5CDWA

Crystal structure analysis of a mutant grb2 sh2 domain (w121g) with a pyvnv peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
98
structure length
98
Chain Sequence
KPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLGVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biophysical investigation of the interaction of a mutant Grb2 SH2 domain (W121G) with its cognate phosphopeptide.
pubmed doi rcsb
molecule keywords Growth factor receptor-bound protein 2
molecule tags Signaling protein
source organism Homo sapiens
total genus 16
structure length 98
sequence length 98
chains with identical sequence B, C, E, G, H, K, L, O, P, U, V, Y, Z, c, d
ec nomenclature
pdb deposition date 2015-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00017 SH2 SH2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.505.10 Alpha Beta 2-Layer Sandwich SHC Adaptor Protein SH2 domain 5cdwA00
1BFJA 3PQZA 2ETZA 2MRJA 2K7AB 3VS7A 2LCTA 1H9OA 1UURA 3MXCA 4GPLB 3CD3A 5IBSA 2CBLA 3VS1A 5DC0B 1GRIA 3M7FA 1CSZA 1A1BA 1YVHA 2OZOA 2CRHA 3VS5A 3ZNIA 1ZFPE 1OPKA 1XA6A 1D4WA 2RSYA 1A1CA 3UF4A 5IBMA 1BF5A 4U1PA 1O4EA 1LUIA 1FHSA 2MC1A 4H1OA 2YU7A 2CI9A 2EYZA 2YSXA 2ABLA 1AYDA 5EHPA 4E68A 2SHPA 3OB2B 4FBNA 2AUGA 2PNBA 2KNOA 1O4DA 5AULA 4OHDA 1P13A 2HCKA 1SPRA 4A4BA 3N8MA 4X6SA 3OV1A 3VRYA 2K79B 3VRZA 2L3TA 2DLZA 1O42A 3VRNA 2HDVA 2DVJA 4D8KA 3PS5A 2Y1MA 1O45A 1NZLA 4P9VA 1I3ZA 4A4CA 2HUWA 1A1EA 1LUMA 2DM0A 4GL9E 1O4GA 1BKLA 2IUHA 4E93A 1O4KA 3QWXX 4K44A 1O4RA 1BLJA 1SKJA 4NWGA 1KC2A 1QG1E 2DLYA 2HDXA 1IJRA 1KSWA 1TCEA 2H46E 2AOAA 1O41A 1BKMA 2CIAA 1O4CA 1BHHA 4OHIA 2LQNA 5HKZA 1X6CA 1M61A 1O4NA 2L4KA 4F59A 2FO0A 1A81A 1A08A 5I6VA 1BM2A 2KK6A 1OPLA 1IS0A 1SHAA 1BFIA 1O4AA 2EO6A 4EIHA 3BUNB 1NRVA 1O4QA 4F5BA 4OHEA 1LKKA 2JYQA 2B3OA 1JYUA 1O47A 3VROA 1O44A 3CXLA 3OP0A 1F1WA 2EU0A 4NWFA 2IZVA 3TL0A 5EG3B 4FL3A 3IMDA 1CWDL 5CDWA 3MAZA 5DC9A 3EACA 4L1BB 1GHUA 2L6KA 5GJIA 1OO4A 2MQIA 3VGOA 3US4A 3HHMB 1JU5A 1KA6A 1X27A 1AYBA 2PTKA 1BHHB 4U17A 1BHFA 4XZ1A 5KAZA 3BUMB 3S8LA 2RMXA 2RVFA 5GJHA 1FYRA 2H5KA 2QMSA 1O43A 1K9AA 3N84A 2H8HA 3NHNA 4P9ZA 1O4LA 1AOUF 2C0OA 5BO4A 2VIFA 3K2MA 1AOTF 1LCKA 1FU6A 3BUWB 5AXIA 5EELA 3PSJA 1KA7A 2MK2A 1O4OA 4TZIA 1AD5A 5EEQA 2LNXA 1BLKA 1HCSB 3BKBA 2CI8A 1MW4A 3EAZA 3VS2A 4K2RA 2DX0A 1F2FA 2PNAA 3VS3A 1SPSA 1LCJA 3IN7A 1X0NA 3KFJA 3PJPA 5DC4A 4JGHA 2EKXA 3MXYA 1CWEA 1O4IA 1PICA 1B47A 2BBUA 1D4TA 3GQIB 1O4HA 1O49A 1AYAA 5J3XA 1G83A 1JYQA 4H34A 3PLFB 1O4BA 2OQ1A 1QCFA 2EOBA 4FL2A 2LQWA 3BUOB 4WWQA 1FBVA 1O46A 4EY0A 1CSYA 2EYYA 5D0JA 2C0IA 3VS0A 3CWGA 5HKWA 4M4ZA 1R1PA 3VS4A 1RPYA 1O4MA 3HIZB 4DGPA 2ECDA 1NZVA 4ROJA 1HCTB 1Y1UA 1O4JA 4K45A 1LKLA 1O4FA 1BG1A 1BMBA 1FBZA 2LNWA 2FCIA 2CR4A 4GWFA 1O4PA 4QSYA 3GXWA 2EL8A 2Y1NA 3VRPA 1Y57A 1Z3KA 2IUGA 1LUKA 2IUIA 5DF6A 1UUSA 2XP1A 1RJAA 2HMHA 2CS0A 2Y3AB 4OHLA 2EO3A 3IN8A 1A07A 2EYVA 2GSBA 3N7YA 3C7IA 3QWYA 1MILA 1O48A 1AB2A 3S9KA 3VRQA 1QADA 1CJ1A 3T04A 4LUDA 3TKZA 3PSKA 2RORA 3HCKA 1OO3A 1SHDA 4JE4A 4F5AA 5HKYA 2C0TA 1R1SA 1M27A 1D1ZA 1JYRA 1RQQC 3S8NA 3BUXB 1FMKA 2GE9A 1R1QA 1YVLA 5EHRA 1A09A 1WQUA 3GXXA 3VRRA 2SRCA 4XZ0A 2PLEA 1AYCA 1FU5A 1TZEE 3S8OA 2AOBA 3OB1B 2MRKA 2C9WA 4OHHA 3IMJA 1A1AA 3PFVA 3UYOA 1SHBA 2PLDA 3CBLA 3OVEA 1LUNA 3VS6A 4JEGA 4K11A 2DCRA 4DGXA 1JWOA 4LUEA 3WA4A
chains in the Genus database with same CATH superfamily
1BFJA 3PQZA 2ETZA 2MRJA 2K7AB 3VS7A 2LCTA 1H9OA 1UURA 3MXCA 4GPLB 3CD3A 5IBSA 2CBLA 3VS1A 5DC0B 1GRIA 3M7FA 1CSZA 1A1BA 1YVHA 2OZOA 2CRHA 3VS5A 3ZNIA 1ZFPE 1OPKA 1XA6A 1D4WA 2RSYA 1A1CA 3UF4A 5IBMA 1BF5A 4U1PA 1O4EA 1LUIA 1FHSA 2MC1A 4H1OA 2YU7A 2CI9A 2EYZA 2YSXA 2ABLA 1AYDA 5EHPA 4E68A 2SHPA 3OB2B 4FBNA 2AUGA 2PNBA 2KNOA 1O4DA 5AULA 4OHDA 1P13A 2HCKA 1SPRA 4A4BA 3N8MA 4X6SA 3OV1A 3VRYA 2K79B 3VRZA 2L3TA 2DLZA 1O42A 3VRNA 2HDVA 2DVJA 4D8KA 3PS5A 2Y1MA 1O45A 1NZLA 4P9VA 1I3ZA 4A4CA 2HUWA 1A1EA 1LUMA 2DM0A 4GL9E 1O4GA 1BKLA 2IUHA 4E93A 1O4KA 3QWXX 4K44A 1O4RA 1BLJA 1SKJA 4NWGA 1KC2A 1QG1E 2DLYA 2HDXA 1IJRA 1KSWA 1TCEA 2H46E 2AOAA 1O41A 1BKMA 2CIAA 1O4CA 1BHHA 4OHIA 2LQNA 5HKZA 1X6CA 1M61A 1O4NA 2L4KA 4F59A 2FO0A 1A81A 1A08A 5I6VA 1BM2A 2KK6A 1OPLA 1IS0A 1SHAA 1BFIA 1O4AA 2EO6A 4EIHA 3BUNB 1NRVA 1O4QA 4F5BA 4OHEA 1LKKA 2JYQA 2B3OA 1JYUA 1O47A 3VROA 1O44A 3CXLA 3OP0A 1F1WA 2EU0A 4NWFA 2IZVA 3TL0A 5EG3B 4FL3A 3IMDA 1CWDL 5CDWA 3MAZA 5DC9A 3EACA 4L1BB 1GHUA 2L6KA 5GJIA 2KGYA 1OO4A 2MQIA 3VGOA 3US4A 3HHMB 1JU5A 1KA6A 1X27A 1AYBA 2PTKA 1BHHB 4U17A 1BHFA 4XZ1A 5KAZA 3BUMB 3S8LA 2RMXA 2RVFA 5GJHA 1FYRA 2H5KA 2QMSA 1O43A 1K9AA 3N84A 2H8HA 3NHNA 4P9ZA 1O4LA 1AOUF 2C0OA 5BO4A 2VIFA 3K2MA 1AOTF 1LCKA 1FU6A 3BUWB 5AXIA 5EELA 3PSJA 1KA7A 2MK2A 1O4OA 4TZIA 1AD5A 5EEQA 2LNXA 1BLKA 1HCSB 3BKBA 2CI8A 1MW4A 3EAZA 3VS2A 4K2RA 2DX0A 1F2FA 2PNAA 3VS3A 1SPSA 1LCJA 3IN7A 1X0NA 3LYVA 3KFJA 3PJPA 5DC4A 4JGHA 2EKXA 3MXYA 1CWEA 1O4IA 1PICA 1B47A 2BBUA 1D4TA 3GQIB 1O4HA 1O49A 1AYAA 5J3XA 3K2TA 1G83A 1JYQA 4H34A 3PLFB 1O4BA 2OQ1A 1QCFA 2EOBA 4FL2A 2LQWA 3BUOB 4WWQA 1FBVA 1O46A 4EY0A 1CSYA 2EYYA 5D0JA 2C0IA 3VS0A 3CWGA 5HKWA 4M4ZA 1R1PA 3VS4A 1RPYA 1O4MA 3HIZB 4DGPA 2ECDA 1NZVA 4ROJA 1HCTB 1Y1UA 1O4JA 4K45A 1LKLA 1O4FA 1BG1A 1BMBA 1FBZA 2LNWA 2FCIA 2CR4A 4GWFA 1O4PA 4QSYA 3GXWA 2EL8A 2Y1NA 3VRPA 1Y57A 1Z3KA 2IUGA 1LUKA 2IUIA 5DF6A 1UUSA 2XP1A 1RJAA 2HMHA 2CS0A 2Y3AB 4OHLA 2EO3A 3IN8A 1A07A 2EYVA 2GSBA 3N7YA 3C7IA 3QWYA 1MILA 1O48A 1AB2A 3S9KA 3VRQA 1QADA 1CJ1A 3T04A 4LUDA 3TKZA 3PSKA 2RORA 3HCKA 1OO3A 1SHDA 4JE4A 4F5AA 5HKYA 2C0TA 1R1SA 1M27A 1D1ZA 1JYRA 1RQQC 3S8NA 3BUXB 1FMKA 2GE9A 1R1QA 1YVLA 5EHRA 1A09A 1WQUA 3GXXA 3VRRA 2SRCA 4XZ0A 2PLEA 1AYCA 1FU5A 1TZEE 3S8OA 2AOBA 3OB1B 2MRKA 2C9WA 4OHHA 3IMJA 1A1AA 3PFVA 3UYOA 1SHBA 2PLDA 3CBLA 3OVEA 1LUNA 3VS6A 4JEGA 4K11A 2LRAA 2DCRA 4DGXA 1JWOA 4LUEA 3WA4A
chains in the Genus database with same CATH topology
1BFJA 3PQZA 2ETZA 2MRJA 2K7AB 3VS7A 2LCTA 1H9OA 1UURA 3MXCA 4GPLB 3CD3A 5IBSA 2CBLA 3VS1A 5DC0B 1GRIA 3M7FA 1CSZA 1A1BA 1YVHA 2OZOA 2CRHA 3VS5A 3ZNIA 1ZFPE 1OPKA 1XA6A 1D4WA 2RSYA 1A1CA 3UF4A 5IBMA 1BF5A 4U1PA 1O4EA 1LUIA 1FHSA 2MC1A 4H1OA 2YU7A 2CI9A 2EYZA 2YSXA 2ABLA 1AYDA 5EHPA 4E68A 2SHPA 3OB2B 4FBNA 2AUGA 2PNBA 2KNOA 1O4DA 5AULA 4OHDA 1P13A 2HCKA 1SPRA 4A4BA 3N8MA 4X6SA 3OV1A 3VRYA 2K79B 3VRZA 2L3TA 2DLZA 1O42A 3VRNA 2HDVA 2DVJA 4D8KA 3PS5A 2Y1MA 1O45A 1NZLA 4P9VA 1I3ZA 4A4CA 2HUWA 1A1EA 1LUMA 2DM0A 4GL9E 1O4GA 1BKLA 2IUHA 4E93A 1O4KA 3QWXX 4K44A 1O4RA 1BLJA 1SKJA 4NWGA 1KC2A 1QG1E 2DLYA 2HDXA 1IJRA 1KSWA 1TCEA 2H46E 2AOAA 1O41A 1BKMA 2CIAA 1O4CA 1BHHA 4OHIA 2LQNA 5HKZA 1X6CA 1M61A 1O4NA 2L4KA 4F59A 2FO0A 1A81A 1A08A 5I6VA 1BM2A 2KK6A 1OPLA 1IS0A 1SHAA 1BFIA 1O4AA 2EO6A 4EIHA 3BUNB 1NRVA 1O4QA 4F5BA 4OHEA 1LKKA 2JYQA 2B3OA 1JYUA 1O47A 3VROA 1O44A 3CXLA 3OP0A 1F1WA 2EU0A 4NWFA 2IZVA 3TL0A 5EG3B 4FL3A 3IMDA 1CWDL 5CDWA 3MAZA 5DC9A 3EACA 4L1BB 1GHUA 2L6KA 5GJIA 1OO4A 2MQIA 3VGOA 3US4A 3HHMB 1JU5A 1KA6A 1X27A 1AYBA 2PTKA 1BHHB 4U17A 1BHFA 4XZ1A 5KAZA 3BUMB 3S8LA 2RMXA 2RVFA 5GJHA 1FYRA 2H5KA 2QMSA 1O43A 1K9AA 3N84A 2H8HA 3NHNA 4P9ZA 1O4LA 1AOUF 2C0OA 5BO4A 2VIFA 3K2MA 1AOTF 1LCKA 1FU6A 3BUWB 5AXIA 5EELA 3PSJA 1KA7A 2MK2A 1O4OA 4TZIA 1AD5A 5EEQA 2LNXA 1BLKA 1HCSB 3BKBA 2CI8A 1MW4A 3EAZA 3VS2A 4K2RA 2DX0A 1F2FA 2PNAA 3VS3A 1SPSA 1LCJA 3IN7A 1X0NA 3KFJA 3PJPA 5DC4A 4JGHA 2EKXA 3MXYA 1CWEA 1O4IA 1PICA 1B47A 2BBUA 1D4TA 3GQIB 1O4HA 1O49A 1AYAA 5J3XA 1G83A 1JYQA 4H34A 3PLFB 1O4BA 2OQ1A 1QCFA 2EOBA 4FL2A 2LQWA 3BUOB 4WWQA 1FBVA 1O46A 4EY0A 1CSYA 2EYYA 5D0JA 2C0IA 3VS0A 3CWGA 5HKWA 4M4ZA 1R1PA 3VS4A 1RPYA 1O4MA 3HIZB 4DGPA 2ECDA 1NZVA 4ROJA 1HCTB 1Y1UA 1O4JA 4K45A 1LKLA 1O4FA 1BG1A 1BMBA 1FBZA 2LNWA 2FCIA 2CR4A 4GWFA 1O4PA 4QSYA 3GXWA 2EL8A 2Y1NA 3VRPA 1Y57A 1Z3KA 2IUGA 1LUKA 2IUIA 5DF6A 1UUSA 2XP1A 1RJAA 2HMHA 2CS0A 2Y3AB 4OHLA 2EO3A 3IN8A 1A07A 2EYVA 2GSBA 3N7YA 3C7IA 3QWYA 1MILA 1O48A 1AB2A 3S9KA 3VRQA 1QADA 1CJ1A 3T04A 4LUDA 3TKZA 3PSKA 2RORA 3HCKA 1OO3A 1SHDA 4JE4A 4F5AA 5HKYA 2C0TA 1R1SA 1M27A 1D1ZA 1JYRA 1RQQC 3S8NA 3BUXB 1FMKA 2GE9A 1R1QA 1YVLA 5EHRA 1A09A 1WQUA 3GXXA 3VRRA 2SRCA 4XZ0A 2PLEA 1AYCA 1FU5A 1TZEE 3S8OA 2AOBA 3OB1B 2MRKA 2C9WA 4OHHA 3IMJA 1A1AA 3PFVA 3UYOA 1SHBA 2PLDA 3CBLA 3OVEA 1LUNA 3VS6A 4JEGA 4K11A 2DCRA 4DGXA 1JWOA 4LUEA 3WA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BFJ A;  3PQZ A;  2ETZ A;  2MRJ A;  2K7A B;  3VS7 A;  2LCT A;  1H9O A;  1UUR A;  3MXC A;  4GPL B;  3CD3 A;  5IBS A;  2CBL A;  3VS1 A;  5DC0 B;  1GRI A;  3M7F A;  1CSZ A;  1A1B A;  1YVH A;  2OZO A;  2CRH A;  3VS5 A;  3ZNI A;  1ZFP E;  1OPK A;  1XA6 A;  1D4W A;  2RSY A;  1A1C A;  3UF4 A;  5IBM A;  1BF5 A;  4U1P A;  1O4E A;  1LUI A;  1FHS A;  2MC1 A;  4H1O A;  2YU7 A;  2CI9 A;  2EYZ A;  2YSX A;  2ABL A;  1AYD A;  5EHP A;  4E68 A;  2SHP A;  3OB2 B;  4FBN A;  2AUG A;  2PNB A;  2KNO A;  1O4D A;  5AUL A;  4OHD A;  1P13 A;  2HCK A;  1SPR A;  4A4B A;  3N8M A;  4X6S A;  3OV1 A;  3VRY A;  2K79 B;  3VRZ A;  2L3T A;  2DLZ A;  1O42 A;  3VRN A;  2HDV A;  2DVJ A;  4D8K A;  3PS5 A;  2Y1M A;  1O45 A;  1NZL A;  4P9V A;  1I3Z A;  4A4C A;  2HUW A;  1A1E A;  1LUM A;  2DM0 A;  4GL9 E;  1O4G A;  1BKL A;  2IUH A;  4E93 A;  1O4K A;  3QWX X;  4K44 A;  1O4R A;  1BLJ A;  1SKJ A;  4NWG A;  1KC2 A;  1QG1 E;  2DLY A;  2HDX A;  1IJR A;  1KSW A;  1TCE A;  2H46 E;  2AOA A;  1O41 A;  1BKM A;  2CIA A;  1O4C A;  1BHH A;  4OHI A;  2LQN A;  5HKZ A;  1X6C A;  1M61 A;  1O4N A;  2L4K A;  4F59 A;  2FO0 A;  1A81 A;  1A08 A;  5I6V A;  1BM2 A;  2KK6 A;  1OPL A;  1IS0 A;  1SHA A;  1BFI A;  1O4A A;  2EO6 A;  4EIH A;  3BUN B;  1NRV A;  1O4Q A;  4F5B A;  4OHE A;  1LKK A;  2JYQ A;  2B3O A;  1JYU A;  1O47 A;  3VRO A;  1O44 A;  3CXL A;  3OP0 A;  1F1W A;  2EU0 A;  4NWF A;  2IZV A;  3TL0 A;  5EG3 B;  4FL3 A;  3IMD A;  1CWD L;  5CDW A;  3MAZ A;  5DC9 A;  3EAC A;  4L1B B;  1GHU A;  2L6K A;  5GJI A;  1OO4 A;  2MQI A;  3VGO A;  3US4 A;  3HHM B;  1JU5 A;  1KA6 A;  1X27 A;  1AYB A;  2PTK A;  1BHH B;  4U17 A;  1BHF A;  4XZ1 A;  5KAZ A;  3BUM B;  3S8L A;  2RMX A;  2RVF A;  5GJH A;  1FYR A;  2H5K A;  2QMS A;  1O43 A;  1K9A A;  3N84 A;  2H8H A;  3NHN A;  4P9Z A;  1O4L A;  1AOU F;  2C0O A;  5BO4 A;  2VIF A;  3K2M A;  1AOT F;  1LCK A;  1FU6 A;  3BUW B;  5AXI A;  5EEL A;  3PSJ A;  1KA7 A;  2MK2 A;  1O4O A;  4TZI A;  1AD5 A;  5EEQ A;  2LNX A;  1BLK A;  1HCS B;  3BKB A;  2CI8 A;  1MW4 A;  3EAZ A;  3VS2 A;  4K2R A;  2DX0 A;  1F2F A;  2PNA A;  3VS3 A;  1SPS A;  1LCJ A;  3IN7 A;  1X0N A;  3KFJ A;  3PJP A;  5DC4 A;  4JGH A;  2EKX A;  3MXY A;  1CWE A;  1O4I A;  1PIC A;  1B47 A;  2BBU A;  1D4T A;  3GQI B;  1O4H A;  1O49 A;  1AYA A;  5J3X A;  1G83 A;  1JYQ A;  4H34 A;  3PLF B;  1O4B A;  2OQ1 A;  1QCF A;  2EOB A;  4FL2 A;  2LQW A;  3BUO B;  4WWQ A;  1FBV A;  1O46 A;  4EY0 A;  1CSY A;  2EYY A;  5D0J A;  2C0I A;  3VS0 A;  3CWG A;  5HKW A;  4M4Z A;  1R1P A;  3VS4 A;  1RPY A;  1O4M A;  3HIZ B;  4DGP A;  2ECD A;  1NZV A;  4ROJ A;  1HCT B;  1Y1U A;  1O4J A;  4K45 A;  1LKL A;  1O4F A;  1BG1 A;  1BMB A;  1FBZ A;  2LNW A;  2FCI A;  2CR4 A;  4GWF A;  1O4P A;  4QSY A;  3GXW A;  2EL8 A;  2Y1N A;  3VRP A;  1Y57 A;  1Z3K A;  2IUG A;  1LUK A;  2IUI A;  5DF6 A;  1UUS A;  2XP1 A;  1RJA A;  2HMH A;  2CS0 A;  2Y3A B;  4OHL A;  2EO3 A;  3IN8 A;  1A07 A;  2EYV A;  2GSB A;  3N7Y A;  3C7I A;  3QWY A;  1MIL A;  1O48 A;  1AB2 A;  3S9K A;  3VRQ A;  1QAD A;  1CJ1 A;  3T04 A;  4LUD A;  3TKZ A;  3PSK A;  2ROR A;  3HCK A;  1OO3 A;  1SHD A;  4JE4 A;  4F5A A;  5HKY A;  2C0T A;  1R1S A;  1M27 A;  1D1Z A;  1JYR A;  1RQQ C;  3S8N A;  3BUX B;  1FMK A;  2GE9 A;  1R1Q A;  1YVL A;  5EHR A;  1A09 A;  1WQU A;  3GXX A;  3VRR A;  2SRC A;  4XZ0 A;  2PLE A;  1AYC A;  1FU5 A;  1TZE E;  3S8O A;  2AOB A;  3OB1 B;  2MRK A;  2C9W A;  4OHH A;  3IMJ A;  1A1A A;  3PFV A;  3UYO A;  1SHB A;  2PLD A;  3CBL A;  3OVE A;  1LUN A;  3VS6 A;  4JEG A;  4K11 A;  2DCR A;  4DGX A;  1JWO A;  4LUE A;  3WA4 A; 
#chains in the Genus database with same CATH topology
 1BFJ A;  3PQZ A;  2ETZ A;  2MRJ A;  2K7A B;  3VS7 A;  2LCT A;  1H9O A;  1UUR A;  3MXC A;  4GPL B;  3CD3 A;  5IBS A;  2CBL A;  3VS1 A;  5DC0 B;  1GRI A;  3M7F A;  1CSZ A;  1A1B A;  1YVH A;  2OZO A;  2CRH A;  3VS5 A;  3ZNI A;  1ZFP E;  1OPK A;  1XA6 A;  1D4W A;  2RSY A;  1A1C A;  3UF4 A;  5IBM A;  1BF5 A;  4U1P A;  1O4E A;  1LUI A;  1FHS A;  2MC1 A;  4H1O A;  2YU7 A;  2CI9 A;  2EYZ A;  2YSX A;  2ABL A;  1AYD A;  5EHP A;  4E68 A;  2SHP A;  3OB2 B;  4FBN A;  2AUG A;  2PNB A;  2KNO A;  1O4D A;  5AUL A;  4OHD A;  1P13 A;  2HCK A;  1SPR A;  4A4B A;  3N8M A;  4X6S A;  3OV1 A;  3VRY A;  2K79 B;  3VRZ A;  2L3T A;  2DLZ A;  1O42 A;  3VRN A;  2HDV A;  2DVJ A;  4D8K A;  3PS5 A;  2Y1M A;  1O45 A;  1NZL A;  4P9V A;  1I3Z A;  4A4C A;  2HUW A;  1A1E A;  1LUM A;  2DM0 A;  4GL9 E;  1O4G A;  1BKL A;  2IUH A;  4E93 A;  1O4K A;  3QWX X;  4K44 A;  1O4R A;  1BLJ A;  1SKJ A;  4NWG A;  1KC2 A;  1QG1 E;  2DLY A;  2HDX A;  1IJR A;  1KSW A;  1TCE A;  2H46 E;  2AOA A;  1O41 A;  1BKM A;  2CIA A;  1O4C A;  1BHH A;  4OHI A;  2LQN A;  5HKZ A;  1X6C A;  1M61 A;  1O4N A;  2L4K A;  4F59 A;  2FO0 A;  1A81 A;  1A08 A;  5I6V A;  1BM2 A;  2KK6 A;  1OPL A;  1IS0 A;  1SHA A;  1BFI A;  1O4A A;  2EO6 A;  4EIH A;  3BUN B;  1NRV A;  1O4Q A;  4F5B A;  4OHE A;  1LKK A;  2JYQ A;  2B3O A;  1JYU A;  1O47 A;  3VRO A;  1O44 A;  3CXL A;  3OP0 A;  1F1W A;  2EU0 A;  4NWF A;  2IZV A;  3TL0 A;  5EG3 B;  4FL3 A;  3IMD A;  1CWD L;  5CDW A;  3MAZ A;  5DC9 A;  3EAC A;  4L1B B;  1GHU A;  2L6K A;  5GJI A;  2KGY A;  1OO4 A;  2MQI A;  3VGO A;  3US4 A;  3HHM B;  1JU5 A;  1KA6 A;  1X27 A;  1AYB A;  2PTK A;  1BHH B;  4U17 A;  1BHF A;  4XZ1 A;  5KAZ A;  3BUM B;  3S8L A;  2RMX A;  2RVF A;  5GJH A;  1FYR A;  2H5K A;  2QMS A;  1O43 A;  1K9A A;  3N84 A;  2H8H A;  3NHN A;  4P9Z A;  1O4L A;  1AOU F;  2C0O A;  5BO4 A;  2VIF A;  3K2M A;  1AOT F;  1LCK A;  1FU6 A;  3BUW B;  5AXI A;  5EEL A;  3PSJ A;  1KA7 A;  2MK2 A;  1O4O A;  4TZI A;  1AD5 A;  5EEQ A;  2LNX A;  1BLK A;  1HCS B;  3BKB A;  2CI8 A;  1MW4 A;  3EAZ A;  3VS2 A;  4K2R A;  2DX0 A;  1F2F A;  2PNA A;  3VS3 A;  1SPS A;  1LCJ A;  3IN7 A;  1X0N A;  3LYV A;  3KFJ A;  3PJP A;  5DC4 A;  4JGH A;  2EKX A;  3MXY A;  1CWE A;  1O4I A;  1PIC A;  1B47 A;  2BBU A;  1D4T A;  3GQI B;  1O4H A;  1O49 A;  1AYA A;  5J3X A;  3K2T A;  1G83 A;  1JYQ A;  4H34 A;  3PLF B;  1O4B A;  2OQ1 A;  1QCF A;  2EOB A;  4FL2 A;  2LQW A;  3BUO B;  4WWQ A;  1FBV A;  1O46 A;  4EY0 A;  1CSY A;  2EYY A;  5D0J A;  2C0I A;  3VS0 A;  3CWG A;  5HKW A;  4M4Z A;  1R1P A;  3VS4 A;  1RPY A;  1O4M A;  3HIZ B;  4DGP A;  2ECD A;  1NZV A;  4ROJ A;  1HCT B;  1Y1U A;  1O4J A;  4K45 A;  1LKL A;  1O4F A;  1BG1 A;  1BMB A;  1FBZ A;  2LNW A;  2FCI A;  2CR4 A;  4GWF A;  1O4P A;  4QSY A;  3GXW A;  2EL8 A;  2Y1N A;  3VRP A;  1Y57 A;  1Z3K A;  2IUG A;  1LUK A;  2IUI A;  5DF6 A;  1UUS A;  2XP1 A;  1RJA A;  2HMH A;  2CS0 A;  2Y3A B;  4OHL A;  2EO3 A;  3IN8 A;  1A07 A;  2EYV A;  2GSB A;  3N7Y A;  3C7I A;  3QWY A;  1MIL A;  1O48 A;  1AB2 A;  3S9K A;  3VRQ A;  1QAD A;  1CJ1 A;  3T04 A;  4LUD A;  3TKZ A;  3PSK A;  2ROR A;  3HCK A;  1OO3 A;  1SHD A;  4JE4 A;  4F5A A;  5HKY A;  2C0T A;  1R1S A;  1M27 A;  1D1Z A;  1JYR A;  1RQQ C;  3S8N A;  3BUX B;  1FMK A;  2GE9 A;  1R1Q A;  1YVL A;  5EHR A;  1A09 A;  1WQU A;  3GXX A;  3VRR A;  2SRC A;  4XZ0 A;  2PLE A;  1AYC A;  1FU5 A;  1TZE E;  3S8O A;  2AOB A;  3OB1 B;  2MRK A;  2C9W A;  4OHH A;  3IMJ A;  1A1A A;  3PFV A;  3UYO A;  1SHB A;  2PLD A;  3CBL A;  3OVE A;  1LUN A;  3VS6 A;  4JEG A;  4K11 A;  2LRA A;  2DCR A;  4DGX A;  1JWO A;  4LUE A;  3WA4 A; 
#chains in the Genus database with same CATH homology
 1BFJ A;  3PQZ A;  2ETZ A;  2MRJ A;  2K7A B;  3VS7 A;  2LCT A;  1H9O A;  1UUR A;  3MXC A;  4GPL B;  3CD3 A;  5IBS A;  2CBL A;  3VS1 A;  5DC0 B;  1GRI A;  3M7F A;  1CSZ A;  1A1B A;  1YVH A;  2OZO A;  2CRH A;  3VS5 A;  3ZNI A;  1ZFP E;  1OPK A;  1XA6 A;  1D4W A;  2RSY A;  1A1C A;  3UF4 A;  5IBM A;  1BF5 A;  4U1P A;  1O4E A;  1LUI A;  1FHS A;  2MC1 A;  4H1O A;  2YU7 A;  2CI9 A;  2EYZ A;  2YSX A;  2ABL A;  1AYD A;  5EHP A;  4E68 A;  2SHP A;  3OB2 B;  4FBN A;  2AUG A;  2PNB A;  2KNO A;  1O4D A;  5AUL A;  4OHD A;  1P13 A;  2HCK A;  1SPR A;  4A4B A;  3N8M A;  4X6S A;  3OV1 A;  3VRY A;  2K79 B;  3VRZ A;  2L3T A;  2DLZ A;  1O42 A;  3VRN A;  2HDV A;  2DVJ A;  4D8K A;  3PS5 A;  2Y1M A;  1O45 A;  1NZL A;  4P9V A;  1I3Z A;  4A4C A;  2HUW A;  1A1E A;  1LUM A;  2DM0 A;  4GL9 E;  1O4G A;  1BKL A;  2IUH A;  4E93 A;  1O4K A;  3QWX X;  4K44 A;  1O4R A;  1BLJ A;  1SKJ A;  4NWG A;  1KC2 A;  1QG1 E;  2DLY A;  2HDX A;  1IJR A;  1KSW A;  1TCE A;  2H46 E;  2AOA A;  1O41 A;  1BKM A;  2CIA A;  1O4C A;  1BHH A;  4OHI A;  2LQN A;  5HKZ A;  1X6C A;  1M61 A;  1O4N A;  2L4K A;  4F59 A;  2FO0 A;  1A81 A;  1A08 A;  5I6V A;  1BM2 A;  2KK6 A;  1OPL A;  1IS0 A;  1SHA A;  1BFI A;  1O4A A;  2EO6 A;  4EIH A;  3BUN B;  1NRV A;  1O4Q A;  4F5B A;  4OHE A;  1LKK A;  2JYQ A;  2B3O A;  1JYU A;  1O47 A;  3VRO A;  1O44 A;  3CXL A;  3OP0 A;  1F1W A;  2EU0 A;  4NWF A;  2IZV A;  3TL0 A;  5EG3 B;  4FL3 A;  3IMD A;  1CWD L;  5CDW A;  3MAZ A;  5DC9 A;  3EAC A;  4L1B B;  1GHU A;  2L6K A;  5GJI A;  1OO4 A;  2MQI A;  3VGO A;  3US4 A;  3HHM B;  1JU5 A;  1KA6 A;  1X27 A;  1AYB A;  2PTK A;  1BHH B;  4U17 A;  1BHF A;  4XZ1 A;  5KAZ A;  3BUM B;  3S8L A;  2RMX A;  2RVF A;  5GJH A;  1FYR A;  2H5K A;  2QMS A;  1O43 A;  1K9A A;  3N84 A;  2H8H A;  3NHN A;  4P9Z A;  1O4L A;  1AOU F;  2C0O A;  5BO4 A;  2VIF A;  3K2M A;  1AOT F;  1LCK A;  1FU6 A;  3BUW B;  5AXI A;  5EEL A;  3PSJ A;  1KA7 A;  2MK2 A;  1O4O A;  4TZI A;  1AD5 A;  5EEQ A;  2LNX A;  1BLK A;  1HCS B;  3BKB A;  2CI8 A;  1MW4 A;  3EAZ A;  3VS2 A;  4K2R A;  2DX0 A;  1F2F A;  2PNA A;  3VS3 A;  1SPS A;  1LCJ A;  3IN7 A;  1X0N A;  3KFJ A;  3PJP A;  5DC4 A;  4JGH A;  2EKX A;  3MXY A;  1CWE A;  1O4I A;  1PIC A;  1B47 A;  2BBU A;  1D4T A;  3GQI B;  1O4H A;  1O49 A;  1AYA A;  5J3X A;  1G83 A;  1JYQ A;  4H34 A;  3PLF B;  1O4B A;  2OQ1 A;  1QCF A;  2EOB A;  4FL2 A;  2LQW A;  3BUO B;  4WWQ A;  1FBV A;  1O46 A;  4EY0 A;  1CSY A;  2EYY A;  5D0J A;  2C0I A;  3VS0 A;  3CWG A;  5HKW A;  4M4Z A;  1R1P A;  3VS4 A;  1RPY A;  1O4M A;  3HIZ B;  4DGP A;  2ECD A;  1NZV A;  4ROJ A;  1HCT B;  1Y1U A;  1O4J A;  4K45 A;  1LKL A;  1O4F A;  1BG1 A;  1BMB A;  1FBZ A;  2LNW A;  2FCI A;  2CR4 A;  4GWF A;  1O4P A;  4QSY A;  3GXW A;  2EL8 A;  2Y1N A;  3VRP A;  1Y57 A;  1Z3K A;  2IUG A;  1LUK A;  2IUI A;  5DF6 A;  1UUS A;  2XP1 A;  1RJA A;  2HMH A;  2CS0 A;  2Y3A B;  4OHL A;  2EO3 A;  3IN8 A;  1A07 A;  2EYV A;  2GSB A;  3N7Y A;  3C7I A;  3QWY A;  1MIL A;  1O48 A;  1AB2 A;  3S9K A;  3VRQ A;  1QAD A;  1CJ1 A;  3T04 A;  4LUD A;  3TKZ A;  3PSK A;  2ROR A;  3HCK A;  1OO3 A;  1SHD A;  4JE4 A;  4F5A A;  5HKY A;  2C0T A;  1R1S A;  1M27 A;  1D1Z A;  1JYR A;  1RQQ C;  3S8N A;  3BUX B;  1FMK A;  2GE9 A;  1R1Q A;  1YVL A;  5EHR A;  1A09 A;  1WQU A;  3GXX A;  3VRR A;  2SRC A;  4XZ0 A;  2PLE A;  1AYC A;  1FU5 A;  1TZE E;  3S8O A;  2AOB A;  3OB1 B;  2MRK A;  2C9W A;  4OHH A;  3IMJ A;  1A1A A;  3PFV A;  3UYO A;  1SHB A;  2PLD A;  3CBL A;  3OVE A;  1LUN A;  3VS6 A;  4JEG A;  4K11 A;  2DCR A;  4DGX A;  1JWO A;  4LUE A;  3WA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...