5CDLA

Proline dipeptidase from deinococcus radiodurans (selenomethionine derivative)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
349
structure length
349
Chain Sequence
SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proline dipeptidase from Deinococcus radiodurans (selenomethionine derivative)
rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords Proline dipeptidase
total genus 107
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdlA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdlA02
2BHDA 2V3YA 4RZYA 3Q6DA 3CB6A 2GU7A 1QXWA 4ZWPA 4IDYA 2NQ7A 2BHAA 2GZ5A 2EA4A 1C21A 3PKDA 5CDLA 2BWSA 4U6WA 2BWWA 3L7GA 4FLJA 1PV9A 2Q93A 4IKUA 2GG3A 4U70A 2GGCA 2BWYA 4PV4A 4U75A 5FCHA 2Q95A 2BHBA 1C24A 2NQ6A 2DFIA 1JAWA 3OVKA 2MATA 2BN7A 5CDVA 4QR8A 4ZWUA 3O5VA 4EGEA 3IL0A 4Z7MA 3IG4A 1KQ0A 5JI6A 1WN1A 2BWTA 2BWVA 4S2RP 2GG8A 4MATA 2P98A 4RGZ1 4IKSA 4FO7A 2EVCA 3MX6A 5E2CA 1C23A 2ZSGA 2BB7A 1R58A 5CIKA 1WKMA 4HXXA 2HOWA 4IECA 1CHMA 4ZWOA 3IU8A 1YW9A 3BIQA 3PKEA 2BHCA 1MATA 2B3KA 4OOKA 1W2MA 1QXZA 4FUKA 2Q8KA 2B3HA 2P99A 5JHUA 1WY2A 2OKNA 4ZNGA 2BWXA 3PEBA 4FKCA 1WBQA 4IF7A 5CLSA 2GU4A 1KP0A 2GU6A 4S00A 2V3XA 3BITA 2GTXA 3IU7A 2V3ZA 1C27A 2EVOA 3TB5A 3MATA 3CB5A 4FLIA 1XGSA 2GA2A 4JUQA 1W7VA 1B6AA 4U71A 3IU9A 1XGMA 3BIPA 5JFRA 2GG9A 5CDEA 1B59A 4U73A 3FMQA 3PN9A 5E5BA 5FCFA 1XGNA 3D27A 1Y1NA 1QZYA 1YJ3A 3L24A 2B3LA 3PKAA 1YW7A 1QXYA 1WL9A 1M35A 5D6EA 4FO8A 4U69A 4U6EA 1WL6A 2GG2A 5D6FA 3PKCA 3TAVA 3MR1A 4PNCA 4B28A 4IU6A 4KM3A 3FMRA 1C22A 2GGBA 1YW8A 3S6BA 4IKRA 2ADUA 4R60A 1XGOA 4IPAA 1WLRA 2EA2A 4S01A 1A16A 1BN5A 2GG5A 2GU5A 2BWUA 2GG7A 2BH3A 1YVMA 4FLLA 4U6JA 3RORA 4U6CA 1N51A 2EVMA 3OOOA 1XNZA 2V6CA 4IKTA 4RZZA 2P9AA 2Q92A 4U6ZA 3RVAA 1R5HA 2Q94A 3QOCA 4U1BA 1KQ9A 2OAZA 4FLKA 2GG0A 3I7MA 2IW2A 1O0XA 3PKBA 4A6WA 1BOAA 4S2TP 5CE6A 4U76A 2Q96A 2G6PA 3CTZA 3FM3A 4A6VA 1R5GA 5CNXA
chains in the Genus database with same CATH superfamily
2BHDA 2V3YA 4RZYA 3Q6DA 3CB6A 2GU7A 1QXWA 4ZWPA 4IDYA 2NQ7A 2BHAA 2GZ5A 2EA4A 1C21A 3PKDA 5CDLA 2BWSA 4U6WA 2BWWA 3L7GA 4FLJA 1PV9A 2Q93A 4IKUA 2GG3A 4U70A 2GGCA 2BWYA 4PV4A 4U75A 5FCHA 2Q95A 2BHBA 1C24A 2NQ6A 2DFIA 1JAWA 3OVKA 2MATA 2BN7A 5CDVA 4QR8A 4ZWUA 3O5VA 4EGEA 3IL0A 4Z7MA 3IG4A 1KQ0A 5JI6A 1WN1A 2BWTA 2BWVA 4S2RP 2GG8A 4MATA 2P98A 4RGZ1 4IKSA 4FO7A 2EVCA 3MX6A 5E2CA 1C23A 2ZSGA 2BB7A 1R58A 5CIKA 1WKMA 4HXXA 2HOWA 4IECA 1CHMA 4ZWOA 3IU8A 1YW9A 3BIQA 3PKEA 2BHCA 1MATA 2B3KA 4OOKA 1W2MA 1QXZA 4FUKA 2Q8KA 2B3HA 2P99A 5JHUA 1WY2A 2OKNA 4ZNGA 2BWXA 3PEBA 4FKCA 1WBQA 4IF7A 5CLSA 2GU4A 1KP0A 2GU6A 4S00A 2V3XA 3BITA 2GTXA 3IU7A 2V3ZA 1C27A 2EVOA 3TB5A 3MATA 3CB5A 4FLIA 1XGSA 2GA2A 4JUQA 1W7VA 1B6AA 4U71A 3IU9A 1XGMA 3BIPA 5JFRA 2GG9A 5CDEA 1B59A 4U73A 3FMQA 3PN9A 5E5BA 5FCFA 1XGNA 3D27A 1Y1NA 1QZYA 1YJ3A 3L24A 2B3LA 3PKAA 1YW7A 1QXYA 1WL9A 1M35A 5D6EA 4FO8A 4U69A 4U6EA 1WL6A 2GG2A 5D6FA 3PKCA 3TAVA 3MR1A 4PNCA 4B28A 4IU6A 4KM3A 3FMRA 1C22A 2GGBA 1YW8A 3S6BA 4IKRA 2ADUA 4R60A 1XGOA 4IPAA 1WLRA 2EA2A 4S01A 1A16A 1BN5A 2GG5A 2GU5A 2BWUA 2GG7A 2BH3A 1YVMA 4FLLA 4U6JA 3RORA 4U6CA 1N51A 2EVMA 3OOOA 1XNZA 2V6CA 4IKTA 4RZZA 2P9AA 2Q92A 4U6ZA 3RVAA 1R5HA 2Q94A 3QOCA 4U1BA 1KQ9A 2OAZA 4FLKA 2GG0A 3I7MA 2IW2A 1O0XA 3PKBA 4A6WA 1BOAA 4S2TP 5CE6A 4U76A 2Q96A 2G6PA 3CTZA 3FM3A 4A6VA 1R5GA 5CNXA
chains in the Genus database with same CATH topology
2BHDA 2V3YA 4RZYA 3Q6DA 3CB6A 2GU7A 1QXWA 4ZWPA 4IDYA 2NQ7A 2BHAA 2GZ5A 2EA4A 1C21A 3PKDA 5CDLA 2BWSA 4U6WA 2BWWA 3L7GA 4FLJA 1PV9A 2Q93A 4IKUA 2GG3A 4U70A 2GGCA 2BWYA 4PV4A 4U75A 5FCHA 2Q95A 2BHBA 1C24A 2NQ6A 2DFIA 1JAWA 3OVKA 2MATA 2BN7A 5CDVA 4QR8A 4ZWUA 3O5VA 4EGEA 3IL0A 4Z7MA 3IG4A 1KQ0A 5JI6A 1WN1A 2BWTA 2BWVA 4S2RP 2GG8A 4MATA 2P98A 4RGZ1 4IKSA 4FO7A 2EVCA 3MX6A 5E2CA 1C23A 2ZSGA 2BB7A 1R58A 5CIKA 1WKMA 4HXXA 2HOWA 4IECA 1CHMA 4ZWOA 3IU8A 1YW9A 3BIQA 3PKEA 2BHCA 1MATA 2B3KA 4OOKA 1W2MA 1QXZA 4FUKA 2Q8KA 2B3HA 2P99A 5JHUA 1WY2A 2OKNA 4ZNGA 2BWXA 3PEBA 4FKCA 1WBQA 4IF7A 5CLSA 2GU4A 1KP0A 2GU6A 4S00A 2V3XA 3BITA 2GTXA 3IU7A 2V3ZA 1C27A 2EVOA 3TB5A 3MATA 3CB5A 4FLIA 1XGSA 2GA2A 4JUQA 1W7VA 1B6AA 4U71A 3IU9A 1XGMA 3BIPA 5JFRA 2GG9A 5CDEA 1B59A 4U73A 3FMQA 3PN9A 5E5BA 5FCFA 1XGNA 3D27A 1Y1NA 1QZYA 1YJ3A 3L24A 2B3LA 3PKAA 1YW7A 1QXYA 1WL9A 1M35A 5D6EA 4FO8A 4U69A 4U6EA 1WL6A 2GG2A 5D6FA 3PKCA 3TAVA 3MR1A 4PNCA 4B28A 4IU6A 4KM3A 3FMRA 1C22A 2GGBA 1YW8A 3S6BA 4IKRA 2ADUA 4R60A 1XGOA 4IPAA 1WLRA 2EA2A 4S01A 1A16A 1BN5A 2GG5A 2GU5A 2BWUA 2GG7A 2BH3A 1YVMA 4FLLA 4U6JA 3RORA 4U6CA 1N51A 2EVMA 3OOOA 1XNZA 2V6CA 4IKTA 4RZZA 2P9AA 2Q92A 4U6ZA 3RVAA 1R5HA 2Q94A 3QOCA 4U1BA 1KQ9A 2OAZA 4FLKA 2GG0A 3I7MA 2IW2A 1O0XA 3PKBA 4A6WA 1BOAA 4S2TP 5CE6A 4U76A 2Q96A 2G6PA 3CTZA 3FM3A 4A6VA 1R5GA 5CNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHD A;  2V3Y A;  4RZY A;  3Q6D A;  3CB6 A;  2GU7 A;  1QXW A;  4ZWP A;  4IDY A;  2NQ7 A;  2BHA A;  2GZ5 A;  2EA4 A;  1C21 A;  3PKD A;  5CDL A;  2BWS A;  4U6W A;  2BWW A;  3L7G A;  4FLJ A;  1PV9 A;  2Q93 A;  4IKU A;  2GG3 A;  4U70 A;  2GGC A;  2BWY A;  4PV4 A;  4U75 A;  5FCH A;  2Q95 A;  2BHB A;  1C24 A;  2NQ6 A;  2DFI A;  1JAW A;  3OVK A;  2MAT A;  2BN7 A;  5CDV A;  4QR8 A;  4ZWU A;  3O5V A;  4EGE A;  3IL0 A;  4Z7M A;  3IG4 A;  1KQ0 A;  5JI6 A;  1WN1 A;  2BWT A;  2BWV A;  4S2R P;  2GG8 A;  4MAT A;  2P98 A;  4RGZ 1;  4IKS A;  4FO7 A;  2EVC A;  3MX6 A;  5E2C A;  1C23 A;  2ZSG A;  2BB7 A;  1R58 A;  5CIK A;  1WKM A;  4HXX A;  2HOW A;  4IEC A;  1CHM A;  4ZWO A;  3IU8 A;  1YW9 A;  3BIQ A;  3PKE A;  2BHC A;  1MAT A;  2B3K A;  4OOK A;  1W2M A;  1QXZ A;  4FUK A;  2Q8K A;  2B3H A;  2P99 A;  5JHU A;  1WY2 A;  2OKN A;  4ZNG A;  2BWX A;  3PEB A;  4FKC A;  1WBQ A;  4IF7 A;  5CLS A;  2GU4 A;  1KP0 A;  2GU6 A;  4S00 A;  2V3X A;  3BIT A;  2GTX A;  3IU7 A;  2V3Z A;  1C27 A;  2EVO A;  3TB5 A;  3MAT A;  3CB5 A;  4FLI A;  1XGS A;  2GA2 A;  4JUQ A;  1W7V A;  1B6A A;  4U71 A;  3IU9 A;  1XGM A;  3BIP A;  5JFR A;  2GG9 A;  5CDE A;  1B59 A;  4U73 A;  3FMQ A;  3PN9 A;  5E5B A;  5FCF A;  1XGN A;  3D27 A;  1Y1N A;  1QZY A;  1YJ3 A;  3L24 A;  2B3L A;  3PKA A;  1YW7 A;  1QXY A;  1WL9 A;  1M35 A;  5D6E A;  4FO8 A;  4U69 A;  4U6E A;  1WL6 A;  2GG2 A;  5D6F A;  3PKC A;  3TAV A;  3MR1 A;  4PNC A;  4B28 A;  4IU6 A;  4KM3 A;  3FMR A;  1C22 A;  2GGB A;  1YW8 A;  3S6B A;  4IKR A;  2ADU A;  4R60 A;  1XGO A;  4IPA A;  1WLR A;  2EA2 A;  4S01 A;  1A16 A;  1BN5 A;  2GG5 A;  2GU5 A;  2BWU A;  2GG7 A;  2BH3 A;  1YVM A;  4FLL A;  4U6J A;  3ROR A;  4U6C A;  1N51 A;  2EVM A;  3OOO A;  1XNZ A;  2V6C A;  4IKT A;  4RZZ A;  2P9A A;  2Q92 A;  4U6Z A;  3RVA A;  1R5H A;  2Q94 A;  3QOC A;  4U1B A;  1KQ9 A;  2OAZ A;  4FLK A;  2GG0 A;  3I7M A;  2IW2 A;  1O0X A;  3PKB A;  4A6W A;  1BOA A;  4S2T P;  5CE6 A;  4U76 A;  2Q96 A;  2G6P A;  3CTZ A;  3FM3 A;  4A6V A;  1R5G A;  5CNX A; 
#chains in the Genus database with same CATH topology
 2BHD A;  2V3Y A;  4RZY A;  3Q6D A;  3CB6 A;  2GU7 A;  1QXW A;  4ZWP A;  4IDY A;  2NQ7 A;  2BHA A;  2GZ5 A;  2EA4 A;  1C21 A;  3PKD A;  5CDL A;  2BWS A;  4U6W A;  2BWW A;  3L7G A;  4FLJ A;  1PV9 A;  2Q93 A;  4IKU A;  2GG3 A;  4U70 A;  2GGC A;  2BWY A;  4PV4 A;  4U75 A;  5FCH A;  2Q95 A;  2BHB A;  1C24 A;  2NQ6 A;  2DFI A;  1JAW A;  3OVK A;  2MAT A;  2BN7 A;  5CDV A;  4QR8 A;  4ZWU A;  3O5V A;  4EGE A;  3IL0 A;  4Z7M A;  3IG4 A;  1KQ0 A;  5JI6 A;  1WN1 A;  2BWT A;  2BWV A;  4S2R P;  2GG8 A;  4MAT A;  2P98 A;  4RGZ 1;  4IKS A;  4FO7 A;  2EVC A;  3MX6 A;  5E2C A;  1C23 A;  2ZSG A;  2BB7 A;  1R58 A;  5CIK A;  1WKM A;  4HXX A;  2HOW A;  4IEC A;  1CHM A;  4ZWO A;  3IU8 A;  1YW9 A;  3BIQ A;  3PKE A;  2BHC A;  1MAT A;  2B3K A;  4OOK A;  1W2M A;  1QXZ A;  4FUK A;  2Q8K A;  2B3H A;  2P99 A;  5JHU A;  1WY2 A;  2OKN A;  4ZNG A;  2BWX A;  3PEB A;  4FKC A;  1WBQ A;  4IF7 A;  5CLS A;  2GU4 A;  1KP0 A;  2GU6 A;  4S00 A;  2V3X A;  3BIT A;  2GTX A;  3IU7 A;  2V3Z A;  1C27 A;  2EVO A;  3TB5 A;  3MAT A;  3CB5 A;  4FLI A;  1XGS A;  2GA2 A;  4JUQ A;  1W7V A;  1B6A A;  4U71 A;  3IU9 A;  1XGM A;  3BIP A;  5JFR A;  2GG9 A;  5CDE A;  1B59 A;  4U73 A;  3FMQ A;  3PN9 A;  5E5B A;  5FCF A;  1XGN A;  3D27 A;  1Y1N A;  1QZY A;  1YJ3 A;  3L24 A;  2B3L A;  3PKA A;  1YW7 A;  1QXY A;  1WL9 A;  1M35 A;  5D6E A;  4FO8 A;  4U69 A;  4U6E A;  1WL6 A;  2GG2 A;  5D6F A;  3PKC A;  3TAV A;  3MR1 A;  4PNC A;  4B28 A;  4IU6 A;  4KM3 A;  3FMR A;  1C22 A;  2GGB A;  1YW8 A;  3S6B A;  4IKR A;  2ADU A;  4R60 A;  1XGO A;  4IPA A;  1WLR A;  2EA2 A;  4S01 A;  1A16 A;  1BN5 A;  2GG5 A;  2GU5 A;  2BWU A;  2GG7 A;  2BH3 A;  1YVM A;  4FLL A;  4U6J A;  3ROR A;  4U6C A;  1N51 A;  2EVM A;  3OOO A;  1XNZ A;  2V6C A;  4IKT A;  4RZZ A;  2P9A A;  2Q92 A;  4U6Z A;  3RVA A;  1R5H A;  2Q94 A;  3QOC A;  4U1B A;  1KQ9 A;  2OAZ A;  4FLK A;  2GG0 A;  3I7M A;  2IW2 A;  1O0X A;  3PKB A;  4A6W A;  1BOA A;  4S2T P;  5CE6 A;  4U76 A;  2Q96 A;  2G6P A;  3CTZ A;  3FM3 A;  4A6V A;  1R5G A;  5CNX A; 
#chains in the Genus database with same CATH homology
 2BHD A;  2V3Y A;  4RZY A;  3Q6D A;  3CB6 A;  2GU7 A;  1QXW A;  4ZWP A;  4IDY A;  2NQ7 A;  2BHA A;  2GZ5 A;  2EA4 A;  1C21 A;  3PKD A;  5CDL A;  2BWS A;  4U6W A;  2BWW A;  3L7G A;  4FLJ A;  1PV9 A;  2Q93 A;  4IKU A;  2GG3 A;  4U70 A;  2GGC A;  2BWY A;  4PV4 A;  4U75 A;  5FCH A;  2Q95 A;  2BHB A;  1C24 A;  2NQ6 A;  2DFI A;  1JAW A;  3OVK A;  2MAT A;  2BN7 A;  5CDV A;  4QR8 A;  4ZWU A;  3O5V A;  4EGE A;  3IL0 A;  4Z7M A;  3IG4 A;  1KQ0 A;  5JI6 A;  1WN1 A;  2BWT A;  2BWV A;  4S2R P;  2GG8 A;  4MAT A;  2P98 A;  4RGZ 1;  4IKS A;  4FO7 A;  2EVC A;  3MX6 A;  5E2C A;  1C23 A;  2ZSG A;  2BB7 A;  1R58 A;  5CIK A;  1WKM A;  4HXX A;  2HOW A;  4IEC A;  1CHM A;  4ZWO A;  3IU8 A;  1YW9 A;  3BIQ A;  3PKE A;  2BHC A;  1MAT A;  2B3K A;  4OOK A;  1W2M A;  1QXZ A;  4FUK A;  2Q8K A;  2B3H A;  2P99 A;  5JHU A;  1WY2 A;  2OKN A;  4ZNG A;  2BWX A;  3PEB A;  4FKC A;  1WBQ A;  4IF7 A;  5CLS A;  2GU4 A;  1KP0 A;  2GU6 A;  4S00 A;  2V3X A;  3BIT A;  2GTX A;  3IU7 A;  2V3Z A;  1C27 A;  2EVO A;  3TB5 A;  3MAT A;  3CB5 A;  4FLI A;  1XGS A;  2GA2 A;  4JUQ A;  1W7V A;  1B6A A;  4U71 A;  3IU9 A;  1XGM A;  3BIP A;  5JFR A;  2GG9 A;  5CDE A;  1B59 A;  4U73 A;  3FMQ A;  3PN9 A;  5E5B A;  5FCF A;  1XGN A;  3D27 A;  1Y1N A;  1QZY A;  1YJ3 A;  3L24 A;  2B3L A;  3PKA A;  1YW7 A;  1QXY A;  1WL9 A;  1M35 A;  5D6E A;  4FO8 A;  4U69 A;  4U6E A;  1WL6 A;  2GG2 A;  5D6F A;  3PKC A;  3TAV A;  3MR1 A;  4PNC A;  4B28 A;  4IU6 A;  4KM3 A;  3FMR A;  1C22 A;  2GGB A;  1YW8 A;  3S6B A;  4IKR A;  2ADU A;  4R60 A;  1XGO A;  4IPA A;  1WLR A;  2EA2 A;  4S01 A;  1A16 A;  1BN5 A;  2GG5 A;  2GU5 A;  2BWU A;  2GG7 A;  2BH3 A;  1YVM A;  4FLL A;  4U6J A;  3ROR A;  4U6C A;  1N51 A;  2EVM A;  3OOO A;  1XNZ A;  2V6C A;  4IKT A;  4RZZ A;  2P9A A;  2Q92 A;  4U6Z A;  3RVA A;  1R5H A;  2Q94 A;  3QOC A;  4U1B A;  1KQ9 A;  2OAZ A;  4FLK A;  2GG0 A;  3I7M A;  2IW2 A;  1O0X A;  3PKB A;  4A6W A;  1BOA A;  4S2T P;  5CE6 A;  4U76 A;  2Q96 A;  2G6P A;  3CTZ A;  3FM3 A;  4A6V A;  1R5G A;  5CNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...