5CEVA

Arginase from bacillus caldevelox, l-lysine complex
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
298
structure length
298
Chain Sequence
b'KPISIIGVPMDLGQTRRGVDMGPSAMRYAGVIERLERLHYDIEDLGDIPIGKAERLHEQGDSRLRNLKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAETSPSGNIHGMPLAASLGFGHPALTQIGGYSPKIKPEHVVLIGVRSLDEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKERTDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLAEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKLM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (ARGINASE)
publication title Crystal structures of Bacillus caldovelox arginase in complex with substrate and inhibitors reveal new insights into activation, inhibition and catalysis in the arginase superfamily.
pubmed doi rcsb
source organism Bacillus caldovelox
molecule tags Hydrolase
total genus 118
structure length 298
sequence length 298
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 1999-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 5cevA00
2A0MA 4RHIA 4ITYA 4Q3PA 4FCKA 5RLAA 1XFKA 1T5GA 3NIPA 3DJ8A 4Q3RC 4GWCA 4HZEA 4IE3A 3MFWA 1T5FA 3F80A 4RHJA 3SL0A 1P8MA 1T4RA 4Q3SA 2ZAVA 3CEVA 2EIVA 4GSZA 2CEVA 3SKKA 3MJLA 1HQFA 3E9BA 1WOHA 4Q3RA 4IE2A 2EF4A 4GSVA 1ZPGA 3E6KA 4CEVA 3NIQA 1GQ6A 1HQHA 1P8RA 4MYNA 4MXRA 2AEBA 3E8ZA 1P8SA 3MFVA 1HQGA 1HQ5A 4RHMA 4Q3QA 4Q3VA 4IU0A 5HJ9A 3MMRA 4DZ4A 1HQXA 3THHA 3M1RA 3GN0A 1TA1A 1P8PA 4IU4A 5CEVA 4GSMA 5HJAA 3LP4A 2PLLA 4MYKA 1ZPEA 4MYFA 2PHAA 1T4PA 4Q42A 1P8QA 4RHKA 1TBJA 3PZLA 3TF3A 4IU1A 4GWDA 3RLAA 1RLAA 3THEA 2PHOA 3NIOA 1GQ7A 1T4SA 2EF5A 3SJTA 1D3VA 4IXUA 4MYLA 1PQ3A 4Q40A 4FCIA 4Q3UA 4IU5A 4IXVA 1WOIA 4HXQA 4Q41A 4RHLA 1WVBA 3TH7A 3KV2A 1WVAA 1CEVA 4HWWA 1P8NA 3E8QA 3LP7A 3THJA 4G3HA 4I06A 3E6VA 1P8OA 3SL1A 3GMZA 4Q3TA 4RHQA 1R1OA 1T4TA 4IE1A 1WOGA 4RLAA 1TBHA 2RLAA 1TBLA 3LHLA
chains in the Genus database with same CATH superfamily
2A0MA 1W22A 4RHIA 1VKGA 4ITYA 4Q3PA 4FCKA 5RLAA 1XFKA 1T5GA 3NIPA 3DJ8A 5EENA 5G1AA 5G3WA 1ZZ0A 5ICNB 4ZUMA 4Q3RC 5G0XA 4GWCA 4HZEA 5DC6A 4ZUNA 4IE3A 5G0HA 3MZ3A 3MFWA 1T5FA 3F80A 4RHJA 3SL0A 1P8MA 1T4RA 4Q3SA 1ZZ3A 3EZPA 5DC7A 5EFGA 5EFHA 4CBYA 2ZAVA 3CEVA 2EIVA 4GSZA 5EFJD 4BZ9A 2CEVA 3SFHA 4CQFA 3SKKA 3MJLA 4ZURA 3C10A 1HQFA 1WOHA 3E9BA 2VQOA 5EFKB 5G10A 5G0YA 3RQDA 5G1CA 5EEFA 4LY1A 3F0RA 4IE2A 2EF4A 3EZTA 4GSVA 4Q3RA 2GH6A 1ZPGA 1T64A 2VQWG 3E6KA 3Q9BA 4RN1A 4CEVA 3NIQA 5IWGA 1GQ6A 1C3RA 5EEKA 3MZ6A 1HQHA 4QA1A 4CBTA 4ZUPA 1P8RA 4MYNA 5G0GA 3F06A 4MXRA 5D1DA 2AEBA 3EWFA 3E8ZA 1P8SA 3MFVA 1HQGA 1HQ5A 1C3SA 4RHMA 4Q3QA 5FUEA 5FCWA 4Q3VA 4IU0A 4BZ8A 4A69A 5HJ9A 3MMRA 5EEIA 5THVA 4DZ4A 1HQXA 3THHA 3M1RA 3GN0A 4BZ6A 5G0IA 1TA1A 5G12A 1P8PA 4IU4A 5DC8A 5CEVA 3Q9CA 1ZZ1A 4ZUOA 4GSMA 5HJAA 4BKXB 3LP4A 2PLLA 3MZ7A 1C3PA 1ZPEA 4MYKA 4MYFA 5D1BA 5JI5A 2PHAA 2VQVA 1T4PA 1T67A 1P8QA 4Q42A 4QA2A 4RHKA 1TBJA 3C0YA 3PZLA 5THTA 3TF3A 4IU1A 4GWDA 4LXZA 1RLAA 3RLAA 2PHOA 3SFFA 4RN0A 3THEA 5THSA 3NIOA 2V5XA 1GQ7A 1T4SA 2EF5A 3SJTA 3EW8A 1D3VA 4BZ7A 4IXUA 3Q9FA 4MYLA 1PQ3A 4Q40A 4FCIA 4Q3UA 4IU5A 5THUA 5BWZA 4IXVA 1WOIA 4QA3A 4HXQA 4ZUQA 4Q41A 3F07A 4RHLA 3Q9EA 1WVBA 5G11A 3TH7A 2V5WA 3KV2A 1WVAA 1CEVA 3MZ4A 5EEMA 3MAXA 1P8NA 4HWWA 5EFNA 5EFBD 2VQJA 5EF8A 3E8QA 4QA0A 3LP7A 3THJA 5G17A 4G3HA 4I06A 2VQMA 3ZNSA 1T69A 3E6VA 3MENA 1P8OA 5DC5A 4QA7A 3SL1A 2VCGA 3GMZA 4Q3TA 5G13A 4RHQA 1R1OA 5D1CA 1T4TA 4BZ5A 4IE1A 5A2SA 5G1BA 3ZNRA 2VQQA 1WOGA 4QA4A 4RN2A 4RLAA 1TBHA 2RLAA 5EF7A 5LI3A 5IX0A 4QA6A 1TBLA 3C0ZA 5G0JA 4QA5A 3LHLA
chains in the Genus database with same CATH topology
2A0MA 4RHIA 4ITYA 4Q3PA 4FCKA 5RLAA 1XFKA 1T5GA 3NIPA 3DJ8A 4Q3RC 4GWCA 4HZEA 4IE3A 3MFWA 1T5FA 3F80A 4RHJA 3SL0A 1P8MA 1T4RA 4Q3SA 2ZAVA 3CEVA 2EIVA 4GSZA 2CEVA 3SKKA 3MJLA 1HQFA 3E9BA 1WOHA 4Q3RA 4IE2A 2EF4A 4GSVA 1ZPGA 3E6KA 4CEVA 3NIQA 1GQ6A 1HQHA 1P8RA 4MYNA 4MXRA 2AEBA 3E8ZA 1P8SA 3MFVA 1HQGA 1HQ5A 4RHMA 4Q3QA 4Q3VA 4IU0A 5HJ9A 3MMRA 4DZ4A 1HQXA 3THHA 3M1RA 3GN0A 1TA1A 1P8PA 4IU4A 5CEVA 4GSMA 5HJAA 3LP4A 2PLLA 4MYKA 1ZPEA 4MYFA 2PHAA 1T4PA 4Q42A 1P8QA 4RHKA 1TBJA 3PZLA 3TF3A 4IU1A 4GWDA 3RLAA 1RLAA 3THEA 2PHOA 3NIOA 1GQ7A 1T4SA 2EF5A 3SJTA 1D3VA 4IXUA 4MYLA 1PQ3A 4Q40A 4FCIA 4Q3UA 4IU5A 4IXVA 1WOIA 4HXQA 4Q41A 4RHLA 1WVBA 3TH7A 3KV2A 1WVAA 1CEVA 4HWWA 1P8NA 3E8QA 3LP7A 3THJA 4G3HA 4I06A 3E6VA 1P8OA 3SL1A 3GMZA 4Q3TA 4RHQA 1R1OA 1T4TA 4IE1A 1WOGA 4RLAA 1TBHA 2RLAA 1TBLA 3LHLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A0M A;  4RHI A;  4ITY A;  4Q3P A;  4FCK A;  5RLA A;  1XFK A;  1T5G A;  3NIP A;  3DJ8 A;  4Q3R C;  4GWC A;  4HZE A;  4IE3 A;  3MFW A;  1T5F A;  3F80 A;  4RHJ A;  3SL0 A;  1P8M A;  1T4R A;  4Q3S A;  2ZAV A;  3CEV A;  2EIV A;  4GSZ A;  2CEV A;  3SKK A;  3MJL A;  1HQF A;  3E9B A;  1WOH A;  4Q3R A;  4IE2 A;  2EF4 A;  4GSV A;  1ZPG A;  3E6K A;  4CEV A;  3NIQ A;  1GQ6 A;  1HQH A;  1P8R A;  4MYN A;  4MXR A;  2AEB A;  3E8Z A;  1P8S A;  3MFV A;  1HQG A;  1HQ5 A;  4RHM A;  4Q3Q A;  4Q3V A;  4IU0 A;  5HJ9 A;  3MMR A;  4DZ4 A;  1HQX A;  3THH A;  3M1R A;  3GN0 A;  1TA1 A;  1P8P A;  4IU4 A;  5CEV A;  4GSM A;  5HJA A;  3LP4 A;  2PLL A;  4MYK A;  1ZPE A;  4MYF A;  2PHA A;  1T4P A;  4Q42 A;  1P8Q A;  4RHK A;  1TBJ A;  3PZL A;  3TF3 A;  4IU1 A;  4GWD A;  3RLA A;  1RLA A;  3THE A;  2PHO A;  3NIO A;  1GQ7 A;  1T4S A;  2EF5 A;  3SJT A;  1D3V A;  4IXU A;  4MYL A;  1PQ3 A;  4Q40 A;  4FCI A;  4Q3U A;  4IU5 A;  4IXV A;  1WOI A;  4HXQ A;  4Q41 A;  4RHL A;  1WVB A;  3TH7 A;  3KV2 A;  1WVA A;  1CEV A;  4HWW A;  1P8N A;  3E8Q A;  3LP7 A;  3THJ A;  4G3H A;  4I06 A;  3E6V A;  1P8O A;  3SL1 A;  3GMZ A;  4Q3T A;  4RHQ A;  1R1O A;  1T4T A;  4IE1 A;  1WOG A;  4RLA A;  1TBH A;  2RLA A;  1TBL A;  3LHL A; 
#chains in the Genus database with same CATH topology
 2A0M A;  1W22 A;  4RHI A;  1VKG A;  4ITY A;  4Q3P A;  4FCK A;  5RLA A;  1XFK A;  1T5G A;  3NIP A;  3DJ8 A;  5EEN A;  5G1A A;  5G3W A;  1ZZ0 A;  5ICN B;  4ZUM A;  4Q3R C;  5G0X A;  4GWC A;  4HZE A;  5DC6 A;  4ZUN A;  4IE3 A;  5G0H A;  3MZ3 A;  3MFW A;  1T5F A;  3F80 A;  4RHJ A;  3SL0 A;  1P8M A;  1T4R A;  4Q3S A;  1ZZ3 A;  3EZP A;  5DC7 A;  5EFG A;  5EFH A;  4CBY A;  2ZAV A;  3CEV A;  2EIV A;  4GSZ A;  5EFJ D;  4BZ9 A;  2CEV A;  3SFH A;  4CQF A;  3SKK A;  3MJL A;  4ZUR A;  3C10 A;  1HQF A;  1WOH A;  3E9B A;  2VQO A;  5EFK B;  5G10 A;  5G0Y A;  3RQD A;  5G1C A;  5EEF A;  4LY1 A;  3F0R A;  4IE2 A;  2EF4 A;  3EZT A;  4GSV A;  4Q3R A;  2GH6 A;  1ZPG A;  1T64 A;  2VQW G;  3E6K A;  3Q9B A;  4RN1 A;  4CEV A;  3NIQ A;  5IWG A;  1GQ6 A;  1C3R A;  5EEK A;  3MZ6 A;  1HQH A;  4QA1 A;  4CBT A;  4ZUP A;  1P8R A;  4MYN A;  5G0G A;  3F06 A;  4MXR A;  5D1D A;  2AEB A;  3EWF A;  3E8Z A;  1P8S A;  3MFV A;  1HQG A;  1HQ5 A;  1C3S A;  4RHM A;  4Q3Q A;  5FUE A;  5FCW A;  4Q3V A;  4IU0 A;  4BZ8 A;  4A69 A;  5HJ9 A;  3MMR A;  5EEI A;  5THV A;  4DZ4 A;  1HQX A;  3THH A;  3M1R A;  3GN0 A;  4BZ6 A;  5G0I A;  1TA1 A;  5G12 A;  1P8P A;  4IU4 A;  5DC8 A;  5CEV A;  3Q9C A;  1ZZ1 A;  4ZUO A;  4GSM A;  5HJA A;  4BKX B;  3LP4 A;  2PLL A;  3MZ7 A;  1C3P A;  1ZPE A;  4MYK A;  4MYF A;  5D1B A;  5JI5 A;  2PHA A;  2VQV A;  1T4P A;  1T67 A;  1P8Q A;  4Q42 A;  4QA2 A;  4RHK A;  1TBJ A;  3C0Y A;  3PZL A;  5THT A;  3TF3 A;  4IU1 A;  4GWD A;  4LXZ A;  1RLA A;  3RLA A;  2PHO A;  3SFF A;  4RN0 A;  3THE A;  5THS A;  3NIO A;  2V5X A;  1GQ7 A;  1T4S A;  2EF5 A;  3SJT A;  3EW8 A;  1D3V A;  4BZ7 A;  4IXU A;  3Q9F A;  4MYL A;  1PQ3 A;  4Q40 A;  4FCI A;  4Q3U A;  4IU5 A;  5THU A;  5BWZ A;  4IXV A;  1WOI A;  4QA3 A;  4HXQ A;  4ZUQ A;  4Q41 A;  3F07 A;  4RHL A;  3Q9E A;  1WVB A;  5G11 A;  3TH7 A;  2V5W A;  3KV2 A;  1WVA A;  1CEV A;  3MZ4 A;  5EEM A;  3MAX A;  1P8N A;  4HWW A;  5EFN A;  5EFB D;  2VQJ A;  5EF8 A;  3E8Q A;  4QA0 A;  3LP7 A;  3THJ A;  5G17 A;  4G3H A;  4I06 A;  2VQM A;  3ZNS A;  1T69 A;  3E6V A;  3MEN A;  1P8O A;  5DC5 A;  4QA7 A;  3SL1 A;  2VCG A;  3GMZ A;  4Q3T A;  5G13 A;  4RHQ A;  1R1O A;  5D1C A;  1T4T A;  4BZ5 A;  4IE1 A;  5A2S A;  5G1B A;  3ZNR A;  2VQQ A;  1WOG A;  4QA4 A;  4RN2 A;  4RLA A;  1TBH A;  2RLA A;  5EF7 A;  5LI3 A;  5IX0 A;  4QA6 A;  1TBL A;  3C0Z A;  5G0J A;  4QA5 A;  3LHL A; 
#chains in the Genus database with same CATH homology
 2A0M A;  4RHI A;  4ITY A;  4Q3P A;  4FCK A;  5RLA A;  1XFK A;  1T5G A;  3NIP A;  3DJ8 A;  4Q3R C;  4GWC A;  4HZE A;  4IE3 A;  3MFW A;  1T5F A;  3F80 A;  4RHJ A;  3SL0 A;  1P8M A;  1T4R A;  4Q3S A;  2ZAV A;  3CEV A;  2EIV A;  4GSZ A;  2CEV A;  3SKK A;  3MJL A;  1HQF A;  3E9B A;  1WOH A;  4Q3R A;  4IE2 A;  2EF4 A;  4GSV A;  1ZPG A;  3E6K A;  4CEV A;  3NIQ A;  1GQ6 A;  1HQH A;  1P8R A;  4MYN A;  4MXR A;  2AEB A;  3E8Z A;  1P8S A;  3MFV A;  1HQG A;  1HQ5 A;  4RHM A;  4Q3Q A;  4Q3V A;  4IU0 A;  5HJ9 A;  3MMR A;  4DZ4 A;  1HQX A;  3THH A;  3M1R A;  3GN0 A;  1TA1 A;  1P8P A;  4IU4 A;  5CEV A;  4GSM A;  5HJA A;  3LP4 A;  2PLL A;  4MYK A;  1ZPE A;  4MYF A;  2PHA A;  1T4P A;  4Q42 A;  1P8Q A;  4RHK A;  1TBJ A;  3PZL A;  3TF3 A;  4IU1 A;  4GWD A;  3RLA A;  1RLA A;  3THE A;  2PHO A;  3NIO A;  1GQ7 A;  1T4S A;  2EF5 A;  3SJT A;  1D3V A;  4IXU A;  4MYL A;  1PQ3 A;  4Q40 A;  4FCI A;  4Q3U A;  4IU5 A;  4IXV A;  1WOI A;  4HXQ A;  4Q41 A;  4RHL A;  1WVB A;  3TH7 A;  3KV2 A;  1WVA A;  1CEV A;  4HWW A;  1P8N A;  3E8Q A;  3LP7 A;  3THJ A;  4G3H A;  4I06 A;  3E6V A;  1P8O A;  3SL1 A;  3GMZ A;  4Q3T A;  4RHQ A;  1R1O A;  1T4T A;  4IE1 A;  1WOG A;  4RLA A;  1TBH A;  2RLA A;  1TBL A;  3LHL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...