5CGJA

Crystal structure of murine keap1 in complex with ra839, a non-covalent small-molecule binder to keap1 and selective activator of nrf2 signalling.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
290
structure length
290
Chain Sequence
VGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVIDGHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRSGVGVAVTMEPC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Characterization of RA839, a Noncovalent Small Molecule Binder to Keap1 and Selective Activator of Nrf2 Signaling.
pubmed doi rcsb
molecule keywords Kelch-like ECH-associated protein 1
molecule tags Protein binding
source organism Mus musculus
total genus 61
structure length 290
sequence length 290
ec nomenclature
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01344 Kelch_1 Kelch motif
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.80 Mainly Beta 6 Propeller Neuraminidase Kelch-type beta propeller 5cgjA00
3ADEA 4L7BA 2ZZKA 4L7DA 2DYHA 4IFJA 4N1BA 3WDZA 2XN4A 1U6DX 3VNGA 1ZGKA 1X2JA 4L7CA 5CGJA 3ZGCA 3VNHA 4ZY3A 4IN4A 5FNTA 4ZGCA 2FLUX 4IQKA 5FZJA 3WN7A 2VPJA 2Z32A 2ZW9A 2ZWAA 3II7A 4CHBA 5FNSA 4CH9A 2WOZA 4IFLX 5F72C 1X2RA 5FNUA 5FZNA 4XMBA 4ASCA 5FNQA 5FNRA 4IFNX 4YY8A 3ZGDA
chains in the Genus database with same CATH superfamily
2VWDA 4L7BA 1V3BA 4NC5A 3LI4A 1IVBA 1Q7FA 4GZTA 1H6LA 3V64C 1SUUA 4XJZA 4XMAA 2GHSA 1MS1A 2AH2A 3KGGA 1INXA 3LI3A 1NMAN 1Z50A 3HRPA 4CPYA 2XZIA 1F8EA 2V91A 1MZ5A 3P5BL 3AMSA 4FP2A 4CH9A 4K1IA 5GX4A 1V0EA 2FPCA 2F27A 4CPMA 7NN9A 4MX0A 3HLHA 1F8BA 3NO0A 1A14N 1NCDN 1S1DA 4L7DA 2VW0A 4SLIA 1NSDA 1SNTA 3WDZA 4XJ8A 3K37A 4C1YA 1WCQA 3S2KA 5GX3A 1IVDA 2QE8A 3K36A 4O5SA 4YZ5A 1V3DA 2CMLA 2QWDA 4FQ4A 4MZEA 1IUCA 3CL0A 2QWCA 2XCYA 4GJTA 4I00A 4YZ2A 1E8UA 4FPLA 4H53A 1X2RA 5FNUA 4B7MA 4Q6KA 4Q1UA 1VCJA 4XJUA 3GVJA 2XZKA 2QWAA 3BEQA 5D9BA 4XILA 3LI5A 2YDPA 1C9UA 1N1TA 3S94A 3VNHA 4X49A 1W20A 1USRA 3B7EA 4ZGCA 4IQKA 4AH4A 2AEPA 2HTWA 2SILA 4GEZA 2YDTA 3WW9A 4HHQA 3SALA 1MS9A 4XJAA 1MS0A 4XJWA 2AEQA 2JKBA 2DYHA 4MWXA 3SOQA 4NN9A 1NCCN 4MC7A 3S8ZA 4KS3A 1W0PA 3G4EA 2ISMA 2X9MA 4QN6A 3T1EA 4QN7A 2F25A 4HZWA 1INYA 1INFA 4XHXA 3ALWA 3K3AA 1CQ1A 2HTVA 2IVZA 1MS4A 2HU4A 2GVWA 4D52A 2Z32A 3SLIA 2XZJA 1B9SA 4J9TA 2F10A 4GN7A 4WEFA 2IATA 2HTYA 4ZLRA 4MWRA 5HUNA 2VSMA 4XE9A 1INGA 3I1CA 4FPJA 2XN4A 3A9HA 4GZXA 4NCSA 1POOA 2YA8A 1WP5A 2C4AA 1V04A 1IVGA 2W8BA 4QN4A 5B2DA 1L7HA 1EUSA 4GB1A 1N1YA 2YA6A 4FOWA 2FHRA 3II7A 3SOBB 2IAXA 3KYAA 4GN8A 2HT5A 4MWUA 3HLIA 3TIAA 2FP9A 3ALXA 2IAOA 2QWJA 4N1BA 2FP8A 1SO7A 4XJRA 2IAWA 5FNTA 2FLUX 4MZAA 1QLGA 5M1ZA 4CPZA 1A4GA 2VW1A 3H72A 2ZB5A 2ZW9A 3S8VA 5B2CA 4WEGA 4GZQA 5FNSA 4KS1A 5F72C 1L7FA 2HTUA 3K38A 4FP3A 2VK5A 1XOGA 1CRUA 4BBWA 2HTQA 2YA5A 2W20A 4HZVA 1S0IA 4UOUA 5GX2A 3SANA 3UC1A 4FPGA 4AGTA 5EX7A 5CGJA 4QN3A 1W8OA 4D52B 2IARA 1S0JA 4FPHA 4X4AA 4JMLA 2RKCA 5HUGA 1MWEA 1DIMA 3BYCA 3INBA 4GNCA 4MJVA 4XIKA 2F28A 1C5KA 4GZPA 3CYEA 4O5TA 4G3NA 4XMBA 1IVFA 1USXA 1Z4WA 4KS4A 4M3MA 1F8CA 1N6EA 2BF6A 4IFJA 1B9VA 2IAVA 1RWLA 3AMRA 1U6DX 3TI5A 2BERA 2F11A 2C4LA 4ZY3A 4D4UA 2VW2A 4XIOA 1SLLA 1IUBA 4D52C 4YW1A 2QWBA 2SIMA 4XMIA 2ZB6A 4MWYA 2ZWAA 1S18A 2DG1A 4FJ6A 3SILA 4HZYA 4IFNX 1NPEA 2HU0A 4B7NA 4GZSA 4HIZA 2A75A 2HQSA 5F9TA 3TI4A 4FPFA 4JF7A 3TICA 4A0PA 4IN4A 4AHAA 1EUUA 4FVKA 1N6FA 1V2IA 1E1AA 1W1XA 1MR5A 3L6VA 1NMCA 5HUMA 1W0OA 4YZ4A 1INVA 1WCSA 1SLIA 5NN9A 3NN9A 4YZ1A 2DSOA 2VK6A 4GNBA 4C1YB 1BJIA 4K1HA 3DASA 1ZI0A 3CL2A 3VNGA 4L7CA 3K39A 3U0SA 4GZOA 1V3EA 4UF7A 2VSKA 5GX1A 1NNBA 4YW5A 4IYGA 4D8SA 4CPOA 4M4VA 4YW2A 5FNQA 5D9DA 2HTRA 4DGRA 5GTQA 4FOQA 4B7QA 4FPEA 4DG6A 1INHA 1INWA 1ZGKA 5GX5A 3ZGCA 3SRGA 2IASA 4YW4A 4WA3A 3WN7A 4YW3A 5EO7A 3A71A 2VK7A 1Z4VA 2W5OA 3SOVA 4FZHA 1Z4ZA 3TI6A 2IAQA 2SLIA 3FVZA 4AGIA 4HW6A 4YZ3A 2GVUA 1N7DA 3TI3A 4FOYA 3CKZA 1NNCA 2HT8A 4FPCA 4K1KA 1QBIA 2QWKA 3G4HA 4HZZA 2IAUA 1NSBA 4KS2A 1NCBN 5FWWA 3O9JA 2IAPA 4MWWA 2F26A 3V1SA 2VPJA 2F24A 1IJQA 4H52A 2F13A 3Q6PA 4CHBA 3WWAA 3DR2A 1MS8A 5HX0A 2GVXA 4WA4A 4CPNA 3GVKA 2H2UA 4PWZA 2F0ZA 1N6DA 1MZ6A 4HHOA 1MS3A 2DG0A 1NN2A 1CRZA 1E8VA 4QNPA 4FPYA 1K32A 2W8BB 3TIBA 1MS5A 4FPOB 4X6KA 3Q6TA 4XYXA 4CPLA 4GN9A 4GNAA 1NCAN 4GDJA 1DILA 2HT7A 5JYYA 4IMBA 4FPKA 2VVZA 3H6JA 2POOA 5FZNA 3IAXA 4CSDA 1EURA 4ASCA 4XJ9A 4YY8A 3ZGDA 2ZZKA 4XHBA 1NSCA 1PJXA 1V0ZA 1IVCA 2H2NA 2AGSA 5D9CA 2QWEA 1VCUA 4R40A 1A4QA 3V65B 3D11A 1W8NA 3TC9A 3H73A 3TI8A 3Q6KA 4X47A 1L7GA 3A72A 1IVEA 1E8TA 1V3CA 2WOZA 1Z4XA 4B7JA 2FPBA 4GDIA 1F8DA 1N1SA 4MWJA 2OJHA 1RWIA 4HZXA 3A9GA 3ADEA 2GVVA 2G8SA 3H71A 4KS5A 2VAQA 4WA5A 3W09A 1CVMA 3FW0A 1XOEA 2QWIA 2QWFA 4MWQA 2B8HA 1OFZA 1EUTA 2F12A 2YA4A 2BZDA 2YA7A 3OPZA 3PJQA 2QWGA 3JU4A 3B69A 4FOVA 4M4NA 4XJQA 4K1JA 4QN5A 3GVLA 2W38A 5HUKA 5FNRA 1NNAA 2F29A 3E5ZA 4M4UA 2QWHA 4GZWA 1Z4YA 1X2JA 3NSSA 6NN9A 4MWVA 3O9KA 4XOGA 4B7RA 5H47A 3SREA 1B9TA 5FZJA 4MWLA 2W5NA 1N1VA 2P4OA 2BATA 3O4PA 4MJUA 1W21A 4IFLX 4K3YA 1KITA 3D12A 1V0FA 1NMBN 5EO8A
chains in the Genus database with same CATH topology
3ADEA 4L7BA 2ZZKA 4L7DA 2DYHA 4IFJA 4N1BA 3WDZA 2XN4A 1U6DX 3VNGA 1ZGKA 1X2JA 4L7CA 5CGJA 3ZGCA 3VNHA 4ZY3A 4IN4A 5FNTA 4ZGCA 2FLUX 4IQKA 5FZJA 3WN7A 2VPJA 2Z32A 2ZW9A 2ZWAA 3II7A 4CHBA 5FNSA 4CH9A 2WOZA 4IFLX 5F72C 1X2RA 5FNUA 5FZNA 4XMBA 4ASCA 5FNQA 5FNRA 4IFNX 4YY8A 3ZGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADE A;  4L7B A;  2ZZK A;  4L7D A;  2DYH A;  4IFJ A;  4N1B A;  3WDZ A;  2XN4 A;  1U6D X;  3VNG A;  1ZGK A;  1X2J A;  4L7C A;  5CGJ A;  3ZGC A;  3VNH A;  4ZY3 A;  4IN4 A;  5FNT A;  4ZGC A;  2FLU X;  4IQK A;  5FZJ A;  3WN7 A;  2VPJ A;  2Z32 A;  2ZW9 A;  2ZWA A;  3II7 A;  4CHB A;  5FNS A;  4CH9 A;  2WOZ A;  4IFL X;  5F72 C;  1X2R A;  5FNU A;  5FZN A;  4XMB A;  4ASC A;  5FNQ A;  5FNR A;  4IFN X;  4YY8 A;  3ZGD A; 
#chains in the Genus database with same CATH topology
 2VWD A;  4L7B A;  1V3B A;  4NC5 A;  3LI4 A;  1IVB A;  1Q7F A;  4GZT A;  1H6L A;  3V64 C;  1SUU A;  4XJZ A;  4XMA A;  2GHS A;  1MS1 A;  2AH2 A;  3KGG A;  1INX A;  3LI3 A;  1NMA N;  1Z50 A;  3HRP A;  4CPY A;  2XZI A;  1F8E A;  2V91 A;  1MZ5 A;  3P5B L;  3AMS A;  4FP2 A;  4CH9 A;  4K1I A;  5GX4 A;  1V0E A;  2FPC A;  2F27 A;  4CPM A;  7NN9 A;  4MX0 A;  3HLH A;  1F8B A;  3NO0 A;  1A14 N;  1NCD N;  1S1D A;  4L7D A;  2VW0 A;  4SLI A;  1NSD A;  1SNT A;  3WDZ A;  4XJ8 A;  3K37 A;  4C1Y A;  1WCQ A;  3S2K A;  5GX3 A;  1IVD A;  2QE8 A;  3K36 A;  4O5S A;  4YZ5 A;  1V3D A;  2CML A;  2QWD A;  4FQ4 A;  4MZE A;  1IUC A;  3CL0 A;  2QWC A;  2XCY A;  4GJT A;  4I00 A;  4YZ2 A;  1E8U A;  4FPL A;  4H53 A;  1X2R A;  5FNU A;  4B7M A;  4Q6K A;  4Q1U A;  1VCJ A;  4XJU A;  3GVJ A;  2XZK A;  2QWA A;  3BEQ A;  5D9B A;  4XIL A;  3LI5 A;  2YDP A;  1C9U A;  1N1T A;  3S94 A;  3VNH A;  4X49 A;  1W20 A;  1USR A;  3B7E A;  4ZGC A;  4IQK A;  4AH4 A;  2AEP A;  2HTW A;  2SIL A;  4GEZ A;  2YDT A;  3WW9 A;  4HHQ A;  3SAL A;  1MS9 A;  4XJA A;  1MS0 A;  4XJW A;  2AEQ A;  2JKB A;  2DYH A;  4MWX A;  3SOQ A;  4NN9 A;  1NCC N;  4MC7 A;  3S8Z A;  4KS3 A;  1W0P A;  3G4E A;  2ISM A;  2X9M A;  4QN6 A;  3T1E A;  4QN7 A;  2F25 A;  4HZW A;  1INY A;  1INF A;  4XHX A;  3ALW A;  3K3A A;  1CQ1 A;  2HTV A;  2IVZ A;  1MS4 A;  2HU4 A;  2GVW A;  4D52 A;  2Z32 A;  3SLI A;  2XZJ A;  1B9S A;  4J9T A;  2F10 A;  4GN7 A;  4WEF A;  2IAT A;  2HTY A;  4ZLR A;  4MWR A;  5HUN A;  2VSM A;  4XE9 A;  1ING A;  3I1C A;  4FPJ A;  2XN4 A;  3A9H A;  4GZX A;  4NCS A;  1POO A;  2YA8 A;  1WP5 A;  2C4A A;  1V04 A;  1IVG A;  2W8B A;  4QN4 A;  5B2D A;  1L7H A;  1EUS A;  4GB1 A;  1N1Y A;  2YA6 A;  4FOW A;  2FHR A;  3II7 A;  3SOB B;  2IAX A;  3KYA A;  4GN8 A;  2HT5 A;  4MWU A;  3HLI A;  3TIA A;  2FP9 A;  3ALX A;  2IAO A;  2QWJ A;  4N1B A;  2FP8 A;  1SO7 A;  4XJR A;  2IAW A;  5FNT A;  2FLU X;  4MZA A;  1QLG A;  5M1Z A;  4CPZ A;  1A4G A;  2VW1 A;  3H72 A;  2ZB5 A;  2ZW9 A;  3S8V A;  5B2C A;  4WEG A;  4GZQ A;  5FNS A;  4KS1 A;  5F72 C;  1L7F A;  2HTU A;  3K38 A;  4FP3 A;  2VK5 A;  1XOG A;  1CRU A;  4BBW A;  2HTQ A;  2YA5 A;  2W20 A;  4HZV A;  1S0I A;  4UOU A;  5GX2 A;  3SAN A;  3UC1 A;  4FPG A;  4AGT A;  5EX7 A;  5CGJ A;  4QN3 A;  1W8O A;  4D52 B;  2IAR A;  1S0J A;  4FPH A;  4X4A A;  4JML A;  2RKC A;  5HUG A;  1MWE A;  1DIM A;  3BYC A;  3INB A;  4GNC A;  4MJV A;  4XIK A;  2F28 A;  1C5K A;  4GZP A;  3CYE A;  4O5T A;  4G3N A;  4XMB A;  1IVF A;  1USX A;  1Z4W A;  4KS4 A;  4M3M A;  1F8C A;  1N6E A;  2BF6 A;  4IFJ A;  1B9V A;  2IAV A;  1RWL A;  3AMR A;  1U6D X;  3TI5 A;  2BER A;  2F11 A;  2C4L A;  4ZY3 A;  4D4U A;  2VW2 A;  4XIO A;  1SLL A;  1IUB A;  4D52 C;  4YW1 A;  2QWB A;  2SIM A;  4XMI A;  2ZB6 A;  4MWY A;  2ZWA A;  1S18 A;  2DG1 A;  4FJ6 A;  3SIL A;  4HZY A;  4IFN X;  1NPE A;  2HU0 A;  4B7N A;  4GZS A;  4HIZ A;  2A75 A;  2HQS A;  5F9T A;  3TI4 A;  4FPF A;  4JF7 A;  3TIC A;  4A0P A;  4IN4 A;  4AHA A;  1EUU A;  4FVK A;  1N6F A;  1V2I A;  1E1A A;  1W1X A;  1MR5 A;  3L6V A;  1NMC A;  5HUM A;  1W0O A;  4YZ4 A;  1INV A;  1WCS A;  1SLI A;  5NN9 A;  3NN9 A;  4YZ1 A;  2DSO A;  2VK6 A;  4GNB A;  4C1Y B;  1BJI A;  4K1H A;  3DAS A;  1ZI0 A;  3CL2 A;  3VNG A;  4L7C A;  3K39 A;  3U0S A;  4GZO A;  1V3E A;  4UF7 A;  2VSK A;  5GX1 A;  1NNB A;  4YW5 A;  4IYG A;  4D8S A;  4CPO A;  4M4V A;  4YW2 A;  5FNQ A;  5D9D A;  2HTR A;  4DGR A;  5GTQ A;  4FOQ A;  4B7Q A;  4FPE A;  4DG6 A;  1INH A;  1INW A;  1ZGK A;  5GX5 A;  3ZGC A;  3SRG A;  2IAS A;  4YW4 A;  4WA3 A;  3WN7 A;  4YW3 A;  5EO7 A;  3A71 A;  2VK7 A;  1Z4V A;  2W5O A;  3SOV A;  4FZH A;  1Z4Z A;  3TI6 A;  2IAQ A;  2SLI A;  3FVZ A;  4AGI A;  4HW6 A;  4YZ3 A;  2GVU A;  1N7D A;  3TI3 A;  4FOY A;  3CKZ A;  1NNC A;  2HT8 A;  4FPC A;  4K1K A;  1QBI A;  2QWK A;  3G4H A;  4HZZ A;  2IAU A;  1NSB A;  4KS2 A;  1NCB N;  5FWW A;  3O9J A;  2IAP A;  4MWW A;  2F26 A;  3V1S A;  2VPJ A;  2F24 A;  1IJQ A;  4H52 A;  2F13 A;  3Q6P A;  4CHB A;  3WWA A;  3DR2 A;  1MS8 A;  5HX0 A;  2GVX A;  4WA4 A;  4CPN A;  3GVK A;  2H2U A;  4PWZ A;  2F0Z A;  1N6D A;  1MZ6 A;  4HHO A;  1MS3 A;  2DG0 A;  1NN2 A;  1CRZ A;  1E8V A;  4QNP A;  4FPY A;  1K32 A;  2W8B B;  3TIB A;  1MS5 A;  4FPO B;  4X6K A;  3Q6T A;  4XYX A;  4CPL A;  4GN9 A;  4GNA A;  1NCA N;  4GDJ A;  1DIL A;  2HT7 A;  5JYY A;  4IMB A;  4FPK A;  2VVZ A;  3H6J A;  2POO A;  5FZN A;  3IAX A;  4CSD A;  1EUR A;  4ASC A;  4XJ9 A;  4YY8 A;  3ZGD A;  2ZZK A;  4XHB A;  1NSC A;  1PJX A;  1V0Z A;  1IVC A;  2H2N A;  2AGS A;  5D9C A;  2QWE A;  1VCU A;  4R40 A;  1A4Q A;  3V65 B;  3D11 A;  1W8N A;  3TC9 A;  3H73 A;  3TI8 A;  3Q6K A;  4X47 A;  1L7G A;  3A72 A;  1IVE A;  1E8T A;  1V3C A;  2WOZ A;  1Z4X A;  4B7J A;  2FPB A;  4GDI A;  1F8D A;  1N1S A;  4MWJ A;  2OJH A;  1RWI A;  4HZX A;  3A9G A;  3ADE A;  2GVV A;  2G8S A;  3H71 A;  4KS5 A;  2VAQ A;  4WA5 A;  3W09 A;  1CVM A;  3FW0 A;  1XOE A;  2QWI A;  2QWF A;  4MWQ A;  2B8H A;  1OFZ A;  1EUT A;  2F12 A;  2YA4 A;  2BZD A;  2YA7 A;  3OPZ A;  3PJQ A;  2QWG A;  3JU4 A;  3B69 A;  4FOV A;  4M4N A;  4XJQ A;  4K1J A;  4QN5 A;  3GVL A;  2W38 A;  5HUK A;  5FNR A;  1NNA A;  2F29 A;  3E5Z A;  4M4U A;  2QWH A;  4GZW A;  1Z4Y A;  1X2J A;  3NSS A;  6NN9 A;  4MWV A;  3O9K A;  4XOG A;  4B7R A;  5H47 A;  3SRE A;  1B9T A;  5FZJ A;  4MWL A;  2W5N A;  1N1V A;  2P4O A;  2BAT A;  3O4P A;  4MJU A;  1W21 A;  4IFL X;  4K3Y A;  1KIT A;  3D12 A;  1V0F A;  1NMB N;  5EO8 A; 
#chains in the Genus database with same CATH homology
 3ADE A;  4L7B A;  2ZZK A;  4L7D A;  2DYH A;  4IFJ A;  4N1B A;  3WDZ A;  2XN4 A;  1U6D X;  3VNG A;  1ZGK A;  1X2J A;  4L7C A;  5CGJ A;  3ZGC A;  3VNH A;  4ZY3 A;  4IN4 A;  5FNT A;  4ZGC A;  2FLU X;  4IQK A;  5FZJ A;  3WN7 A;  2VPJ A;  2Z32 A;  2ZW9 A;  2ZWA A;  3II7 A;  4CHB A;  5FNS A;  4CH9 A;  2WOZ A;  4IFL X;  5F72 C;  1X2R A;  5FNU A;  5FZN A;  4XMB A;  4ASC A;  5FNQ A;  5FNR A;  4IFN X;  4YY8 A;  3ZGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...