OGAA 2C4FU 4EQ2A 2YRZA 5EBLB 3CFBB 4FP8L 1YEFL 1FP5A 3CDFA 1GH7A 2DKUA 5CBEA 1ZXQA 4JY6A 4P57B 5D72H