5D3GA

Structure of hiv-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer dna aptamer
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
553
structure length
553
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 reverse transcriptase bound to a novel 38-mer hairpin template-primer DNA aptamer.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate bh10)
molecule tags Transferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE P66 subunit
total genus 153
structure length 553
sequence length 553
chains with identical sequence C
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 5d3gA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5d3gA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5d3gA05
3C6TA 3L8BA 1JLEA 5F8JA 5KGXA 4IG0B 3IG1B 3MEDB 4DQQA 1J5OA 3OS2A 4FW1A 2BANA 3D45A 1VSJA 3AA4A 3HVTA 1KLMB 4ED3A 3DOLA 5HLFB 3Q8RB 4K4TA 1RYRA 4CJPA 3NGYA 1VSMA 1VRUB 4ECZA 4KB1A 2WOMB 1S4FA 1EKEA 4J2BA 3M8QA 1HMVA 1K1QA 2ZD1A 1SKRA 3DRSA 2FVSA 2R8JA 4NYFA 2YKNB 4LSLB 3P5JA 1JLAB 1Z26A 4YNQA 1NJXA 4WYLA 1SH2A 4CHQA 3VQCA 2JLEA 3CFPA 3KKRA 3RRGA 1UA1A 4IFYA 2UUWA 1BIZA 1LWEA 1X9MA 4BE2A 5DQGA 3BGRB 3OYDA 4DLEA 1LV5A 4O55A 1RTDA 1SKSA 4DS4A 2KQ2A 3OYGA 4BDYA 2IMWP 4NLSA 2FBXA 3LWLA 3K5NA 4N47A 4AHSA 4WFZA 4DTOA 4H54A 4O3PA 2HHTA 2D0CA 1KHWA 5L1IA 4ECTA 2VG7A 3PR4A 4K4UA 1C1CA 3Q8SB 1BL3A 2GV9A 4M41A 3NBPB 4PA1A 3K58A 4EBDA 4Y34A 3BSOA 1ZTWA 1HQUA 3GILA 3VQEA 3NCIA 1C1BA 1REVB 3TANA 2JEGA 1S1XA 3T5HA 3QNNA 2D41A 3LP2A 4M95A 4CJ4A 2HNYB 4DFPA 4NLDA 4CJRA 2BDPA 3ZSZA 1JLQB 4IBNA 1JLCA 3IGNA 5DGBA 4GVMA 4B9VA 5KT6A 3BDPA 4CF2A 5F9NA 1LWFB 2C2DA 4AHRA 2DFEA 1S1WA 3SUNA 3CVKA 3K5LA 3RR7A 4R8UA 3G0ZA 5KFQA 4CERA 2J6SA 5KFSA 4WYWA 3KD1E 3PW4A 1VSHA 1RNHA 3H5YA 3SQ2A 1IKWB 3DLHA 2VA2A 3NF6A 4EP5A 2AGQA 5I3UA 3PUFA 4FLYA 1S0NA 2HW3A 2R8KA 2HVIA 4ELUA 4K50A 3MF5A 4FJ9A 5J2NB 4E7IA 4TLRA 3FFIA 2FBYA 2G8UA 3M8QB 1IKXA 2EHGA 4KPYA 3H5XA 3I5CA 3TAMB 4CECA 4R5PA 4K8XA 5J2NA 3S3MA 3V1QA 5KFAA 4N76A 3AVHA 1S1TB 2GBZA 2B5JB 1YVFA 3GIJA 5KT7A 3HVTB 4EO8A 3ZSWA 3QNOA 4KB7A 2R8IA 4KI4A 1FK9B 4Q43A 1RT4B 3DLKB 3KK3B 2FLLA 3V6DB 1WAFA 4EP4A 4CK3A 1K1SA 2JGUA 4FBUA 1U47A 4FM0A 3OYAA 1WSGA 2IAJA 5KFHA 4CFBA 1GOCA 3PR5B 1TAUA 2FVRA 5CYQB 4J9SA 3PW2A 3V1RA 4MFBA 3CJ3A 4EBEA 4DL2A 1D9DA 3SPYA 2YNHA 3UQSA 2DPJA 4Z4FA 3E51A 1S49A 1EETB 1RAJA 4C8NA 1GOBA 3MFHA 1ZTTA 5KFYA 3IN5A 5SWMA 3TAQA 4E89A 3DDKA 5F8IA 3VA0A 5J2QB 4F4ZA 3KMSA 3CDEA 1JLBB 3AVNA 2X6NA 4C8KA 4IG3A 4DL3A 3MXIA 3PX6A 1DLOA 2BR0A 1QSLA 3RR8A 3OJSA 3MEEB 2QV6A 5C24A 3GYNA 4NLWA 2O4GA 1N5YA 4Z4CA 4QW9A 4ZVGA 1ZBIA 3AVLA 2IM3A 4IKAA 1U49A 4B9UA 4WFXA 4ED8A 4N5SA 5C24B 5DLFA 1BCMA 3PW0A 3LZJA 3SNNA 4ZMMA 3C6TB 1JLFB 3DM2B 4YP3A 1B9DA 1QS4A 3DOKA 2R2SA 5T14A 3QINA 4DMNA 4FJGA 5KFVA 3C95A 1WNSA 1KVBA 3V6JA 4DTNA 3SQ0A 4TYAA 4RW4B 3T3FA 3AA3A 4LH4A 2R7YA 2W9AA 4IRDA 2G8KA 4CGDA 4KFBB 5DQIA 4KHWA 2JEIA 4M3WA 5F8LA 4RU9A 5KFDA 3H2LA 3P83D 1VRUA 3QESA 4TY8B 5C42A 1XR6A 3MXJA 3SV4A 1RA6A 4DSKA 1TK5A 1FKOB 3AA2A 1ZETA 3NBPA 3CDUA 3SFGA 4FZYA 1KVAA 3FRZA 1N56A 1UA0A 1REVA 1DTQB 4RZRA 3WNFA 3CYMA 2O5DA 5EWEA 2DFFA 3QEPA 3BR9A 1S1TA 3U3YA 4J9RA 5KFBA 3HVAA 1VSLA 2WB4A 3OYEA 4R0EA 2CJQA 1NHVA 4RNFA 4RUCA 3C6UA 2OH2A 1RDAA 1VSDA 1IKVB 3KLFB 3G10A 3H59A 4FJNA 2ITGA 3SJJA 1HQUB 4FYDA 1JLGA 4CCHA 3UPFA 3KK1A 5T7BA 3C6UB 1LW0B 5DMRA 3HVWA 1SH0A 4MK8A 4NCAA 2OPRB 4ICLB 2AU0A 5FROA 4HCCA 1YT3A 4Y3CA 3NFAA 2OYQA 4TQSA 4FJXA 5CYMB 2YHBA 2JC1A 3OYKA 2XCPA 3ZT0A 2E9RX 4E7KA 1QAIA 1L3VA 1IKXB 2R8GA 3MR3A 4FM1A 3RMCA 4CFDA 1NKEA 1L3UA 4IH6A 3V81A 1N6QA 3VQ5A 2YNGB 1HJRA 2G8HA 3LWMA 4IG3B 2B5JA 1JLFA 2HNYA 2YHAA 3OYCA 4E1NA 4M45A 4CJEA 4JV1A 1U4BA 4DU4A 3V6DA 4I9QA 4NLTA 4KHNA 1NKBA 3HP6A 5HP1B 3MR2A 2G8FA 4IR9A 3RBEA 4ED1A 1SUQA 5I42A 4K8ZA 4DQPA 1S6PB 1ZBUA 1T3NA 3VQPA 3DLEA 4DTRA 4ZVHA 3ZCMA 3L2QA 3QZ8A 3FFIB 4B9SA 3EPGA 1IG9A 4KTQA 2IOCA 4C8OA 1C6VA 4RNNA 4E0DA 3V9UA 2A1SA 4MK7A 1N48A 2AJQA 1C1BB 3UR0A 3IRXB 4URQU 4FS2A 1TL1A 4DS5A 3AVCA 1FK9A 1HPZB 1LAVA 5KG5A 3G6XA 1TKTB 4LH5A 1EP4A 4DTJA 4F8RA 5FRNA 2VWKA 3E01A 2W9BB 3OYMA 3HHKA 4RW6A 1RTHA 4OJRA 3OYFA 4RNOA 4F4KA 1JKHA 5KFLA 3HPHA 4CJSA 4J2EA 1Y97A 1HRHA 4R8UB 1S6QA 5D3GB 3D0PA 3O3HA 1YTUA 5JS1A 1BIUA 2WCXA 5J2PA 1NHUA 4L8RB 3RB0A 4W5NA 5CYQA 4FXDA 1D1UA 3QEXA 2IM2A 2FLNA 3RRHA 1S1XB 1K6YA 3JYTB 3DI6A 3ISNC 1KRPA 4Q8FA 1JXEA 2UVRA 1S1VA 3I0RB 2QKBA 4WE1B 2HHWA 3BREA 3RMAA 3NGZA 3MXMA 2BE2A 4LD0A 1TK8A 2D7SA 4K4YA 4YR3A 4DSFA 5KFOA 1S97A 1TKDA 5KFFA 4OKEA 3DYAB 3AVKA 1G15A 4ZP8A 3SPZA 2KFZA 2GIRA 3PY8A 4J9QA 3ZSOA 4M42A 4IDKB 1IO2A 4AILC 5DG7A 5KFWA 1KHVA 3BSCA 5KG6A 1JL1A 1SKWA 4DFKA 4PUOA 2W9CA 4PY5A 3OHAA 1CSJA 4J9LA 3OYIA 3U3GA 5C42B 1T7PA 4HUGA 3LP1B 5KFXA 4WZQA 4JUZA 4MKBA 4EZ6A 3OLBA 3TAMA 2W8LA 1KTQA 4E7JA 3AVAA 5HP1A 1R0AA 2LSNA 5KG3A 3AVIA 4Y1DA 4H4OB 5F8HA 1C2PA 5J2MB 3NL0A 4KV8B 4LSNA 4F4WA 3RAQA 3U6FA 2I5JA 4CFCA 2VG5B 2I1RA 1JLCB 5E41A 3ZT2A 3DLEB 3UDLA 4TY8A 3HK2A 3AVJA 3EY1A 1HNIB 2X74A 4OLAA 4OL8A 4CHOA 2E4LA 4FJ7A 5HBMA 4QW8A 1HQEB 1N4LA 4YR2A 1S9FA 2OPPA 1L3SA 2IDOA 3MR6A 3FQLA 2Y1IA 1TV6B 4FLZA 1N5YB 2GIQA 2XCAA 3V6HA 3KLFA 4ECXA 3CJ0A 2VG6B 4NZ0A 3N6LA 1J53A 2UVWA 1BI4A 4DWIA 2QXFA 3KHGA 5KTQA 1NK7A 4W5TA 2YNGA 5J2PB 2ZKUA 4H8KA 4JRPA 1QSYA 4CESA 1KVCA 4DLGA 3S3OA 4KB0A 1B92A 1WSHA 4M3UA 3HYFA 4DSEA 3SZ2A 3DMJA 1QSSA 2J6TA 4OKJA 1RT1A 4ZPBA 1RDRA 4GMJB 2BGGA 4NLUA 4CF0A 2W7PA 3DLGA 3TI0A 1HYVA 4URGA 1DLOB 4CHYA 5K14B 2BRKA 4J9OA 3QIPA 3QGIA 4QWBA 1J5OB 2W8KA 4CJWA 4ZP6A 4E19A 1T03B 2IC3A 1D9FA 3V4IA 5K14A 4J2AA 3KD5E 3DI6B 4M3RA 2HHVA 4BDPA 3ALYA 1TAQA 1NK8A 5KT4A 1JL2A 1TKZB 4JS4A 1LWCA 2D0BA 4RNMA 2IBKA 4B08A 4F4YA 2C28A 4J9KA 1NJZA 4MFBB 2UVUA 1Q9YA 5JXSA 2R2RA 3IS9A 2J6UA 4CJ5A 3NH1A 4OVLA 2ATQA 3LP1A 2D5RA 4K4XA 4AHCA 4KFBA 3VQBA 3WNEA 4CJKA 3AO4A 1SL2A 4FLUA 3KIOA 4O0JA 4TYBA 1RT7B 4H4OA 5KG4A 1DTTA 3HJFA 5HLFA 1WSFA 4Q5VA 4M3TA 4FVMA 4ICLA 4NLGA 2FBTA 1C1AA 3AO1A 1RT7A 1TL3A 4EEYA 5HRPA 4Q0BB 3KMQA 4O3QA 3AO2A 3IAYA 5J1EA 3UIQA 2D3ZA 3NKYA 5EUHA 3QIDA 4ID5B 3DRSB 2QKKA 4FZXC 3Q8QB 2OZMA 5F8NA 5DQHA 4CEFA 2DY4A 3SFUA 2Z1GA 3KLGB 3AVGA 2RKIA 3FQKA 3T19A 4AH9A 3ZSYA 1JIHA 4Z4IA 1JXBA 4CIFA 5HBMB 4RW9A 4QWAA 5CZ1A 3N6MA 3DYAA 3QO9A 5C25B 3KLGA 5C5JA 3PVXA 3M8SA 2RKIB 4KKOA 1JKHB 4DF4A 3JYTA 2ASJA 3KLIA 3PX0A 3KK2A 5KGWA 2XI3A 1XR7A 4OLBA 2KZZA 1S6QB 2ASLA 4ED2A 4LY7A 3LAKA 2W42A 2KZMA 1TK0A 5HROA 2HNDB 4NCGA 2X6SA 4CHNA 3VQ6A 4MH8A 4DL6A 1ASVA 4FJHA 5CY4A 1UWBB 4HYKA 4GC7A 4DTMA 2OZSA 3HPGA 3AO3A 5KT5A 1Q8IA 3DMJB 4CEDA 3QEWA 4RG8A 1UAXA 1NKCA 1JLAA 2WOMA 1S1VB 3KLVA 1MU2B 3PHEA 4ZPDA 5DG8A 1HYSB 4O3OA 3QYYA 4ECUA 1S10A 2PZSA 2B4JA 2ZQBA 4WXOA 4AHUA 2G8IA 3BJYA 4ELVA 4NRUA 2RDJA 3VQ9A 4EO6A 2ZD1B 4FJKA 4KHRA 4O3NA 2ETJA 4KAIA 4C8LA 2G8WA 3KHLA 1D0EA 4AHVA 3RMBA 2VG6A 4Z4GA 1CZ9A 2V4RA 3L2UA 4RW8B 2IM0A 2I5JB 4FLTA 3SQ1A 3HSTB 3OHBA 4MIBA 3P1GA 4QCLA 1RTDB 3PW5A 1XHZA 4LSNB 4OPJA 4Y2AA 2VG5A 3WNGA 4DL4A 1EETA 2FC0A 3I5AA 1GOAA 4ZPAA 4XO0A 3KTQA 2OPQB 3I0RA 4PQUA 3GIKA 2VG7B 3SCXA 5FDLA 4O4GB 1HNVB 4RW6B 3MEGB 4CGFA 5KG2A 1LAWA 4Z0UA 1Z4UA 4NLYA 1ZBLA 1U48A 4MKAA 2YKMA 4KAZA 1JLQA 2BRLA 3V9ZA 1VSEA 1NK5A 4DL5A 1D5AA 5KT3A 4I9LA 4I2PA 3KLIB 4B3OB 1UOCA 4CJLA 1X1PA 1VSFA 1D8YA 4IH5A 3OYBA 4J9MA 1TVRB 5KFPA 3QIPB 4IG0A 1A5VA 4YQWA 1TGOA 3RBDA 5EU7A 3K57A 1HMVB 4M94A 3V9XA 3MECA 2GUIA 4F4XA 1RBUA 2XC9A 2BE2B 1NJYA 2XO7A 2F96A 2AWZA 1R0AB 2Z1JA 4GW6A 5KRTA 2IJFA 1RT3B 4KHSA 3DOLB 3DRRA 4KO0A 1XC9A 4MIAA 3HPOA 4CJ3A 2E6LA 4LSLA 4IH7A 1TL3B 4FK2A 4M3ZA 3RWUA 4KO0B 3MAQA 4OGEA 4Q8EA 3DRPB 2VA3A 4UQGA 3L2RA 4M3XA 2YKNA 3S3NA 1BISA 2DPIA 4MQ3A 4NCBA 2R2UA 4U7CA 3TABA 4M3YA 4IRKA 3T1AA 5KFKA 4TXSA 3KLEA 2BQ3A 2XY6A 3K5OA 3KJVA 2YNHB 3OS1A 1C0TB 3IS9B 3HXMA 4RUAA 1WAJA 2IA6A 2B6AA 1KSPA 2HHSA 3ICLA 2HHQA 1DTTB 3VQDA 5J2MA 4K4SA 4TSXA 3CO9A 3KK2B 1CLQA 4I2QB 4DQRA 1RBVA 4FBTA 3RAXA 3PW7A 3CG7A 4Q0BA 4F50A 4C8MA 3O3FA 1GX5A 1QHTA 3LP2B 2GC8A 2WK4A 2HMIA 5KI6A 3SI6A 1O1WA 2R2TA 3CWJA 5JS2A 1Q9XA 3HP9A 4KHYA 4O3RA 3EZ5A 3NF9A 2RF2A 4CK2A 2O4IA 1MU2A 5KFUA 3Q8PB 1LW2A 3OYNA 3MEEA 3NAEA 3M9OB 5HRSA 4DTSA 2YV0X 4CJQA 4W5QA 2XHBA 1QTMA 3AA5X 3G86A 3JSMA 2KTQA 4J2DA 2FLPA 4BE0A 4DSIA 1S48A 1FKPB 1RA7A 3RB4A 2Y1JA 5KRSA 3H08A 5EWGA 5HROB 3AVMA 3RTVA 4NLRA 3G6YA 3BQ2A 2XI2A 5CYMA 4O5BA 5KFIA 3VQ4A 1TVRA 4KSEB 2HNDA 4NCGB 4QPXA 3KOAA 3RB6A 1MMLA 1VSKA 4JS5A 1RT6A 4CGGA 3TWHA 2ILYA 3BSAA 3NE6A 2E9ZA 1CXUA 2ALZA 3BSNA 2YNIB 1OS5A 4PQUB 1ASWA 3TAGA 2AQ4A 3THVA 1RBSA 4K4WA 1TP7A 3NAHA 2OPPB 1NOZA 3ISND 3LPTA 1JX4A 4CJFA 1RTIB 1RDBA 1LWFA 1YTAA 2WTFA 5KG1A 3M9NB 3QO9B 5C25A 1SUQB 4NLXA 1BI4B 1LW0A 1S6PA 3K5MA 4ECQA 5L1KA 4FM2A 4F3OA 3NH0A 4XPEA 1CZBA 4JLHA 5EDWA 5L1LA 3QLHA 2E6MA 3SYZA 2OPQA 4CGHA 1NNDA 4E3SA 4LQ3A 1WNEA 3VQQA 3T5JA 3QIOA 2WONB 4PWDB 3LALA 4Y1CA 3GV8B 2XRIA 4F3TA 2PYJA 3MFIA 3OS0A 3PV8A 2ILZA 1UWBA 3ZT4A 3EZUA 5J2QA 2V4QA 1QE1A 3B6OA 1RILA 4ZP9A 3O4QA 4CGIA 2VWJA 2FVCA 4W5OA 3KLHB 2IJNA 3SUOA 1VRTB 2C2RA 4E1MA 4OPKA 3PJWA 1QE1B 1X9WA 4CF1A 3DLKA 3KK3A 3GIMA 2RDIA 1IH7A 1RT2B 2D0AA 3DOKB 4CEAA 1QAJA 4IRCA 3BQ1A 1LWCB 3CDWA 3H5UA 4JV0A 4FK0A 5KFTA 3H4BA 3T5LA 4KRFA 4G1QA 3O3GA 3M8PA 5KG7A 4WFYA 3CJ4A 2HHXA 1ASUA 4HKQA 3AVFA 3NDKA 1J54A 3ZT1A 4OKKA 4FJ8A 4O44A 4ED7A 2OPSA 2FJXA 1CXQA 2ZE2B 1EX4A 3JSMB 4BWJA 2DTUA 3VQSA 2XY7A 5KFNA 4FW2A 4FJJA 5I42B 4HUEA 4NLOA 2HHUA 3K2PA 3L2WA 3V9WA 2OPSB 4BWMA 1RYSA 4CF8A 5EWFA 2YNFA 4CF9A 1TKTA 3PZPA 2EX3A 4HHTA 3ZSRA 4WZMA 1RT3A 2W9BA 4KV8A 1SV5A 3NF7A 4DFMA 1RTHB 4ID1A 2XY8A 3DRPA 5KFCA 2IAJB 1A5WA 1EP4B 2HMIB 4CK1A 1TL1B 2B6AB 3O4NA 1J9AA 4NYZA 3PJXA 3CM5A 2RPIA 1IKYB 1KFSA 4B3OA 3L2VA 3LPUA 3S9HA 3TVKA 4DTUA 2FVQA 1ZYQA 2FJVA 1BCOA 2ATLA 4DL7A 1SL1A 3SQ4A 1T94A 1C1CB 2XY5A 5JUMA 1W0HA 3V1OA 3I0SA 2W7OA 4ECSA 4PWDA 3DLRA 4NLVA 5SZTA 4QWCA 2QE5A 5D3GA 3VN5A 3F9KA 2V9WA 1HNVA 4KHMA 1T05A 2B43A 4YMEA 4I2QA 3OYLA 4YR0A 3MR5A 4CJTA 2V0NA 4CIGA 3SV3A 4DSLA 3SUPA 3PO4A 3OL8A 1RT5A 2BQUA 1BQNA 4EYHB 3ITHA 1A5XA 2XGQA 3K59A 4ZVEA 4ZPCA 2HWHA 4Z4EA 3DM2A 3GV5B 1C0MA 4E7LA 1RT5B 4FJIA 1LW2B 4RW8A 4EBCA 1HYSA 4ZTJA 3OL9A 3PO5A 3FSIA 2JC0A 1SL0A 2YNIA 2RF2B 4NYNA 1IM4A 3TQ1A 3LZIA 2ASDA 3OYJA 1RTJA 1FKPA 1ITGA 4XPCA 2UVVA 2AGPA 2C22A 2HB5A 1RCHA 4QOZB 4IQXA 4DQSA 2XGPA 3AVBA 4ZHRB 3H4DA 3TR8A 4Z4HA 3KK1B 3MTKA 4ECYA 2CKWA 2P51A 4KTZA 2WRMA 1L3TA 1HNIA 4ZVFA 5CZ2A 4B9NA 3OL6A 1T03A 3NGDA 3CJ2A 5DG9A 4JRQA 5KFZA 2PYLA 1RT4A 3OYHA 3OLAA 3IGVA 4I7FB 3RB3A 2HNZB 1YVUA 2Z1IA 4I2PB 5F8MA 2HAIA 1BGXT 4HTUA 4FLVA 3QETA 3NHGA 2JEFA 1S9EA 4FJLA 3E01B 3IRXA 4IFVA 4R5PB 1KFDA 3ZT3A 1S0MA 1QQCA 3MEGA 4IFYB 4NLQA 3H98A 3C94A 3KLHA 1IKVA 4B9LA 3EPIA 3KNAA 1BHLA 4HCBA 3HL8A 4E7HA 2YKMB 1S1UB 3N6NA 4IFVB 1S0OA 4EZ9A 1X9SA 3CQ8A 4DF8A 4FLWA 4QAGA 1RT2A 3A2FA 2WONA 4N56A 4CJVA 1VK0A 5DGAA 4CEZA 4DTPA 3TARA 5KFEA 2AX1A 1I6JA 2EC0A 3VQAA 5HRRA 3ZSQA 3KHHA 3AV9A 3HO1A 2F8TA 4U6PA 4CGJA 3DLGB 3AO5A 4WXWA 1RBRA 4DU3A 4DFJA 3MECB 1WSJA 2WHOA 3ZSXA 3OSPA 1RT1B 4TY9A 3IG1A 3MEDA 3M9MB 1TKXA 3NF8A 1TQLA 2JEJA 1BQMA 1I3AA 4FJMA 3LAMA 3GQCA 4PUOB 4TN2A 2W9CB 4ED6A 3DRRB 4ECWA 3CFRA 1NK9A 3OY9A 4K4VA 2G8VA 2BQRA 3GV7B 4Y2CA 3OSNA 1LWEB 1NJWA 4MK9A 4J9NA 3ULDA 5L1JA 1SV5B 1FXXA 4URSA 2KW4A 2KFNA 4DTXA 3V9SA 5KFRA 4HUFA 3SUQA 1NK4A 3QEIA 4N41A 4KHQA 1RTIA 4NLPA 2ZE2A 3CJ5A 4J9PA 4GC6A 4BE1A 2OA8A 4KI6A 2HVHA 2Q3SA 3KJVB 4DG1A 1WLJA 3G6VA 4DSJA 4KHUA 3ASMA 3B6PA 4CFAA 4CEBA 4CHPA 4BACA 3BGRA 2DFHA 2NUBA 4X2BA 4FK4A 1ZBHA 4B8AB 1SH3A 1FKOA 4W5RA 3HVRA 3KHRA 4Q44A 2YNFB 3CM6A 3OL7A 4EYIB 4HVJA 4ZHRA 4AHTA 4XIUA 3CIZA 1WSIA 4ECVA 4FS1A 2IGIA 2A1RA 3ZSVA 4ZTFA 1S1WB 3HKWA 3OJUA 5DK5A 1XI1A 1S1UA 4QWDA 1HQEA 4YFUA 4ID5A 2C2EA 4JV2A 1TV6A 1IKYA 2P5GA 1JLEB 3DLBA 4OGCA 4CEOA 2AGOA 3QLHB 5I3UB 4FZZA 3VQ7A 2P5OA 1W25A 3M8PB 4IR1A 4O0IA 5KFMA 4LQ9A 2FBVA 2Z1HA 4BDZA 4IKFA 3D28A 4WE1A 2R8HA 1VSIA 1RT6B 1NOYA 1S9GB 1HYZA 1ZBFA 4B9MA 1BQNB 1IKWA 5DLGA 3I8DA 4F2RA 4FJ5A 4B9TA 1TKXB 1BQMB 3HT3A 2IC3B 3WNHA 3D5MA 1VRTA 1S9GA 5FDLB 3L3UA 3QGHA 1I39A 3ITHB 3L3VA 4ED0A 1RDCA 4IDKA 3TAPA 1B9FA 3RMDA 4NRTA 1W9HA 4CEEA 4CEQA 1KLNA 3QEVA 3LP0A 5L9XA 3V4IB 4RW7A 1Z25A 2HWIA 2AX0A 4ELTA 4G3IA 3NMAA 4O3SA 4B8CA 1KCFA 3LANA 5KFJA 3VA3A 2XWYA 1TKZA 2E9TA 2FVPA 4DEZA 3OVNA 2F8SA 3LP0B 3GIIA 2F8EX 3H40A 3LP3A 1NK6A 2D3UA 4RW7B 3KKSA 1JXLA 2RN2A 5F8GA 5KT2A 4KTWA 4RW4A 1RDDA 3F73A 1RTJB 4CHZA 4CE9A 4Q45A 1S5JA 3PX4A 3NAIA 1U04A 5HRNA 1HARA 1L5UA 5J1EB 5F9LA 1U09A 3I5BA 4I7FA 1QUVA 2QK9A 3EYZA 2IS3A 3QERA 4KE5A 4QWEA 1JLGB 2PY5A 4DQIA 4O4RA 1XHXA 1T8EA 3NGIA 4O4GA 1U45A 3M8RA 4DG1B 3LDSA 2HNZA 5KG0A 2OPRA 1T05B 4KBIA 3TAFA 1NK0A 2UUTA 4K4ZA 3HM9A 3T5KA 3SI8A 4FLXA 3QZ7A 1DTQA 1WN7A 2X78A 3VQ8A 2IM1A 4TQRA 2FJWA 1GX6A 3V6KA 3TAEA 1JLBA 4KKOB 3CFOA 4IOBA 4G1QB 4CIEA 1XR5A 4RW9B 4KREA 5KFGA 1S9EB 2P1JA 1F21A 4F2SA 4ECRA 3BQ0A 3KLEB 3NH2A 4H4MB 4FCYA 5FRMA 1HPZA 1C0UA 3V81B 1N6QB 3FDSA 4O44B 4CJUA 3I0SB 1RBTA 1C0TA 1XWLA 1WSEA 4ZP7A 4DU1A 4H4MA 2BANB 1C0UB 1KLMA 3H5SA 3QGGA 4RNHA 1EXQA
chains in the Genus database with same CATH superfamily
3N5FA 1QDUB 1JLEA 1PCAA 3ZZ0A 4MJKA 1J5OA 4C6AA 3OS2A 4FW1A 3D45A 1VSJA 1PAUB 3DOLA 4DHYA 4DV0K 3CD0A 2ZWPA 4YDXA 1XC3A 2E2OA 1Q5VA 3Q7BA 2WOMB 2O01C 3SSRA 4J2BA 5D4OA 1K1QA 1SKRA 2Q79A 4I6AA 4LFBJ 3SK3A 4YNQA 4CHQA 1OPIA 3UDVA 1WG4A 1NXIA 1VAZA 1NGHA 2JLEA 4GKJK 5HJXA 2CVIA 1LWEA 3ET6B 3LF0A 4O55A 3I9ZA 1VQ6S 1G3OA 2KQ2A 1VQ5S 4OX9K 4P2FA 1N34K 3K5NA 3W0LA 2ZH6A 1N36K 4ECTA 3PR4A 4X4RA 2ZZNA 5I3QA 4JHDA 3TX8A 4L3NA 2K3IA 2GV9A 1F3VA 2OJ3A 3NBPB 3TEHB 4PA1A 3K58A 4TKTA 3UI3A 2M4MA 2HFZA 4DV6F 3M5RA 2ZVSA 2EG2A 2GVZA 3I8BA 2AF6A 1EJ7L 1XK8A 2HNYB 1X4EA 3DDNA 2D9OA 4DX7A 4CJRA 2OO4A 1YJ7A 4YB6A 5DGBA 4PXBA 5KT6A 2PFFB 2QFJA 5D4PA 1MWZA 3MOJB 3MMCB 1S1WA 3SUNA 3RR7A 4NZ6A 5KFQA 2J6SA 3UN2A 5KFSA 4WYWA 2NXJA 4FN5A 4NXMK 5KQ8A 3FFKB 3RZAA 4EI2A 3E9OA 1PAEX 4DV0F 3CCSS 3NF6A 3OV7A 2P9IB 4YHHJ 1CS4B 3G25A 3C16B 4TLRA 1CULA 2G8UA 4XTTA 3G9CA 4JI4F 3H5XA 4ILMA 3TAMB 2XYGB 4LIWA 3S3MA 5KFAA 3P3DA 1HBOA 2BJ8A 4DPTA 2GBZA 3TA1A 1HKBA 5JVGQ 3ZSWA 2V6AA 4KB7A 3QWUA 3KK3B 3V6DB 4KGVB 4MDAA 1WAFA 3J81U 3VGSA 2YH1A 1Q82T 3IKMA 4HTLA 1BWEA 3PDNA 1ULRA 4BS2A 1WSGA 5LMNK 2GUPA 2GJIA 1GOCA 3PR5B 4ZCMA 3LO3A 1F5AA 4BQLA 4A8XA 5CYQB 2Y9HA 3PKYA 3GOIA 3D2EA 3UQSA 3PYEA 4UT4A 2O66A 3MFHA 3HRGA 2DY1A 4Q2MA 5J2QB 3KK7A 3CDEA 1T95A 5AQVA 2BVZA 4IG3A 4DL3A 4F26A 3T1YK 1OPZA 3IA0A 4LVOP 2NUHA 1XNRK 1FJCA 4IO9L 2FJBB 4FKYA 2H9ZA 2QV6A 3GYNA 4DV4K 2GX8A 4ZVGA 3AXKA 1RZMA 2IM3A 4IKAA 1EIYB 5C2FA 4ED8A 2CPIA 1HBNB 5AFUH 4HDHA 2LFVA 4N5SA 5E3RA 2OD4A 5DLFA 3VEWA 3PW0A 3I96A 1JLFB 4YP3A 1B9DA 4I6MA 1RWPB 1WF0A 2QFIA 1WNSA 4CZGA 4DX6A 3CCSN 3V6JA 1B0PA 4OYZA 4WYBA 3THYB 5FLXY 2ZBRA 2A1BA 1NMDA 1IQZA 1QZ6A 1KBRA 2BX6A 4KFBB 3KUHA 4KHWA 2JEIA 2ZJPQ 5LJ5Y 5LJ3Y 3H2LA 5LJWA 5C42A 1XR6A 5AQMA 4PHTX 2RHKA 1U2FA 5LMUF 4LIRA 1S76D 1RA6A 3ZETA 1P1LA 3CCRS 2BOAA 1YJNN 2AIRB 3THWB 3CDUA 2H3GX 4XH4A 4USIA 1N36J 4RZRA 3WNFA 2W4DA 4ZPVR 2O5DA 4AXIA 3LDOA 2DFFA 3QEPA 3BR9A 3AD9C 3U3YA 5KFBA 4A5AA 1F3FA 4ZVUB 4A8WA 2H1YA 1N5TA 3DHWC 1MMDA 2GWJA 4ILGB 2ITGA 4FYDA 3OW2M 1JLGA 3KK1A 1OQ3A 1IJFB 2Q2RA 1VCTA 1P1TA 2QWRA 3PYFA 3HVWA 5A8KB 4IFEA 1KD1T 1SH0A 3WBZA 3D2FA 4X62J 2PT0A 4ICLB 2VC0A 3KJFB 3P49B 2AU0A 4DR5J 3BBCA 4HT7A 1VBXA 4EHTA 4TQSA 4PL8A 3JS9A 2HGNA 2M70A 2DHHA 2OTLS 3A8YA 2R8GA 4FM1A 4FVCA 1EB0A 3CCUN 1VS3A 1NKEA 3EMTA 3SDEB 4IG3B 4AUKA 3EGWB 1X4FA 1SQFA 3CMEN 3CF5Q 2WSFC 3MN5A 4KGZB 3V6DA 4NLTA 4FWQA 3CMAS 2GGPB 2PSZA 3TJAA 4B3RF 1YUWA 3ZNUA 2K1RB 4B17A 4ED1A 2F65A 3DLJA 3MM8B 1VQMS 3WX8A 5B09A 5BR9A 4CI0B 5GAEI 1YJUA 3M30A 4DQPA 1T6DA 1XJWB 4J91A 3ZZPA 4ZVHA 4QR2A 3QZ8A 3CHWA 4B9SA 2WB1D 4G1PA 1WB9A 4KTQA 5B0AA 1BU6O 2BJ7A 3MOZA 4WU2A 5C12A 4W98A 5DZ7A 4I0WA 3UR0A 4URQU 3NNAA 2FLOA 4KPCA 4M5JA 4XK8C 4DPWA 3BBFA 3A13A 3TTFA 5FRNA 2VWKA 2GHWA 3M6VA 2W9BB 4B3SJ 4FL9A 2XNRA 4CJSA 1TL5A 5D0EA 2QLXA 4R8UB 1VQ7S 2Y1RI 4MDBA 2W4PA 2P5VA 1BIUA 1NHUA 2DHAA 1SC1B 1D1UA 3NCQA 4B9QA 4BC3A 3HFVA 3GE9A 4X65J 3QEXA 2D3O1 1MWYA 2IM2A 3RRHA 2FLNA 1O5JA 1S1XB 1KOOA 3ILLA 1EKRA 1BC6A 3N4PA 1N8RT 4Q8FA 2UVRA 3DXMA 4YS2A 2XWXA 4AQYK 3FSXA 2F8MA 1GLEG 4CO4A 3A5NC 4JI4K 1X5OA 4DSFA 5KFOA 1S97A 3S01A 2EVZA 3UE2A 3AVKA 4ZP8A 2KFZA 2GIRA 3VV2B 4A62A 4M42A 4IDHA 5DG7A 4ITSA 4P9SA 3FZBA 5BPMA 2PA8D 3OTDA 4OZ0A 3QJPA 3OHAA 3G6ES 1NGDA 2PFDA 1CEZA 5C42B 3US5A 2MGZB 3H25A 3THXB 3LP1B 5KFXA 5DO2A 1F9FA 1Q5YA 5AXKA 4JUZA 4EZ6A 2XZWA 3TAMA 2JVOA 1H3DA 3W8GA 2IBOA 4Y1DA 1HBUA 2ROPA 1RSCA 2GCFA 5J2MB 1ZZFA 3IRWP 2QA4N 3GR0A 2I1RA 1JLCB 2EK1A 5E41A 1UMJA 4TY8A 4USHA 3EY1A 2UU9J 2X74A 4UY8O 4OLAA 2OD6A 1HBUB 3EE3A 3GTYX 3P4IA 1HQEB 3F44A 1L3SA 1HKCA 3MR6A 2E8AA 2Q1NA 1I5OB 2WBRA 2DNRA 2GIQA 1QVFM 2NQPA 1IBKJ 1J53A 4HWIA 1BI4A 4DWIA 2D9PA 4W5TA 2YNGA 2ZKUA 2YWHA 3S3OA 3BPSP 3OBWA 4M3UA 3SZ2A 1RBOB 2JWNA 1RT1A 1K47A 3AJDA 1FDNA 2CADA 1Y11A 1YJRA 2HHPA 4URGA 3IMXA 5AQTA 2MJUA 2RMLA 3BY5A 1SKUB 3O9QA 1RFQA 1FRJA 3QGIA 4QWBA 4NLCA 1J5OB 2W8KA 2O8CB 4IOCQ 4ZP6A 1T03B 3CCQN 4NXMF 1FKAF 5DM7L 5M1QA 3KD5E 3H0PA 3T6BA 4BDPA 1TAQA 2XBPA 1ZXOA 2GVDB 1NK8A 3QSIA 1Q8KA 1F2HA 3PM9A 1V3SA 3T1YF 1U2VB 3D9BA 4F4YA 3DDIA 2C28A 5ETSA 3CUNA 3SBTA 2VFVA 1P90A 1VQ5N 2ATCB 4CJ5A 1TUGB 2E5LK 4OVLA 3P8BB 2D5RA 4K4XA 3SQGB 1OY8A 3R5JB 4FF4A 1WACA 1RACB 5M2UA 1SL2A 3VF6A 4TYBA 3K8WA 2GWKA 1ATNA 5KG4A 1DTTA 4JKEA 2CNLB 4B1VA 2IDLA 5CAAA 2FJDB 2KN4A 2FBTA 5HRPA 4BG8A 2OFGX 5J1EA 1E6VA 3UIQA 1HJOA 3QIDA 2IRUA 4PXCA 2M7SA 5F8NA 5D8HB 2Z1GA 2RKIA 3OVAA 5AZJB 2UYTA 2B8QA 3FQKA 3RBXA 3ZSYA 4HH0A 5B08A 2HBYB 3ZX2A 4ISFA 3HI0A 5LY3A 1M5VC 2WZ1A 3N6MA 3QO9A 1WG1A 2OTLN 1LKZA 3Q22A 4KKOA 4DI6A 4LRCA 1FNXH 1JKHB 4I68A 1QQMA 1S6QB 3TSQA 3BGUA 1VI7A 2YWFA 1I94F 1X9JA 5HROA 3CQXA 3N5BA 1ASVA 4X64K 2DNHA 5T41A 1U1NA 4PWUA 4AM7A 3A0IX 2CJYB 4DTMA 1Q7YT 3HBTA 3KKFA 1DAXA 2DB1A 3AO3A 1MN7A 3VF2A 3X1LB 3B8HA 4H0OA 4LRAA 3O1WA 2IVFB 5AQFA 3R1HA 3LTOA 3JTOA 5GINA 1MU2B 4ZPDA 4B3TK 4DCOB 2VQFK 4W4MA 2VFRA 4K41A 4O3OA 3QYYA 3M6GA 3AOCA 4ECUA 2ZQBA 3JSBA 3OVSA 3BJYA 4NRUA 4B1XB 4KHRA 4O3NA 3NS7B 2G8WA 3CCZA 5BRHA 1TU0B 1AFJA 3RMBA 1Q8LA 2VG6A 4BQZA 3AY0A 4Z4GA 2AW0A 5GAGI 1UEKA 3L2UA 3F2KA 1H6KX 3BGOP 5ELZA 2P8IA 3HM8A 4WK1A 3P1GA 4LSNB 4OPJA 4KIAA 3WXKA 4YDUA 3C0BA 2DHGA 2W6LA 2QLJB 1EWQA 3JSYA 1QVGR 4DV3K 4B3RJ 3CTRA 1HNVB 3BEXA 4CGFA 1LAWA 1Z4UA 5AFUA 3D2WA 1ZBLA 3CCLS 1JLQA 1O0PA 2B9WA 2X3DA 4LFCF 2HG4A 2ITMA 4RKUC 5LSLA 4GKJF 3QRQA 3I56N 4JV5F 4B3OB 4I67A 5CA5A 3KWMA 2ZHBA 3T41A 1X1PA 3IM9A 4J9MA 1TVRB 3QIPB 2N7YA 4OYAA 1TGOA 5EU7A 2E2PA 1T9UA 4K5RA 4M94A 1EHWA 4I1TA 3V9XA 1YGYA 2CQBA 4WQ4A 4CI6A 1RBUA 2BE2B 2XO7A 2VB6A 2CVEA 2K3KA 2GVDA 1NZ8A 1B70B 4N8NA 2XULA 5M1KA 4MIAA 3D6MB 3QT6A 4OPAA 2DR9A 1WHWA 2HVEA 5ETOA 4JI0K 4ZVPB 3MAQA 4UY8T 2CDRB 2QT7A 4UQGA 4LF1A 4BGBA 3L2RA 4M3XA 4F02A 2H54B 2DPIA 3WQTA 4HI2A 2DIVA 2FJAB 3CJKB 4JN4A 4M3YA 4IRKA 3SAFA 2XY6A 3MCOA 4NEYA 3DJCA 1ESVA 3OS1A 2FD2A 1C0TB 3ELHA 3NG8A 2IA6A 2HFVA 1EQYA 3L4IA 4U7BA 5DRKA 2HBZB 1D4XA 1NGBA 2NXEA 4H0VB 3KK2B 1CLQA 4AL7A 2P9UB 3RAXA 3PCOB 4Q0BA 3FMWA 4F50A 3QT8A 2WVDA 3A3PB 3DLLQ 3R3LA 1U6ZA 2IIHA 5KI6A 2R2TA 2HGLA 1Q9XA 1VQOS 4O3RA 2RF2A 2RJZA 2OMOA 3I56S 1YZ6A 1NMNA 1PYOB 2A42A 1T3VA 1LW2A 3NAEA 4DR4K 3CDBA 4QJVA 4USVA 2KFYA 2FLPA 4CBUA 1S48A 2WVFA 1RA7A 1PGZA 5IV3A 2Y1JA 5KRSA 1CC8A 5EWGA 5HQLA 3AVMA 3RTVA 4BC2A 3BQ2A 1A0OB 1Q16B 2HNDA 3W60A 4UOGA 3UFCX 2NZ4A 4DR7K 1DURA 3VWSA 4QPXA 1RWVB 1OJ4A 1VSKA 2E1AA 5M1NA 2P9GA 5BN9A 2Q66A 2FB0A 3UNGC 3BSAA 3NE6A 5AT1B 1GFWB 2DNMA 2NNWA 3GBTA 3VPZA 5BYRA 2AQ4A 3THVA 4ZLPA 4FYYB 1RP5A 1RTIB 2DHSA 1JJHA 2KRRA 2V8GA 5CCMA 1FD2A 3TOQA 1NCLA 2DR6A 3CETA 5LMNF 4NE9C 3K5MA 4ECQA 2Q0UA 5BYQA 5L1KA 1IBLJ 4F3OA 3NH0A 5AQQA 4XPEA 1CZBA 1X4GA 4LBHA 3QLHA 2E6MA 3SYZA 2YH0A 1H2TZ 1TMMA 1NNDA 4LF8F 1FRIA 3VQQA 1WF1A 3QIOA 3P31A 1X5PA 4K43A 3TYTA 3LALA 3D6RA 2XRIA 5GADP 2PYJA 3MFIA 3OS0A 1AT1B 2ILZA 3PV8A 4DV7K 4FPBA 1UWBA 5E3QA 3HULA 1QLNA 2HHHF 3HSZA 2XZTB 4ZP9A 4W5OA 3KLHB 1SJFA 2MKCA 1VRTB 3AOAA 2C2RA 1VQPS 4Y2IA 1Z2ZA 1X9WA 4CF1A 3DLKA 4H5RA 3GIMA 2OCEA 2HQGA 1HBMA 4IRCA 1LWCB 3H5UA 5GAHU 5KFTA 1I94K 3T5LA 4G1QA 3D1QA 3VVUA 1D09B 4WFYA 1SAZA 4GKKF 3CJ4A 2HHXA 1ASUA 2JSXA 3NDKA 4QIEA 2Q97A 3ZETB 4O44A 4ED7A 2HBMA 2OPSA 1E4GT 2FTRA 1BUPA 4QYRA 3VQSA 2OMLA 4X66K 2AJ1A 5I42B 3OUYA 4HUEA 3PEHA 3K2PA 3L2WA 1WEXA 4BWMA 2CJXB 2HBRB 3PZPA 1DT9A 2C2NA 1RT3A 4CZFA 4LVNP 3NF7A 1MW7A 1RTHB 4DV7F 2CNKB 2N82B 3UKUA 4X4SA 2IAJB 2V2ZA 1Q7YO 1IR0A 3VALA 2ZFHA 4ZIWA 2H4WB 1DQAA 4JI6J 4BRDA 1TL1B 3O4NA 2BA9A 1J9AA 3C2PA 2RPIA 2XMAA 4DR7J 4ZN3A 2AV5A 2ATLA 2XYHB 3CCVS 3O5BA 1C1CB 4HLBA 1W0HA 1OKJA 4ECSA 3Q2TC 4NLVA 5SZTA 4DV3F 5BPLA 2V68A 2E5IA 2HRYA 4ZLJA 1OY6A 1HNVA 4KHMA 1J5EF 1VQMN 2B43A 3FCVA 2FJEB 2P6TA 3QMLA 3W63A 4WK3A 4U8VA 4LFAK 2V0NA 2C2MB 3SV3A 4DSLA 4CIGA 1HNZF 4K0KJ 3SUPA 2BQUA 1BQNA 1VQPN 2CJ9A 4JKFA 5KPTA 2X1FA 5IM0B 2ASPA 4DHVA 2JHEA 4KYZA 2GHPA 1C0MA 1YIJN 2DR8A 1WEZA 4R0JA 4EBCA 2JC0A 4KH1B 3H90A 3CCMS 3LZIA 3OYJA 2G2ZA 4DR6J 1FKPA 1R31A 2CAJA 3MWTA 1U1QA 2UVVA 3R6MA 2C22A 2XGPA 4OHZA 4TU8A 3WIVA 3TR8A 1IBMK 2KVIA 2ZC3A 2WRMA 2V7YA 4DN0A 3U1LA 1HNIA 1GLFO 4ZVFA 1ZZNA 4B9NA 1T03A 3CMAN 4LF7F 1Q82O 5DG9A 4EAHD 3CE8A 2W25A 3H2UB 4CZHA 4JRQA 1E6YB 3IGVA 4HL9A 1GT8A 4Y0FA 3K89A 3J7YP 1BGXT 4FLVA 1TR0A 4H4KA 4OI3A 2CQCA 3CQYA 2JL9A 4FJLA 1VISA 3FK4A 3AAQA 3ZT3A 3J81O 3MEGA 3AQOA 4IFYB 2HQ3A 2H65B 2HS3A 1U02A 2EKYA 4M5NA 4GVBB 3CD6S 2EKNA 3IO1A 2VGNA 3CD7A 4IFVB 2WBMA 2YVSA 4G6VB 2MKKA 4EZ9A 1X9SA 3ILIA 3CQ8A 4DF8A 2PI5A 1YRTA 4JI7F 4QAGA 2XZDB 2WONA 1HX1A 5L8RC 3P6YC 1XNQK 4U67L 3W2VB 4CEZA 4ZN1A 4ES2A 3QB0A 1OH6A 3TARA 3MWBA 5F0WA 3WX4A 5E33A 2EC0A 3VQAA 5HRRA 2VQFF 2CQ0A 2NCKL 3HO1A 2F8TA 4CGJA 3L3CA 1Y5NB 4WIIA 3AO5A 3U9ZA 1YAGA 1NGCA 1YI2N 3OSPA 1KQFB 1RT1B 4TY9A 4OZ1A 1RAHB 3M9MB 1TKXA 3NF8A 2DKOB 2XS7A 4K0KF 1BQMA 1WOPA 5D77A 1I3AA 2NRHA 2CJAA 3GQCA 4PUOB 3HD1A 4LR8A 2W9CB 2UU9K 2IYGA 4LF7K 5DS7A 3TWZA 4UTGA 3IWNC 4JI7K 4RWXA 4Z37A 2BQRA 3GV7B 1FA0A 1W2BM 4DUYF 3MUTP 4JI3J 3EJMA 2HWTA 5L1JA 2DNZA 4URSA 2KW4A 4OJ1A 4E98A 5AQOA 1T9TA 1NK4A 2A2DA 4FWMA 4OPHA 4O8UA 3OR1B 3ENVA 3GZ7A 4J9PA 4GC6A 4BE1A 2OA8A 4KI6A 1OYDA 2CJBA 4PPZA 4DR4F 2UXDF 4CEBA 3P4UB 4BACA 4FF3A 2QL9B 1ZBHA 1SH3A 3HVRA 4W5RA 3KHRA 4Q44A 2YNFB 1ZBTA 1IVZA 3OL7A 1YJ9N 1MMNA 5K8NA 2IGIA 2R7SA 3I32A 3ZSVA 5IC6B 2VPWB 4WJBA 2IVNA 3OJUA 2G4BA 5DK5A 1S1UA 5AQWA 1RWMB 3AFGA 1N8RO 2J0SD 1IJEB 5B7WA 1ZAXA 2HFUA 2P5GA 1JLEB 4DV2J 4OGCA 3H1VX 2AHOB 5I3UB 5K20B 5B0EA 1W25A 2N3OA 4LQ9A 2FBVA 2Z1HA 4ERDA 3BEGB 2RQKA 1JJ4A 1LQ9A 1YK9A 1HYZA 4F2RA 4FJ5A 2V2VA 2HKEA 2WVCA 1QAYA 2B9YA 3D5MA 4USWA 3B8AX 5CHIA 1ZPVA 3TAPA 1B9FA 2JWLA 3N0VA 2WUSA 2OEKA 3NGKA 3VAKA 1Z25A 4RW7A 2DGUA 3PG9A 4L6V3 3NMAA 3R6GB 2FVPA 2J0QD 2F8SA 1NK6A 2F8EX 4RW7B 4CLYA 3AARA 3MAHA 2JRSA 1N33K 1WC4A 3CCQS 4KTWA 5B0GA 3CJKA 2QTDA 3F73A 5H9EJ 4ISGA 2NS1B 4Q45A 3IFEA 5EX3A 2KT5A 2QEXS 3EYZA 4JKDA 3M2RB 1SC4B 2EI5A 3WDOA 4JKGB 4QWEA 3TO8A 1WC6A 2C42A 2MPUA 5J1NA 1LWXA 1ZC6A 2ZM6J 3M4XA 3LDSA 1UJ6A 5KG0A 2OPRA 3NXZA 1T05B 3THWA 1NK0A 1ZA1B 5HATA 2YBVA 3SI8A 1IJJA 1XN9A 1EWRA 1IXKA 3T6JA 2FJWA 3CERA 4KY3A 3TAEA 3CPWR 5ETMA 3IAM9 4EHUA 4KREA 3AODA 2P1JA 1VC6A 3BQ0A 4H4MB 5FRMA 3TVZA 3TZYA 1KD1O 1HPZA 1C0UA 3FDSA 2V50A 2RE2A 3AH6A 4X4NA 1C0TA 1VHXA 1SI9A 1XWLA 2K8GA 3T1HK 4MYTA 5GADU 2FHJA 3O8WA 3R3TA 3FE1A 2BANB 1C0UB 2HHHK 4RNHA 1GLLO 3HFKA 4JYAF 5KGXA 4DQQA 2BANA 2ZH3A 2HAFA 3NCPA 4ED3A 1ZAWA 3Q8RB 4K4TA 4CJPA 1VRUB 2I6WA 4LF4K 3ILJA 3M32A 1BWVA 3B4DA 2H5IB 2ZD1A 2HURA 5CR4A 2FVSA 4PKIA 4NYFA 1IBLK 2Z56B 3IBFB 1NJXA 1SH2A 4KGMA 3VQCA 2HMPA 2OHDA 3KKRA 3RRGA 1UA1A 1YVNA 2LECA 1BIZA 3BZCA 4JEPA 3ZZRA 4BE2A 4CLTA 4OHWA 2K1RA 4YB7A 3VAMA 2WSCC 4DR2J 3PTWA 4DS4A 4ILJA 3W3DA 2MHEA 3OYGA 4L76A 4BDYA 1OIAA 1WJ9A 3LWLA 3PSFA 1GAOA 4N47A 2HHTA 5G0RA 3SMSA 2D1CA 2E5LJ 2XS2A 1NDKA 3ZTOA 3X3UA 1ZTWA 1HQUA 2CQGA 3LDLA 3KG4A 3VGLA 3TANA 1Y4ZB 3ZEUB 5JJBA 1M5PC 1PJ6A 1FT8A 1S1XA 4DPOA 1HLUA 4NL5A 3FUYA 4CLZA 5TKYA 4GV3A 3GP9A 5ITHA 1SC6A 3OR2B 4ISEA 1I3OB 2BDPA 2MKJA 1HR0F 2OP5A 3BDPA 2H51B 2CZ4A 3F0NA 5F9NA 2C2DA 4AHRA 2DFEA 4H4KC 3K5LA 4DUYK 4CERA 3KD1E 5IT4A 3A8IA 1NGFA 1RNHA 3EDQB 4AE5A 3HHNB 4WF9L 4LFAF 4H5TA 2KM8C 4GRSA 2RS2A 3EGNA 4EP5A 4FLYA 1LXJA 2HVIA 2R8KA 1UVKA 4ELUA 4FJ9A 2MY7A 3RBZA 4E7IA 3FZKA 2MDAA 2F9JA 3FFIA 1RAGB 3M8QB 1IKXA 8AT1B 2QC3A 1KEKA 4CECA 3SLCA 1YX2A 2MZSA 3V1QA 4LF6J 4FWPA 2MLXA 4WBFA 4FOEA 4F4AA 3AVHA 4ATNA 2M2BA 2B5JB 3GIJA 2ZOGA 5AQNA 1LEOA 1FK9B 1RT4B 2FLLA 2ZBIA 2VDHA 3HZ6A 2FPHX 4EP4A 2HFSA 4FBUA 1W7WA 1U47A 3QBWA 3ZZOA 1RWWB 2IAJA 1BHNA 2AP1A 3O1LA 5E3AA 4BR9A 4C7QA 4B1YB 4X4PA 3CC2N 3PW2A 4PRFA 2IVYA 4A47A 3WQUA 4CT8A 2ZH2A 4EBEA 4DL2A 3SPYA 1N32K 2DPJA 1S49A 4CP5A 4C8NA 2OSQA 5KFYA 3IN5A 5F3TA 5SWMA 3DDKA 2MZTA 4F4ZA 3M2UA 1F2GA 3AVNA 2X6NA 4C8KA 1V5VA 2CQDA 3PX6A 2HHHJ 1QSLA 4X66F 4JNEA 4DR1K 3QFWA 1FJGJ 1UAWA 3JSRA 4CT9A 3DFEA 3GG1A 3MN7A 1U49A 4WFXA 2F40A 5C24B 2B4UA 4AQYJ 2BEFA 2EFNA 3UWTA 3SNNA 3I55N 2PI4A 1IBLF 5T14A 4DMNA 4FJGA 1B7YB 1UVIA 2UUAJ 1KVBA 4K59A 4BRCA 3AA8A 3HFZB 2KH9A 3D7EO 3AA3A 3ATVA 4YB5A 2UU9F 4IRDA 2EC2A 2G8KA 2ZM6K 4CGDA 3J7YU 4M3WA 5F8LA 1V5IB 1RDWX 2QMWA 4MKVA 1VQNN 4DR6K 4GVLA 3W5ZA 2HBJA 4ZKAA 1FWPA 1REGX 3AA2A 3NBPA 1Q78A 5AQXA 3PSIA 4FZYA 3JAMO 2F5GA 1KVAA 2J9EA 3OA9A 1UA0A 1JQGA 1KP6A 3AXMA 1N33J 1FX4A 1HLWA 4LUBA 5IOLA 4LFCJ 4J9RA 1VSLA 4M7YA 4R0EA 1PBUA 4YOYA 4RNFA 3NLCA 2OH2A 1RDAA 1HKAA 1IKVB 1RCOB 3G10A 4W92B 2NXUA 2RRBA 2CQ3A 1HQUB 4CH1A 1H2UX 5T7BA 2CPXA 1LW0B 2VODA 1RBAA 3UCGA 4NCAA 4KJIA 2OPRB 3GCWP 4XH5A 4RL1A 3CCRN 4CQ1A 1S72N 1SJ1A 4Y65A 4RUHA 3HHLC 1E6YA 5CYMB 3O8MA 1RE1B 2FHJD 2J7UA 2YHBA 3UDCA 2XCPA 2E9RX 2CXEA 1L3VA 4JI5F 1IKXB 1VBZA 2ASMA 1HNXK 2DCLA 2XYPB 4CFDA 1QQNA 3W61A 4JI5J 2PMHA 2FGCA 4YUDA 1WUUA 4LF9F 1FRKA 2YQ3A 3VQ5A 2G8HA 4FWKA 4MYUA 3CC7S 4R79A 2YHAA 3OYCA 2VQEK 2QEXN 5IC4B 2Q3PA 3TNVA 2R7UA 3PEJA 1X0PA 2ZBPA 1C4AA 4KHNA 1NKBA 1S0VA 1G2EA 2P9KB 4IR9A 3RBEA 1NU0A 1S5ZA 1GXLA 3MMAB 5I42A 3MI7X 4DR6F 1S6PB 4K8ZA 2VKRA 3MCSA 4Z7CA 4IQMA 2P9SA 1KAYA 5AQKA 3U1NA 4DTRA 5H1SQ 3BYRA 3IWLA 5C15A 3BN7A 2O1PA 1XMBA 1C6VA 5AJ3K 3CO0P 3D1HA 1H7WA 7AT1B 2L9DA 4BRNA 2I7PA 4MK7A 1C1BB 5A8RB 5LSRA 2PO4A 3IRXB 1G99A 1ZA2B 4FS2A 1TL1A 2FSKA 3OXFA 4K42A 3AVCA 5H9FK 1HPZB 3I6PA 1LAVA 3CJCA 3G6XA 2KT2A 1TKTB 2VU5A 1EP4A 4LH5A 4DTJA 2K7JA 2HS4A 3TTDA 4XEIA 4QR0A 5AXLA 3OYMA 3TZWA 4OJRA 3QBCA 3OYFA 2G2YA 4RNOA 4F4KA 3HPHA 2PEBA 1HRHA 4P7TA 4JI7J 1TUVA 3LGNA 3O3HA 5JS1A 2RT3A 5J2PA 4W5NA 4NLBA 5CYQA 2DNYA 4DPUA 3CCTA 1UVLA 5EN1A 5DZ6A 2EFVA 4UY85 3JYTB 1KRPA 1NDCA 2XMVA 1R8CA 1CC7A 1S1VA 1TMJA 1KAZA 2NXNA 1U1LA 1HW8A 3CMQA 2HFNA 3NGZA 3MXMA 2BE2A 2CGJA 4NXNK 2O8BB 3HMJG 2J5AA 3BZKA 4L74A 1G15A 4J9QA 3ZSOA 4YY3F 4IDKB 2ROGA 2KKHA 4MT1A 1FRHA 4OI2A 5KG6A 1JL1A 4ZVRB 5IT0A 1SKWA 4PUOA 4OYIA 2W9CA 3IMQJ 3MD1A 4PY5A 1RGIA 3D0HE 1PIEA 3R2DJ 2F9TA 4ZK7M 3F5TA 4KC5A 2R42A 3GJRB 1T7PA 3FGUA 2HVZA 3KJQB 4ANEA 4CYUB 1DQ9A 5A2QU 4DXLA 2YWEA 1I1GA 1KTQA 2IMOA 3AVAA 5HP1A 1DZ5A 5KG3A 2ADBA 4NX9A 2GS8A 4FWNA 4H4OB 1C2PA 3NL0A 4LBPA 1AXQA 1R89A 4F4WA 4LF5J 4QYZK 1S12A 3HK2A 4GMKA 1VC0A 3AVJA 4OL8A 2FHKA 2E4LA 4QW8A 2Q43A 4AT1B 2HPUA 2HFOA 5C2CA 4FNIA 5C7PA 2DGOA 2MZ1A 4NB4A 2Y1IA 2XCAA 5F0XA 1R8PA 3M7VA 3TUZC 2H5EA 3KHYA 4MO5A 2DH7A 2NPFA 1VLOA 2UVWA 2VH7A 5KTQA 4U95A 3CD5A 1QSYA 1S77D 5GIPA 3BKFA 1B92A 1WSHA 2V63A 4TU7A 3A1YG 3HYFA 2P9KA 4UOHA 3R7NB 1RDRA 2BGGA 2F3JA 4CF0A 2MXYA 3TI0A 3A5OC 3CJ7A 3EO3A 4CHYA 2CG4A 3QIPA 1SVDA 4CJWA 4JKHA 2C3OA 4E19A 2RQCA 1GLJO 3A8KA 3SSQA 3V4IA 3DGVA 5K14A 5IV4A 1R6YA 4DV6J 2HHVA 2DNOA 1TKZB 4DDFA 4JS4A 1LWCA 3MHYA 4BRKA 3NP5A 1JB0C 3NH1A 2PMZD 2ATQA 3LP1A 4GO5X 1LOTB 2N3LA 1KVKA 1MROA 2R4FA 2E5HA 4BROA 2PMWA 3HZGA 4DR4J 3AO4A 3WUHA 2MKSA 4FLUA 3EXYA 3L0QA 2X1GA 2DXDA 3ULHA 5JVGL 1WSFA 3EKSA 2RQMA 3TA0A 4FVMA 4KHPJ 4NZ7A 4UUWA 4NLGA 3SXLA 3AO1A 1RT7A 4EEYA 4DV5K 3D6FB 4F36A 3KMQA 3IAYA 5JMVA 3NKYA 4JI2J 5HMWA 4ILLA 2VHGA 4FZXC 3TP2A 2DTJA 4ZJOA 4CTAA 4AL5A 2AYMA 5DM6L 3C66A 2DY4A 4JI8F 3AVGA 5C10A 3T19A 3R8YA 3OR2A 4RLEA 1QTNB 4Z4IA 4LREA 2CPYA 3MX5A 4G1IA 4QWAA 3IDHA 1FF2A 4LSZB 4RUBA 5C5JA 5LMNJ 1RKIA 4MLHA 4C2MA 3P39A 3PFEA 4DF4A 3JYTA 1O51A 5IWAF 3PX0A 3KUGA 5BREA 1QM9A 4EIAA 1NU4A 5DJBA 1PYTA 1X4AA 3PNIA 2W42A 2VFTA 1XMOF 1RWXB 3UKRB 1OH5A 2F4FA 4CHNA 3VQ6A 4MH8A 4DL6A 1IWAA 3LM9A 2WBNA 3KG1A 3IC1A 4KH0B 4FJHA 5GMKa 1UWBB 4HYKA 4GC7A 5AQIA 1GNKA 1Q8IA 4BR2A 3QEWA 2R9LA 3EVOA 4AM6A 2WOMA 3KG0A 4YORA 4YHHK 2QA4S 4JV5J 2DNGA 2OTJS 4DKWA 2H3EB 1HI0P 3R27A 3HKZD 2Z2MA 3RVCA 3AD8C 5A0YB 1S10A 2PZSA 2B4JA 1N5VA 4EO6A 2FY1A 2ZD1B 2HSEB 1ELOA 4C8LA 3TJ9A 2I38A 1CJUA 1HD0A 2D69A 2YY3A 3AB4B 1WWHA 2U2FA 3KFWX 3JTNA 2Q0RA 2UXCF 4RW8B 4JHDB 1ROFA 1MSWD 2IM0A 2I5JB 1B0TA 3D6TB 2LVWA 4FLTA 3HSTB 1AA1B 4MIBA 1WC5A 4ZCLA 2JJ4D 1JJCB 2A41A 2ZWHA 5EX5A 4C3LA 2QX0A 2FF6A 1ATRA 3THXA 2UXDJ 2ASOA 1KNZA 5D0HA 4DL4A 4DCJB 1BA0A 2GV1A 2X7IA 1LXNA 1UVMA 2YX6A 2FXUA 3KTQA 3I0RA 2VF3A 3GIKA 2VG7B 5C0YA 3SCXA 1KQSM 2M3DA 4RW6B 3MEGB 4NLYA 3I55S 3ZEUA 3V9ZA 3PLAA 3MPUB 5CD4H 1VSEA 3J80U 1Y64A 2LDIA 4I9LA 3M30B 4FYXB 4YY3K 3KLIB 3CC4N 1UOCA 4CJLA 5CYJA 4M5HA 2QG9B 1NZAA 4ZVTB 3BZQA 3OVBA 1VSFA 4IH5A 2ZITA 2XSFA 2UP1A 3OYBA 2OGUA 2XB2D 1A5VA 3MMBB 2V51B 3RBDA 4BRAA 1NUEA 1CJVA 5LMUJ 1CPZA 2JNJA 1XMQJ 5AE1A 3UD3P 2GUIA 1NJYA 2AWZA 2BJ9A 1R0AB 2Z1JA 4GW6A 4GV9A 4DV2K 3DOLB 3EWGA 4CJ3A 3K9JA 4LSLA 3A12A 3L7UA 2KRBA 4FK2A 4HR2A 2GJ2A 3RWUA 1IM6A 1RABB 1NSAA 1U2VA 3MXHP 3W7BA 3DRPB 3W2WA 2YKNA 1BISA 1X3NA 1T44A 3VF0B 4BRQA 4OX7A 3T1AA 4ZVSB 5KFKA 1NLKL 4PYAA 1Q0NA 4U67Q 1SQEA 3UCUP 3K5OA 3D66A 2GQCA 3FCWA 1MWMA 2YNHB 2BUPA 4OI0A 2AP6A 3IS9B 1SJRA 4WTYA 1WAJA 1KSPA 3ICLA 3OTCA 3ID6A 1DTTB 4HTJA 2NZTA 2GO8A 4GKKJ 4PG4A 2VKZG 2LDYA 4BR0A 4I2QB 4DQRA 2RUSA 1IG8A 4ID8A 3D4JA 1RAAB 2KXNB 4C8MA 1QHTA 4O5FA 4X65F 1EARA 1IBKK 2BTFA 1U6FA 1O1WA 5F0UA 1QUPA 4A8OA 5B0DA 4J7CA 1RTZA 2BYCA 3W62A 1NBEB 1CJTA 1XEZA 3SAHA 4OI6A 4CK2A 1MU2A 1GQEA 5KFUA 3CC4S 2NLWA 3H46O 4ETXA 4CYUA 4OZJA 3U9DA 3OYNA 1RAFB 2Y0SD 3THYA 2DR5A 2D74B 3G86A 4CBXA 5J1PA 4I6MB 4DSIA 3GDQA 4M1KA 3Q8VA 5HROB 3FBCA 1ILYA 4Q2LA 4A59A 2J8AA 3G6YA 4MMOA 1JWWA 2KVQE 1HHTP 1SQGA 4TNOA 5KAKA 2X1BA 3VQ4A 3BR8A 5E84A 3WXLA 1GLAG 1UTAA 1V4SA 1PO6A 1HIYA 2E9ZA 1G6BA 2YNIB 5LL6d 1FJEB 4K4WA 1TP7A 1HD1A 2OPPB 2DNQA 4IEIA 1FE4A 2LCWA 4KRWA 1LWFA 2OEMA 1YTAA 2WTFA 4OV6A 2WFBA 2Q6CA 3BP8A 3HT0A 4A4JA 3MK6A 4QU6A 5F3ZA 1S6PA 2FUG9 3EICA 4FSVA 3RYLA 4JLHA 2VBYA 1Q18A 2OPQA 4X62K 4ES3A 1FVSA 2MQMA 1DEJA 4H03B 4F67A 2WONB 1SJ3P 4PWDB 2E1ZA 3VGKA 3GV8B 2JFDA 4B3MJ 5J2QA 3J7Z5 1UP1A 1JXVA 4O23A 4CGIA 2VWJA 5HAOA 3DRYA 3NCRA 1I51B 1OY9A 3O3LA 4ZLLA 4E1MA 4OPKA 1NH7A 2ASYA 1QY7A 1CBKA 5FPNA 4WP8A 3C14A 4DCHA 3SDEA 2UXBJ 1RT2B 2XHWA 3FCHA 2R7TA 3BQ1A 4BR7A 2DD8S 2KLAA 3NS6A 1K0VA 2E1MC 3I33A 3PIPL 3H4BA 1B7FA 4KRFA 2P9CA 3SCIE 1WI8A 2Z57B 5KG7A 1FCAA 2AYEA 1G7CB 3AVFA 3GJSB 4RBVA 2NRXA 1CXQA 3MR7A 4BWJA 3L4BC 1BDGA 1UEVA 2HHUA 1F9HA 4ILHA 1RYSA 1AW0A 4CF8A 5EWFA 2AD9A 3AGKA 2C3YA 3K17A 4X4VA 4WZMA 4NYPA 4CD3A 4I64A 2W9BA 2DRAA 4KV8A 1SV5A 1WEYA 5BR8J 4CM2A 1X60A 1S72S 1N36F 2KDOA 6FDRA 5KFCA 3MM5B 1A5WA 4A57A 3A5MC 4CK1A 2UXBF 2HZAA 4HI1A 1NSKL 4NEZA 5AQLA 3S1TA 3TVYA 1FDAA 3KYLA 1IWGA 3PJXA 4RJVA 4ZJLA 3LPUA 3TVKA 4DTUA 4L75A 1FD8A 4DL7A 4DUZK 1T94A 1GXTA 2G0CA 2XY5A 4JK7A 4OZNA 3VEOA 4CO3A 1ZAVA 3DLRA 4JKGA 4FF1A 4YOEA 5D4LA 2QE5A 1K9MO 4CM0A 5D3GA 3KDNA 3F9KA 1RCXB 2RHQB 2UXBK 1YBAA 2DNPA 1Y5IB 5AQGA 4U7UD 1EO1A 2CUYA 3PO4A 3OL8A 3CCWA 4B1WB 3FNNA 4EYHB 1A5XA 3EDRB 3FZHA 1NNEA 2DGVA 2XGQA 4M5GA 1PKUA 3K59A 4ZVEA 4ZPCA 2HWHA 4Z4EA 5AZIB 4JI5K 5GAEU 2C3MA 1YG0A 4FJIA 1RXOB 1LW2B 1HNXJ 4XDCA 4ZTJA 3OL9A 3PO5A 2PDAA 2A5XA 4NYNA 3TQ1A 3OBYA 2ZHAA 1RTJA 1GXUA 3MD3A 3OPKA 3GSIA 2XLKA 2AGPA 2Z58B 1W26A 4QOZB 4IQXA 2C1EB 4DV6K 2ACMA 3OHRA 4H0YB 4Z4HA 4YDUC 4ECYA 2CKWA 2P51A 3GMGA 3VOVA 1C0GA 3MM9A 5K8OA 1WORA 3E1YA 4C1NI 1NMEB 2KXHA 4DN9A 2R7XA 3NGDA 5KFZA 2PYLA 4B02A 3D54A 3W2WB 3KWIA 1WDTA 4FKXA 2XG8A 2APOA 2BW2A 1S9EA 1WD6A 4IFVA 1VMBA 1S0MA 1S57A 2C3UA 3KLHA 1IKVA 3EPIA 3KNAA 1DKGD 2LLZA 4HCBA 1KS2A 4E7HA 4JD2A 2RRAA 2KJVA 1RWOB 4CLUA 5ADXH 2RSQA 5F2RA 4CZEA 4FYWB 1FX2A 5F1XA 2ZHOA 2IVOA 1RT2A 1S6UA 4A61A 1HNWK 3CJ1A 2KKZA 1YZ7A 2V7ZA 4DTPA 2DHXA 1HL6A 2N7CA 5KFEA 4AYBD 3OFFA 1N32F 4XH1A 3ZSQA 3AV9A 1Q79A 2WVBA 3DLGB 4DFJA 3MECB 2ZDPA 3OBIA 1P8ZA 3MCPA 2HBQB 1RHQB 1YLXA 4TN2A 3DRRB 4ECWA 5JVHQ 2VIHA 3PIOL 1AZSA 3OSNA 1HNWF 3MMCA 4J9NA 4QS9A 3ZXWA 1S7HA 1Q81T 1XMOJ 3HHDA 3GG0A 1EX8A 1FERA 1UW4A 5KFRA 1NGGA 3EGVA 4KHQA 4NLPA 4BCAA 1NGEA 4L72B 1H38A 2NYHA 1S59A 2CQ4A 1NAQA 2CH6A 3A8EA 1LFWA 4KHUA 1R3NA 4V19S 2JLGA 1VJQA 2XS5A 2DFHA 3BF3A 4XAKA 4B8AB 2YHWA 1VK8A 1FRMA 5IT9U 2MQPA 5EGYA 4WCEQ 2CNOB 1HR0J 3C46A 2BH1A 4EYIB 1B0VA 2R7WA 1TYQA 4WKRA 4XIUA 3CIZA 1WSIA 1YBUA 4ECVA 2ZGZA 4K2JA 1LK7A 4ZTFA 3LA0A 4USUA 2QM1A 2LA6A 2H5JB 4BC4A 3MPYA 4NOHA 4JI0J 5BN8A 1S6OA 5AZJA 1TV6A 2GIFA 4CEOA 4EMDA 1KQGB 1Y0HA 2P5OA 2XM3A 3MGJA 3L9ZA 3M8PB 4IR1A 3R7SB 2ZH5A 4O0IA 4BDZA 2QN6B 3D28A 1VSIA 2PC6A 2X51A 2RE1A 4B9MA 2LQ5A 2F4VJ 4DPYA 3R9LA 4DR3K 1TKXB 2Q1LA 1YTYA 4DQ8A 4V1Ak 3LL3A 3M3ZA 1S9GA 4RBUA 2O8EB 3QGHA 1I39A 4J9UE 1UPMB 2ADCA 2UZAA 4IDKA 4OHYA 4A5BA 1OO0B 3UD5A 1J5EJ 4CEQA 2A0FB 3AHPA 1KLNA 1UFLA 1EQMA 2HK3A 1SXLA 5L9XA 3EX7B 4BVPA 5K8PA 1EZZB 4G3IA 2DK2A 4F25A 4B8CA 1KCFA 4HT5A 3M05A 4CRJA 2IFXA 4HEA9 2GJFA 2D3UA 1IQTA 5IXUA 2QLWA 5F8GA 4N77A 3CD6N 1U1PA 1RDDA 5HVGA 3HSCA 2CH5A 3PXGa 3TZXA 2E29A 2MZJA 1S5JA 1U04A 1HARA 4H5WA 1E3MA 1IBKF 3I5BA 4RCHA 2QK9A 3THTA 3AGRA 2IS3A 3VAHA 4KE5A 3I31A 2YWWA 3NGIA 3M8RA 2L48A 3IBCB 2HNZA 3TAFA 4WQ5C 3HM9A 3T5KA 4FLXA 3DXBA 2IVPA 3VF4A 4QR1A 1WN7A 3R6LB 5MAOA 4C0OC 3FZFA 1M5HA 4G1QB 4CIEA 4P2MA 2NR0A 2UUBF 1F21A 2MEWA 3T69A 5LXYA 4ECRA 3W64A 2KG1A 4FCYA 2XEXA 4O44B 2QYGA 1NSPA 4OI4A 2OI2A 4JBCA 4WFAL 3W9HA 3R5GA 3C6TA 4YOVA 3L8BA 1RLDA 5F8JA 2QWLA 4IG0B 3MEDB 3Q0AA 4GO7X 3AA4A 3PKMA 3HVTA 4IXCA 1RHJB 5HQMA 2BBEA 4JI6F 3NGYA 1IR2A 2BM1A 3CMES 1HWKA 4KB1A 5AE2A 4IZ9A 1S4FA 2V2KA 2QGFB 1EKEA 1NHKL 1N5QA 1RAOA 3DRSA 1R8HA 2R8JA 1VLYA 4ANDA 2FQQB 3P5JA 1JLAB 4NXNF 1QVGM 1VQON 2VYPA 3CFPA 1LK5A 1IUJA 4JV5K 1ZM2A 2E20A 3M8YA 2I7NA 5DQGA 1TELA 4A8MP 3BGRB 1ICEB 3NGUA 4DLEA 4OHVA 2CIMA 1LV5A 1RTDA 2NPIA 4JOUA 4ZPWR 2ZUAA 4AHSA 1U25A 1X5SA 4H54A 2EG1A 2D0CA 4LF6F 2QSFA 3BF4A 1KHWA 2MQLA 2DRBA 2VG7A 4OX9J 1W2BR 3Q8SB 4B3MF 4M41A 1SPBP 4EBDA 4Y34A 3BSOA 3GILA 1H0HB 5HMZA 5AJ3J 5M1FA 1REVB 4FP9A 1U2CA 1M5OC 3SAGA 3QNNA 4PG8A 1P9QC 4UW2A 4AFFA 5D78A 3LP2A 2E7VA 4WFNL 4M95A 2V34A 4NLDA 3IFRA 2ZH9A 4RPFA 3WC0A 4DPXA 1JLQB 4IBNA 2DH9A 4A8SA 4B9VA 3DXKA 3VTIA 4CF2A 2NSCA 3UN3A 3CVKA 4R8UA 3G0ZA 4L3QA 3VGUA 4OJ3A 2XSJB 1MWKA 2EEYA 3PW4A 4JI2K 1VSHA 1IBCB 1RWNB 2BE9B 3H5YA 3SQ2A 4I6YA 3DLHA 4RWTA 4PQAA 1U1MA 4V19J 4CLPA 1XUPO 3U1MA 2AGQA 5I3UA 3PUFA 4KHPK 3AQPA 4IOAQ 1S0NA 2ZZMA 3C6HA 3AA9A 1BO5O 3C15A 5J2NB 2LEPA 3U27A 1HHQA 1G1XA 3I82A 2V5HG 1FFGB 2EHGA 5HQ8A 5BR8F 3VQTA 5J2NA 4CDIA 3ETMA 4LRDA 2NRRA 1S1TB 1YVFA 1WF2A 5KT7A 3HVTB 1KR4A 2OEJA 3QNOA 3P38A 2R8IA 1MNEA 3W5YA 4KI4A 3EN9A 3DLKB 5AQHA 2AZ3A 1Q95G 2MZQA 1K1SA 2V69A 2JGUA 3HX9A 4FM0A 3OYAA 5GAGU 3RGIA 1XQIA 5KFHA 1PJ5A 3FJ2A 2J4RA 2V8PA 3NMRA 2PIIA 2L9NA 1UPPA 2YTCA 1Q86T 1BD6A 3V1RA 4MFBA 1D9DA 5IFMA 3BUZB 4Z4FA 3O08A 3E51A 1EETB 1RAJA 1GOBA 5KOWA 1ZTTA 3VVTA 3TAQA 1WI6A 2SXLA 4DB3A 5F8IA 3KMSA 2YWGA 2YWKA 1N33F 2EBGA 2QYCA 2P9NA 3QFUA 3V2UC 5A8WA 5CCLA 3CJQA 3PACA 3OJSA 5HVHA 5C24A 1WTFA 4NLWA 2LQBA 4CO1A 4Z4CA 5BJRA 1TL7A 1ZBIA 1FEEA 3EM1A 3J81j 2FGOA 2JWKA 1AB8A 4BC5A 3FBBA 1EKSA 4DOZA 1VQ4N 2GAHC 3C6TB 2MGZA 3DM2B 1QS4A 3ZZTA 3DOKA 4FVUA 5KFVA 2LQ9A 1GLDG 4DTNA 3C14B 4LF5K 2QO3A 1T6CA 4RW4B 2GZOA 4IO9Q 3T3FA 5DM7Q 3CCUS 3C16A 3S6EA 2W9AA 1KQSR 3CCVN 3HTVA 1RHMB 4RU9A 4X62F 3P83D 3QESA 3MXJA 3SV4A 3A3NB 2O8CA 1NGAA 2M0GB 2E7XA 2YX7A 3KXDA 1TK5A 3UKUB 1Y3JA 1S79A 1NM1A 3SFGA 3ZLJA 3FRZA 2KYXA 3L6QA 1DTQB 3CYMA 2VC1A 5GAHI 4FWLA 3K5PA 4I69A 5KOXA 2E66A 2BV3A 5HL7Q 1S1TA 4BBYA 1CJKB 3TUPA 1SZ2A 1G4CA 4NXNJ 4RUCA 3G8TA 4OYBA 4A8FA 2JX2A 1F5BA 4FJNA 3JS6A 2XHCA 4X4TA 4K5SA 1GK8A 2ZJQL 4LBIA 4CCHA 4ZVOB 3UPFA 3CJTA 3C6UB 2OUGA 5DMRA 2VPXB 1XTZA 1GLCG 3SMPA 3QATA 2W41A 2O8BA 1R6VA 2PBDA 1LNQA 3HHEA 1YT3A 4FOIA 1HKGA 3ATUA 5CABA 3V4MA 4WTOB 4FZVA 2JC1A 3OYKA 3ZT0A 1FW6A 3LDPA 1QAIA 3RMCA 1JK9B 4RR5A 1L3UA 2KHDA 5BR8K 4YY3J 2FIUA 2B5JA 1JLFA 2HNYA 1FJGK 2DISA 4E1NA 3UN5A 4CJEA 3SQGA 3MMAA 1U4BA 2A3ZA 2DEIA 4BREA 1U0HA 2IIRA 5HP1B 3MR2A 2VICA 3MZIA 5A6WA 2RD5C 5IZHA 2ZOMA 1ZBUA 5BPNA 1KDNA 1T3NA 3VQPA 3OXGA 3THPA 3FRYA 2OAUA 3ZCMA 2I0XA 3L2QA 3EPGA 1IG9A 3MDFA 2IOCA 1K8KA 1V3ZA 2XMKA 4UZCA 4E0DA 3V9UA 3JQJA 1N48A 1VFJA 3IXQA 2F9WA 5KG5A 2M8HA 1MN9A 3L95X 2IDEA 1UFWA 5IWAJ 3E01A 2MYFA 1HW9A 3SBMA 4RW6A 5D0GA 5HK4A 5E26A 1PJ7A 1BWFO 4UZBA 2Y8YA 1JMTA 2HVDA 1TL7B 4J2EA 4Y2MA 5DETA 1TL4A 5D3GB 5DDOC 2F7VA 1YTUA 2ZBQA 4QPTA 3UNYA 1T9WA 3BS9A 4RWWA 2WCXA 4L8RB 1ZM4A 3R9PA 1SQKA 2BM0A 4M5DA 2ZNZA 2E1CA 1LFPA 4FXDA 5EX0A 3WEEA 3R5CA 3F41A 4CLKA 3GFYA 3D3BJ 1N34J 4NPOA 4ES1A 1FNOA 1K6YA 3VR1A 1K8AO 3MM6A 4P10A 1JXEA 3I0RB 3BV8A 5GMDA 2HHWA 4IOXA 4CWBA 3RMAA 3J7ZO 2DR7A 1TK8A 2D7SA 1JCEA 1YJ9S 3Q24A 2WW8A 4QIVA 3TU5A 1TKDA 2YPZA 3IWXA 3DYAB 3G82A 3PY8A 1HBNA 5DDPC 2JFKA 1AFIA 4DFKA 4AXJA 4Y2KA 3U3GA 4DV0J 3JXUA 5LJVA 2CQHA 3MMBA 3M6WA 1R8AA 4WZQA 4BLGA 3OLBA 1FO1A 1Z1ZA 2W8LA 4E7JA 2H4YB 5L39A 3N4QA 4A8KA 3AVIA 5F8HA 1NG9A 4KV8B 1X3MA 1VBKA 4LSNA 3BH7B 3U6FA 2I5JA 4CFCA 2VG5B 7FD1A 3ZT2A 2A10A 2UUBK 3DLEB 4G9ZA 4CHOA 5HBMA 1N4LA 1S9FA 2HK2A 1VQNS 1B4SA 5FPEA 4WQ4C 3FQLA 2P9LB 4FLZA 1N5YB 3HHLB 3GYGA 3KLFA 4WKYA 3CJ0A 4LF6K 3N6LA 5I3PA 4NWBA 1YHQN 2QXFA 3CCJN 1IV0A 1NK7A 4NA2A 4CIOA 4H8KA 4JRPA 4CESA 3RSEB 1KC8T 4KB0A 2B0GA 4CNYA 4DR7F 1QSSA 2V8VA 4ZPBA 1TUWA 4GMJB 3I9V9 3HSDA 2W7PA 1U0SA 1HYVA 3SQOP 1N32J 2E1RA 1DLOB 2J0WA 5K14B 2BRKA 3D68A 3NGSA 3T1HJ 4J9OA 2GNKA 3QNWB 3TSPA 5BYSA 2V4JA 1UETA 2IC3A 4OQJA 4OYOA 1MWQA 4JI2F 3GE1A 1RGVA 3SCJE 1NGIA 3ALYA 2J0XA 1JL2A 4DL0C 2DT9A 1X4DA 4KHPF 1QD1A 4IWVA 2D0BA 2E5GA 5LM7E 2KL8A 4B08A 3E3XA 4N8OA 1NJZA 2UVUA 2CYYA 3W1YC 2IA0A 1Q9YA 4NO7A 2J6UA 5CZVA 4DV4F 3CGIA 3G82B 2Y8WA 4AHCA 4C23A 1QJHA 4DUTA 4O0JA 1BQXA 3LGMA 1RT7B 2GMJA 4IUFA 3HJFA 4UUXA 2B4OA 4BY9C 4M3TA 3FBFA 5ETQA 5TKWA 3CJRA 3W9JA 3IM8A 1M5KC 4ICLA 1TL3A 3WEEB 4B1ZA 4Q0BB 5A2QO 2V2QA 2OKQA 2P9PB 4ID5B 3DRSB 4JI1F 2QKKA 1KN6A 2RH3A 1Z2LA 5IT9Y 2OZMA 5DQHA 3MN6A 4B1UB 3HOSA 3HSJA 3SFUA 3KLGB 2FF3B 1F60B 3Q8UA 5K8MA 4AH9A 4GKKK 1JIHA 5IT9O 1JXBA 1VK3A 5HBMB 4RW9A 1GMWD 3DYAA 2HF4A 3H8YA 1DJ0A 2NLXA 3KLGA 3PVXA 2CA9A 1H72C 4B3TF 2A6AA 3DXSX 2ASJA 1FWKA 3ZZZA 4BRLA 4PG6A 2XI3A 2LMIA 3UCZP 1S4EA 3HF5A 2KZZA 5G0RB 2ASLA 4UQTA 2BJ1A 1M5SA 3LAKA 4IJNA 2KZMA 1TK0A 4NCGA 3QT7A 1ZPWX 2OTJN 1PILA 4LF2A 2P9EA 1MDUB 2OZSA 1YF5L 1WOSA 3HPGA 2ZH7A 1TTHB 3LGHA 3DMJB 4CEDA 2ZJRQ 1KQKA 2MKYA 3JQKA 4RG8A 2LA4A 3OTOJ 1UAXA 2K06A 1T0TV 4DR3F 1S1VB 1UW9A 5DG8A 1WHXA 3AAPA 3QQCD 3O6QA 3BO4A 4AHUA 2G8IA 3R2CJ 4ELVA 2RDJA 2RU3A 3EZWA 4KAIA 4U7UK 2QWOA 2GMHA 1T9XA 1VQSA 3A4TA 2FHOB 1HNZJ 4NYOA 1RU1A 2V4RA 4QQBA 2YX4A 2EFQA 5AQUA 2BKNA 4Y0WA 2G13A 4ZIVA 2LKZA 2BE7D 3NOCA 2KO1A 4P2SA 1RTDB 2Z30B 3I4HX 3OUYB 2YCHA 3O4WA 1XHZA 5A8KA 2WW4A 3WNGA 1EETA 2M9KA 2BZ2A 4UOCA 3CNQP 2FC0A 1GOAA 1WDDA 4XO0A 4BHQA 2R7VA 5AQRA 3RRKA 2OPQB 1OVQA 2GTDA 3FEYB 2RVJA 3MEKA 4O4GB 3BB5A 1RISA 5KG2A 3CXCR 2P9NB 4Z0UA 3VEYA 4D3GA 1U48A 2J9DA 2BRLA 2V94A 1NK5A 4PXDA 4DL5A 1FESA 1D5AA 5KT3A 2UV8G 1TUUA 4Y6IA 4Z94A 1O6XA 3ZFVA 3M6XA 3Q2SC 2N4CA 1D8YA 2V52B 2YJEA 5HMXA 5LMUK 1YWXA 2YHYA 3R97A 2UUAF 3C7NB 3JAMU 1FRXA 3K57A 1HMVB 3MECA 4F4XA 2XC9A 4NASA 3ENWA 4OMFG 4C97A 3M32B 5KRTA 1RT3B 3TSUA 3DRRA 4KO0A 1XC9A 2HLUA 3GL1A 1YITN 1W7AA 2G2OA 2MLYA 2RAQA 1JNRB 2E6LA 2DXEA 4M3ZA 5ETRA 2VZ9A 4KO0B 4OGEA 4FXVA 3UDEA 1Y10A 4TU9A 3PJ9A 4PWWA 2BKOA 3N79A 4NCBA 2R2UA 1HQ2A 3F9MA 4U7CA 3TUIC 2VBWA 4F04B 1ZOTA 2IPOB 3KLEA 4EU0A 4BRHA 5D15A 1X5TA 4EFAC 1SS6A 4BR4A 3FEZA 2DCUB 3C8YA 5DDRC 3EKUA 3VGVA 1HUXA 2Y3YA 3I87A 2UXCJ 3VQDA 2WTUA 4OYWA 3FZLA 2YPYA 2RUGA 2RU9A 3CF5L 1RBVA 4FBTA 1FEHA 3CCJS 3PW7A 1XMQK 4CVNE 1WKLA 1XERA 2EW9A 3O3FA 2B56A 2ZWOA 4C11A 3U02A 1GMUA 3FBEA 2GC8A 4CZKA 3CJSA 3RG6A 1R59O 2WK4A 2MQOA 3SI6A 2W40A 3G87A 3CWJA 5JS2A 3HP9A 3IR6B 2MQQA 4KHYA 2CQIA 1XIQA 2AJFE 2O4IA 4ENOA 3PYDA 3MEEA 2D1KA 3M9OB 3UO0A 1VJWA 3ENQA 4A8QA 4FPAA 2UUAK 4CJQA 4DR1F 4W5QA 2XHBA 3AA5X 3JSMA 2KTQA 4J2DA 4BE0A 5IS2A 3J80O 3RB4A 1WBDA 3H08A 4C98A 3UKRA 3M6UA 4WCEL 2EWSA 1VR6A 3NOGA 2MSTA 1IN0A 1CULB 3ULEB 3T1HF 2XI2A