5CD4J

The type ie crispr cascade complex from e. coli, with two assemblies in the asymmetric unit arranged back-to-back
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
156
structure length
156
Chain Sequence
EIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLRMVFCLSAGKNVIRHQDKKSEQTTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRLLTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of CRISPR-RNA guided recognition of DNA targets in Escherichia coli.
pubmed doi rcsb
molecule keywords CRISPR system Cascade subunit CasE
molecule tags Hydrolase/rna
source organism Escherichia coli
total genus 44
structure length 156
sequence length 156
chains with identical sequence K, V, W
ec nomenclature
pdb deposition date 2015-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF09485 CRISPR_Cse2 CRISPR-associated protein Cse2 (CRISPR_cse2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.40 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 5cd4J00
2ZCAA 3WA8A 5CD4J 4H79A 4QYZB 5H9EB 5H9FB 4H7AA 4U7UB
chains in the Genus database with same CATH superfamily
1H3JA 4NVGB 2RBZX 3RIVA 2X07A 4A5GA 2Y5AA 3VLJA 3R99A 5SW6A 1HSRA 2GHDX 5KSFA 1SJ2A 4G05A 4XV7A 4NVAA 4CZOA 2AQDA 5SX3A 3VLIA 1AEMA 2GGNX 5SW5A 2RC2X 2VCNA 4XV6A 2V23A 4XVAA 4BLXA 4BM1A 3Q3UA 5CIHA 3FMUA 4PAEA 4JQJA 1LYCA 5KQHA 5JHYA 1CCEA 5ABNA 5SYXA 4CVJA 5CD4J 2A7UB 4CVIA 1AEBA 1GZBA 3VLMA 5SYUA 4USCA 5L05A 1U75A 4JQNA 3RIWA 2RBVX 4H7AA 5EJTA 1H57A 2EUTA 5KQ3A 4NVKB 1AENA 2B11A 4BM4A 1A2FA 1AEDA 1H58A 4A71A 1CK6A 4NVDA 4FDQA 4JMAA 6ATJA 1ARUA 1B82A 1H5EA 1YZRA 1ITKA 4NVMB 1CCGA 1CPDA 1CPGA 1GZAA 5SX2A 2BO5A 2GB8A 3M2FA 1S73A 2AS4A 1STQA 2ANZA 1BVAA 3UT2A 4CCPA 2CYPA 4NFGA 2ZCAA 3M5QA 4CZRA 3ZCHA 5SXRA 2PCCA 1AEHA 1AEJA 1OAFA 1LYKA 1H5AA 3M2HA 1H5CA 1H5KA 5L86A 1ARPA 1DSEA 3VLKA 1ZBYA 4NVCA 1ARYA 5KQ6A 1U2LA 2CEPA 1GWUA 1B80A 5SXWA 3VLHA 5FNEA 2CCAA 3CCPA 2EURA 2EUQA 4P4QA 1AC8A 4NVIB 4C51A 5ABQA 1MKQA 2WD4A 2EUOA 5SYVA 3UW8A 2GHKX 4JPUA 1DCCA 5SYLA 2JMXA 3M2EA 5KSKA 4FEFA 4GKFA 4NVNB 1MKRA 1Z53A 1MN2A 5SXTA 1CCBA 1APXA 5EJXA 5SXQA 3RRWA 4ATJA 1AEUA 2AS1A 2VCSA 1U2JA 4JMVA 1C8IA 3M2CA 5KQIA 1OAGA 2B0ZA 5CIDA 2RBUX 5JHXA 4GEDA 4JM9A 4A7MA 2VO2X 1ABVA 5CJHA 1YYGA 4CCXA 3EXBA 2VNXX 7ATJA 1BEQA 5SW4A 4H79A 2RC0X 1SBMA 4JQMA 3FKGA 1GX2A 3M2IA 2ICVA 4BLZA 3X1LF 1H55A 2B12A 5SX7A 1AEEA 2VNZX 1GWOA 1DJ1A 3M2BA 1CCIA 1BEMA 3M2GA 1W4WA 1YYDA 3FM6A 1ML2A 3X16A 4BLYA 3CCXA 2AS2A 3FM1A 1ARWA 1BEPA 2IA8A 1SOGA 1LY8A 1ARVA 4CZPA 2CCDA 1SDQA 1CPFA 1W4YA 1CCCA 4XV4A 3WXOA 2XJ8A 2AS3A 4U7UB 2YLJA 1BEJA 4JMSA 2GHCX 3FM4A 4JN0A 1CMQA 2OEBA 1CMUA 1AA4A 2CL4X 1S6VA 1MK8A 1JCIA 1YZPA 4BM0A 1AEOA 1CCKA 3ZCGA 2X08A 3M25A 4A78A 1DS4A 4JZAA 1QO4A 5SXSA 1ZBZA 1IYNA 2XJ5A 1DSOA 1LGAA 7CCPA 2WSSS 1H5MA 1AEGA 1CCAA 1HCHA 2GHEX 2EUNA 5CIBA 2CCPA 2RBWX 4NVFA 3ZCYA 1BESA 4FCNA 4XV5A 4BLKA 3M27A 2EUPA 1MNPA 4BLLA 4JMBA 5ABOA 1MN1A 3M23A 1RYCA 1KRJA 1UB2A 5SX6A 3HDLA 1AEKA 1BEKA 2GHHX 2XI6A 4CZNA 2E3BA 5SYJA 3VLLA 5SYKA 5H9EB 1H5GA 2VKAA 2XIHA 4NVLA 5SYIA 4NVEA 2EUSA 5SYWA 1DJ5A 3M8MA 3WA8A 1CCJA 4NVJB 4BLNA 1GWTA 1SCHA 3M2AA 1KXNA 1JDRA 3M29A 3FJWA 1PA2A 1ATJA 5JHZA 4XV8A 1CYFA 4QYZB 2E3AA 5CICA 2VCFX 1U2KA 4JMTA 4A6ZA 2JTIA 5JQRA 2RBYX 2RBTX 3M28A 1GW2A 1BJ9A 1CPEA 5L02A 3E2OA 4OQ7A 2Y6AA 1QGJA 5JPRA 2ZOPA 5D6MA 2EUUA 1LY9A 4C50A 5SX1A 5SYHA 4NVOB 4NVHB 4NVBA 2AS6A 4FCSA 1KOKA 1V0HX 2B10A 1BGPA 5AL9A 4BM3A 1H5LA 1KXMA 2N18A 4BM2A 1CCLA 5ALAA 2RC1X 1H5IA 3WNUA 1AEVA 3M26A 2XJ6A 2BCNA 4JPTA 1B85A 1H5DA 1DSPA 2Y6BA 1DSGA 2BOQA 5CIGA 1CCPA 5AMMA 2E39A 4JM6A 3M2DA 2PCBA 4JM5A 5H9FB 2XILA 4JMWA 1LLPA 4CZQA 2W23A 5KQKA 5CIEA 5KQ2A 1AESA 1FHFA 4JQKA 1H5FA 5SXXA 6CCPA 2ATJA 1AETA 1KZMA 3E2NA 1QPAA 5SX0A 4JM8A 5AOGA 3ATJA 5SX0B 5SYYA 5KQ0A 1EBEA 1AC4A 4JB4A 4CUOA 2XIFA 2V2EA 2RBXX 4JMZA 3R98A 1ARXA 1H5JA 1CMPA 1H5HA 1U74A 1CMTA 5FNBA 5CIFA 2YCGA 1AEFA 4JPLA 5CCPA 1A2GA 1AEQA
chains in the Genus database with same CATH topology
1H3JA 4NVGB 2RBZX 3RIVA 2X07A 4A5GA 2Y5AA 3VLJA 3R99A 5SW6A 1HSRA 2GHDX 5KSFA 1SJ2A 4G05A 4XV7A 4NVAA 4CZOA 2AQDA 5SX3A 3VLIA 1AEMA 2GGNX 5SW5A 2RC2X 2VCNA 4XV6A 2V23A 4XVAA 4BLXA 4BM1A 3Q3UA 5CIHA 3FMUA 4PAEA 4JQJA 1LYCA 5KQHA 5JHYA 1CCEA 5ABNA 5SYXA 4CVJA 5CD4J 4CVIA 1AEBA 1GZBA 3VLMA 5SYUA 4USCA 5L05A 1U75A 4JQNA 3RIWA 2RBVX 4H7AA 5EJTA 1H57A 2EUTA 5KQ3A 4NVKB 1AENA 2B11A 4BM4A 1A2FA 1AEDA 1H58A 4A71A 1CK6A 4NVDA 4FDQA 4JMAA 6ATJA 1ARUA 1B82A 1H5EA 1YZRA 1ITKA 4NVMB 1CCGA 1CPDA 1CPGA 1GZAA 5SX2A 2GB8A 3M2FA 1S73A 2AS4A 1STQA 2ANZA 1BVAA 3UT2A 4CCPA 2CYPA 4NFGA 2ZCAA 3M5QA 4CZRA 3ZCHA 5SXRA 2PCCA 1AEHA 1AEJA 1OAFA 1LYKA 1H5AA 3M2HA 1H5CA 1H5KA 5L86A 1ARPA 1DSEA 3VLKA 1ZBYA 4NVCA 1ARYA 5KQ6A 1U2LA 2CEPA 1GWUA 1B80A 5SXWA 3VLHA 5FNEA 2CCAA 3CCPA 2EURA 2EUQA 4P4QA 1AC8A 4NVIB 4C51A 5ABQA 1MKQA 2WD4A 2EUOA 5SYVA 3UW8A 2GHKX 4JPUA 1DCCA 5SYLA 3M2EA 5KSKA 4FEFA 4NVNB 1MKRA 1Z53A 1MN2A 5SXTA 1CCBA 1APXA 5EJXA 5SXQA 3RRWA 4ATJA 1AEUA 2AS1A 2VCSA 1U2JA 4JMVA 1C8IA 3M2CA 5KQIA 1OAGA 2B0ZA 5CIDA 2RBUX 5JHXA 4GEDA 4JM9A 4A7MA 2VO2X 5CJHA 1YYGA 4CCXA 3EXBA 2VNXX 7ATJA 1BEQA 5SW4A 4H79A 2RC0X 1SBMA 4JQMA 3FKGA 1GX2A 3M2IA 2ICVA 4BLZA 1H55A 2B12A 5SX7A 1AEEA 2VNZX 1GWOA 1DJ1A 3M2BA 1CCIA 1BEMA 3M2GA 1W4WA 1YYDA 3FM6A 1ML2A 3X16A 4BLYA 3CCXA 2AS2A 3FM1A 1ARWA 1BEPA 2IA8A 1SOGA 1LY8A 1ARVA 4CZPA 2CCDA 1SDQA 1CPFA 1W4YA 1CCCA 4XV4A 3WXOA 2XJ8A 2AS3A 4U7UB 2YLJA 1BEJA 4JMSA 2GHCX 3FM4A 4JN0A 1CMQA 1CMUA 1AA4A 2CL4X 1S6VA 1MK8A 1JCIA 1YZPA 4BM0A 1AEOA 1CCKA 3ZCGA 2X08A 3M25A 4A78A 1DS4A 4JZAA 1QO4A 5SXSA 1ZBZA 1IYNA 2XJ5A 1DSOA 1LGAA 7CCPA 1H5MA 1AEGA 1CCAA 1HCHA 2GHEX 2EUNA 5CIBA 2CCPA 2RBWX 4NVFA 3ZCYA 1BESA 4FCNA 4XV5A 4BLKA 3M27A 2EUPA 1MNPA 4BLLA 4JMBA 5ABOA 1MN1A 3M23A 1RYCA 1KRJA 1UB2A 5SX6A 3HDLA 1AEKA 1BEKA 2GHHX 2XI6A 4CZNA 2E3BA 5SYJA 3VLLA 5SYKA 5H9EB 1H5GA 2VKAA 2XIHA 4NVLA 5SYIA 4NVEA 2EUSA 5SYWA 1DJ5A 3M8MA 3WA8A 1CCJA 4NVJB 4BLNA 1GWTA 1SCHA 3M2AA 1KXNA 1JDRA 3M29A 3FJWA 1PA2A 1ATJA 5JHZA 4XV8A 1CYFA 4QYZB 2E3AA 5CICA 2VCFX 1U2KA 4JMTA 4A6ZA 2JTIA 5JQRA 2RBYX 2RBTX 3M28A 1GW2A 1BJ9A 1CPEA 5L02A 3E2OA 4OQ7A 2Y6AA 1QGJA 5JPRA 5D6MA 2EUUA 1LY9A 4C50A 5SX1A 5SYHA 4NVOB 4NVHB 4NVBA 2AS6A 4FCSA 1KOKA 1V0HX 2B10A 1BGPA 5AL9A 4BM3A 1H5LA 1KXMA 2N18A 4BM2A 1CCLA 5ALAA 2RC1X 1H5IA 3WNUA 1AEVA 3M26A 2XJ6A 2BCNA 4JPTA 1B85A 1H5DA 1DSPA 2Y6BA 1DSGA 2BOQA 5CIGA 1CCPA 5AMMA 2E39A 4JM6A 3M2DA 2PCBA 4JM5A 5H9FB 2XILA 4JMWA 1LLPA 4CZQA 2W23A 5KQKA 5CIEA 5KQ2A 1AESA 1FHFA 4JQKA 1H5FA 5SXXA 6CCPA 2ATJA 1AETA 1KZMA 3E2NA 1QPAA 5SX0A 4JM8A 5AOGA 3ATJA 5SX0B 5SYYA 5KQ0A 1EBEA 1AC4A 4JB4A 4CUOA 2XIFA 2V2EA 2RBXX 4JMZA 3R98A 1ARXA 1H5JA 1CMPA 1H5HA 1U74A 1CMTA 5FNBA 5CIFA 2YCGA 1AEFA 4JPLA 5CCPA 1A2GA 1AEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCA A;  3WA8 A;  5CD4 J;  4H79 A;  4QYZ B;  5H9E B;  5H9F B;  4H7A A;  4U7U B; 
#chains in the Genus database with same CATH topology
 1H3J A;  4NVG B;  2RBZ X;  3RIV A;  2X07 A;  4A5G A;  2Y5A A;  3VLJ A;  3R99 A;  5SW6 A;  1HSR A;  2GHD X;  5KSF A;  1SJ2 A;  4G05 A;  4XV7 A;  4NVA A;  4CZO A;  2AQD A;  5SX3 A;  3VLI A;  1AEM A;  2GGN X;  5SW5 A;  2RC2 X;  2VCN A;  4XV6 A;  2V23 A;  4XVA A;  4BLX A;  4BM1 A;  3Q3U A;  5CIH A;  3FMU A;  4PAE A;  4JQJ A;  1LYC A;  5KQH A;  5JHY A;  1CCE A;  5ABN A;  5SYX A;  4CVJ A;  5CD4 J;  2A7U B;  4CVI A;  1AEB A;  1GZB A;  3VLM A;  5SYU A;  4USC A;  5L05 A;  1U75 A;  4JQN A;  3RIW A;  2RBV X;  4H7A A;  5EJT A;  1H57 A;  2EUT A;  5KQ3 A;  4NVK B;  1AEN A;  2B11 A;  4BM4 A;  1A2F A;  1AED A;  1H58 A;  4A71 A;  1CK6 A;  4NVD A;  4FDQ A;  4JMA A;  6ATJ A;  1ARU A;  1B82 A;  1H5E A;  1YZR A;  1ITK A;  4NVM B;  1CCG A;  1CPD A;  1CPG A;  1GZA A;  5SX2 A;  2BO5 A;  2GB8 A;  3M2F A;  1S73 A;  2AS4 A;  1STQ A;  2ANZ A;  1BVA A;  3UT2 A;  4CCP A;  2CYP A;  4NFG A;  2ZCA A;  3M5Q A;  4CZR A;  3ZCH A;  5SXR A;  2PCC A;  1AEH A;  1AEJ A;  1OAF A;  1LYK A;  1H5A A;  3M2H A;  1H5C A;  1H5K A;  5L86 A;  1ARP A;  1DSE A;  3VLK A;  1ZBY A;  4NVC A;  1ARY A;  5KQ6 A;  1U2L A;  2CEP A;  1GWU A;  1B80 A;  5SXW A;  3VLH A;  5FNE A;  2CCA A;  3CCP A;  2EUR A;  2EUQ A;  4P4Q A;  1AC8 A;  4NVI B;  4C51 A;  5ABQ A;  1MKQ A;  2WD4 A;  2EUO A;  5SYV A;  3UW8 A;  2GHK X;  4JPU A;  1DCC A;  5SYL A;  2JMX A;  3M2E A;  5KSK A;  4FEF A;  4GKF A;  4NVN B;  1MKR A;  1Z53 A;  1MN2 A;  5SXT A;  1CCB A;  1APX A;  5EJX A;  5SXQ A;  3RRW A;  4ATJ A;  1AEU A;  2AS1 A;  2VCS A;  1U2J A;  4JMV A;  1C8I A;  3M2C A;  5KQI A;  1OAG A;  2B0Z A;  5CID A;  2RBU X;  5JHX A;  4GED A;  4JM9 A;  4A7M A;  2VO2 X;  1ABV A;  5CJH A;  1YYG A;  4CCX A;  3EXB A;  2VNX X;  7ATJ A;  1BEQ A;  5SW4 A;  4H79 A;  2RC0 X;  1SBM A;  4JQM A;  3FKG A;  1GX2 A;  3M2I A;  2ICV A;  4BLZ A;  3X1L F;  1H55 A;  2B12 A;  5SX7 A;  1AEE A;  2VNZ X;  1GWO A;  1DJ1 A;  3M2B A;  1CCI A;  1BEM A;  3M2G A;  1W4W A;  1YYD A;  3FM6 A;  1ML2 A;  3X16 A;  4BLY A;  3CCX A;  2AS2 A;  3FM1 A;  1ARW A;  1BEP A;  2IA8 A;  1SOG A;  1LY8 A;  1ARV A;  4CZP A;  2CCD A;  1SDQ A;  1CPF A;  1W4Y A;  1CCC A;  4XV4 A;  3WXO A;  2XJ8 A;  2AS3 A;  4U7U B;  2YLJ A;  1BEJ A;  4JMS A;  2GHC X;  3FM4 A;  4JN0 A;  1CMQ A;  2OEB A;  1CMU A;  1AA4 A;  2CL4 X;  1S6V A;  1MK8 A;  1JCI A;  1YZP A;  4BM0 A;  1AEO A;  1CCK A;  3ZCG A;  2X08 A;  3M25 A;  4A78 A;  1DS4 A;  4JZA A;  1QO4 A;  5SXS A;  1ZBZ A;  1IYN A;  2XJ5 A;  1DSO A;  1LGA A;  7CCP A;  2WSS S;  1H5M A;  1AEG A;  1CCA A;  1HCH A;  2GHE X;  2EUN A;  5CIB A;  2CCP A;  2RBW X;  4NVF A;  3ZCY A;  1BES A;  4FCN A;  4XV5 A;  4BLK A;  3M27 A;  2EUP A;  1MNP A;  4BLL A;  4JMB A;  5ABO A;  1MN1 A;  3M23 A;  1RYC A;  1KRJ A;  1UB2 A;  5SX6 A;  3HDL A;  1AEK A;  1BEK A;  2GHH X;  2XI6 A;  4CZN A;  2E3B A;  5SYJ A;  3VLL A;  5SYK A;  5H9E B;  1H5G A;  2VKA A;  2XIH A;  4NVL A;  5SYI A;  4NVE A;  2EUS A;  5SYW A;  1DJ5 A;  3M8M A;  3WA8 A;  1CCJ A;  4NVJ B;  4BLN A;  1GWT A;  1SCH A;  3M2A A;  1KXN A;  1JDR A;  3M29 A;  3FJW A;  1PA2 A;  1ATJ A;  5JHZ A;  4XV8 A;  1CYF A;  4QYZ B;  2E3A A;  5CIC A;  2VCF X;  1U2K A;  4JMT A;  4A6Z A;  2JTI A;  5JQR A;  2RBY X;  2RBT X;  3M28 A;  1GW2 A;  1BJ9 A;  1CPE A;  5L02 A;  3E2O A;  4OQ7 A;  2Y6A A;  1QGJ A;  5JPR A;  2ZOP A;  5D6M A;  2EUU A;  1LY9 A;  4C50 A;  5SX1 A;  5SYH A;  4NVO B;  4NVH B;  4NVB A;  2AS6 A;  4FCS A;  1KOK A;  1V0H X;  2B10 A;  1BGP A;  5AL9 A;  4BM3 A;  1H5L A;  1KXM A;  2N18 A;  4BM2 A;  1CCL A;  5ALA A;  2RC1 X;  1H5I A;  3WNU A;  1AEV A;  3M26 A;  2XJ6 A;  2BCN A;  4JPT A;  1B85 A;  1H5D A;  1DSP A;  2Y6B A;  1DSG A;  2BOQ A;  5CIG A;  1CCP A;  5AMM A;  2E39 A;  4JM6 A;  3M2D A;  2PCB A;  4JM5 A;  5H9F B;  2XIL A;  4JMW A;  1LLP A;  4CZQ A;  2W23 A;  5KQK A;  5CIE A;  5KQ2 A;  1AES A;  1FHF A;  4JQK A;  1H5F A;  5SXX A;  6CCP A;  2ATJ A;  1AET A;  1KZM A;  3E2N A;  1QPA A;  5SX0 A;  4JM8 A;  5AOG A;  3ATJ A;  5SX0 B;  5SYY A;  5KQ0 A;  1EBE A;  1AC4 A;  4JB4 A;  4CUO A;  2XIF A;  2V2E A;  2RBX X;  4JMZ A;  3R98 A;  1ARX A;  1H5J A;  1CMP A;  1H5H A;  1U74 A;  1CMT A;  5FNB A;  5CIF A;  2YCG A;  1AEF A;  4JPL A;  5CCP A;  1A2G A;  1AEQ A; 
#chains in the Genus database with same CATH homology
 1H3J A;  4NVG B;  2RBZ X;  3RIV A;  2X07 A;  4A5G A;  2Y5A A;  3VLJ A;  3R99 A;  5SW6 A;  1HSR A;  2GHD X;  5KSF A;  1SJ2 A;  4G05 A;  4XV7 A;  4NVA A;  4CZO A;  2AQD A;  5SX3 A;  3VLI A;  1AEM A;  2GGN X;  5SW5 A;  2RC2 X;  2VCN A;  4XV6 A;  2V23 A;  4XVA A;  4BLX A;  4BM1 A;  3Q3U A;  5CIH A;  3FMU A;  4PAE A;  4JQJ A;  1LYC A;  5KQH A;  5JHY A;  1CCE A;  5ABN A;  5SYX A;  4CVJ A;  5CD4 J;  4CVI A;  1AEB A;  1GZB A;  3VLM A;  5SYU A;  4USC A;  5L05 A;  1U75 A;  4JQN A;  3RIW A;  2RBV X;  4H7A A;  5EJT A;  1H57 A;  2EUT A;  5KQ3 A;  4NVK B;  1AEN A;  2B11 A;  4BM4 A;  1A2F A;  1AED A;  1H58 A;  4A71 A;  1CK6 A;  4NVD A;  4FDQ A;  4JMA A;  6ATJ A;  1ARU A;  1B82 A;  1H5E A;  1YZR A;  1ITK A;  4NVM B;  1CCG A;  1CPD A;  1CPG A;  1GZA A;  5SX2 A;  2GB8 A;  3M2F A;  1S73 A;  2AS4 A;  1STQ A;  2ANZ A;  1BVA A;  3UT2 A;  4CCP A;  2CYP A;  4NFG A;  2ZCA A;  3M5Q A;  4CZR A;  3ZCH A;  5SXR A;  2PCC A;  1AEH A;  1AEJ A;  1OAF A;  1LYK A;  1H5A A;  3M2H A;  1H5C A;  1H5K A;  5L86 A;  1ARP A;  1DSE A;  3VLK A;  1ZBY A;  4NVC A;  1ARY A;  5KQ6 A;  1U2L A;  2CEP A;  1GWU A;  1B80 A;  5SXW A;  3VLH A;  5FNE A;  2CCA A;  3CCP A;  2EUR A;  2EUQ A;  4P4Q A;  1AC8 A;  4NVI B;  4C51 A;  5ABQ A;  1MKQ A;  2WD4 A;  2EUO A;  5SYV A;  3UW8 A;  2GHK X;  4JPU A;  1DCC A;  5SYL A;  3M2E A;  5KSK A;  4FEF A;  4NVN B;  1MKR A;  1Z53 A;  1MN2 A;  5SXT A;  1CCB A;  1APX A;  5EJX A;  5SXQ A;  3RRW A;  4ATJ A;  1AEU A;  2AS1 A;  2VCS A;  1U2J A;  4JMV A;  1C8I A;  3M2C A;  5KQI A;  1OAG A;  2B0Z A;  5CID A;  2RBU X;  5JHX A;  4GED A;  4JM9 A;  4A7M A;  2VO2 X;  5CJH A;  1YYG A;  4CCX A;  3EXB A;  2VNX X;  7ATJ A;  1BEQ A;  5SW4 A;  4H79 A;  2RC0 X;  1SBM A;  4JQM A;  3FKG A;  1GX2 A;  3M2I A;  2ICV A;  4BLZ A;  1H55 A;  2B12 A;  5SX7 A;  1AEE A;  2VNZ X;  1GWO A;  1DJ1 A;  3M2B A;  1CCI A;  1BEM A;  3M2G A;  1W4W A;  1YYD A;  3FM6 A;  1ML2 A;  3X16 A;  4BLY A;  3CCX A;  2AS2 A;  3FM1 A;  1ARW A;  1BEP A;  2IA8 A;  1SOG A;  1LY8 A;  1ARV A;  4CZP A;  2CCD A;  1SDQ A;  1CPF A;  1W4Y A;  1CCC A;  4XV4 A;  3WXO A;  2XJ8 A;  2AS3 A;  4U7U B;  2YLJ A;  1BEJ A;  4JMS A;  2GHC X;  3FM4 A;  4JN0 A;  1CMQ A;  1CMU A;  1AA4 A;  2CL4 X;  1S6V A;  1MK8 A;  1JCI A;  1YZP A;  4BM0 A;  1AEO A;  1CCK A;  3ZCG A;  2X08 A;  3M25 A;  4A78 A;  1DS4 A;  4JZA A;  1QO4 A;  5SXS A;  1ZBZ A;  1IYN A;  2XJ5 A;  1DSO A;  1LGA A;  7CCP A;  1H5M A;  1AEG A;  1CCA A;  1HCH A;  2GHE X;  2EUN A;  5CIB A;  2CCP A;  2RBW X;  4NVF A;  3ZCY A;  1BES A;  4FCN A;  4XV5 A;  4BLK A;  3M27 A;  2EUP A;  1MNP A;  4BLL A;  4JMB A;  5ABO A;  1MN1 A;  3M23 A;  1RYC A;  1KRJ A;  1UB2 A;  5SX6 A;  3HDL A;  1AEK A;  1BEK A;  2GHH X;  2XI6 A;  4CZN A;  2E3B A;  5SYJ A;  3VLL A;  5SYK A;  5H9E B;  1H5G A;  2VKA A;  2XIH A;  4NVL A;  5SYI A;  4NVE A;  2EUS A;  5SYW A;  1DJ5 A;  3M8M A;  3WA8 A;  1CCJ A;  4NVJ B;  4BLN A;  1GWT A;  1SCH A;  3M2A A;  1KXN A;  1JDR A;  3M29 A;  3FJW A;  1PA2 A;  1ATJ A;  5JHZ A;  4XV8 A;  1CYF A;  4QYZ B;  2E3A A;  5CIC A;  2VCF X;  1U2K A;  4JMT A;  4A6Z A;  2JTI A;  5JQR A;  2RBY X;  2RBT X;  3M28 A;  1GW2 A;  1BJ9 A;  1CPE A;  5L02 A;  3E2O A;  4OQ7 A;  2Y6A A;  1QGJ A;  5JPR A;  5D6M A;  2EUU A;  1LY9 A;  4C50 A;  5SX1 A;  5SYH A;  4NVO B;  4NVH B;  4NVB A;  2AS6 A;  4FCS A;  1KOK A;  1V0H X;  2B10 A;  1BGP A;  5AL9 A;  4BM3 A;  1H5L A;  1KXM A;  2N18 A;  4BM2 A;  1CCL A;  5ALA A;  2RC1 X;  1H5I A;  3WNU A;  1AEV A;  3M26 A;  2XJ6 A;  2BCN A;  4JPT A;  1B85 A;  1H5D A;  1DSP A;  2Y6B A;  1DSG A;  2BOQ A;  5CIG A;  1CCP A;  5AMM A;  2E39 A;  4JM6 A;  3M2D A;  2PCB A;  4JM5 A;  5H9F B;  2XIL A;  4JMW A;  1LLP A;  4CZQ A;  2W23 A;  5KQK A;  5CIE A;  5KQ2 A;  1AES A;  1FHF A;  4JQK A;  1H5F A;  5SXX A;  6CCP A;  2ATJ A;  1AET A;  1KZM A;  3E2N A;  1QPA A;  5SX0 A;  4JM8 A;  5AOG A;  3ATJ A;  5SX0 B;  5SYY A;  5KQ0 A;  1EBE A;  1AC4 A;  4JB4 A;  4CUO A;  2XIF A;  2V2E A;  2RBX X;  4JMZ A;  3R98 A;  1ARX A;  1H5J A;  1CMP A;  1H5H A;  1U74 A;  1CMT A;  5FNB A;  5CIF A;  2YCG A;  1AEF A;  4JPL A;  5CCP A;  1A2G A;  1AEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...