5DJ7A

S. erythraea trypsin acyl-enzyme
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
230
structure length
230
Chain Sequence
b'IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLEAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPDAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQINAGAVSAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title High resolution structures of S. erythraeus trypsin throughout the catalytic cycle
rcsb
source organism Saccharopolyspora erythraea
molecule tags Hydrolase
total genus 56
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dj7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dj7A01
2XW9A 4H42U 1YYY1 1CT0E 4K1EA 1O3AA 3GY2A 1VGCC 2AH4X 1GJAB 1V2QT 2GMTB 1XXFA 4AFUA 4R0IA 2OINA 1LDTT 1C4U2 1C5SA 3I29A 1GJ7B 2FOEA 2A5IA 1MTUA 1K22H 5EQQA 4GLYA 3MU4A 1SBWA 2FO9A 2W3KA 4INLA 4JYVH 2VNTA 2TGPZ 4CHAB 3LGTA 4PROA 1E36B 3RXJA 3TLOA 3ZV9A 3A8BA 1MBMA 4B2CA 1NESE 1EP6A 5LPEA 2AEIH 1AUJA 2VB0A 3HPTB 3UNRA 5IDKA 1J14A 3TITA 1XUGA 1BMNH 2HNTF 4OS7A 1ELDE 1UMAH 1LQDB 2WV4A 1SB1H 3SOSA 1CGHA 2P8OB 1YKTA 1NTPA 3OY6U 1D6RA 1P09A 1UK4A 1RIWB 5E2OA 3DFJA 1T8LA 1ZGIA 1XUKA 3T2NA 1V2MT 3T26A 1Y3WA 5JPMH 2ZFFH 1TRNA 4JZFH 1EJNA 4Y71A 3Q3KA 1HJAB 1O3MA 3T27A 1O2YA 2BLOA 3ZZ5A 2BLQA 1MZAA 1YPJH 5HGGA 5DKMA 1CVWH 5CMXH 3GY8A 3QK1A 1KIGH 2WYGA 2J95A 3VB3A 4K5ZA 4WH6A 2BVRH 3LOXA 3P8GA 1ANDA 4NIXA 5FBEA 1TNKA 2TGAA 1EPTA 1O5DH 1DWEH 2PW8H 4ABBA 3RC4A 2BDAA 1SOTA 1ELVA 3A8CA 1C5YB 2H6MA 2ZIQH 1O0DH 1SHHB 1DSTA 2BZ6H 4Z6AH 1NN6A 3ZZ4A 1MQ5A 1IQNA 1V2NT 1V2JT 2AMPA 1NRQH 3V13A 3DD2H 4ESTE 3RXRA 1HGTH 2PKSB 2R2MB 3H7OA 4VGCB 1BA8B 1W0YH 2XBYA 3A85A 3GCOA 1RTFB 4CHAC 2BY5X 2VIPA 3E0NB 1HAPH 2FTMA 3A87A 1MKXK 2CN0H 3K6YA 2KAIA 3VXFH 3UQVA 4X2XA 1GMCF 4AORA 4XSKU 4UFEH 3UR6A 4IS5A 5G4BA 1SQAA 2QXHA 3P8FA 9LPRA 1C1NA 1RIWC 1E37B 3GY6A 2C4FH 1ZOMA 2BHGA 1RS0A 2J4IA 4CRCA 1C2KA 3C1KA 3GISB 4FUFA 1SFQB 2DE9A 5E0GA 1O2WA 1YPGH 4B75A 2ZU4A 3HATH 1IQHA 1WUNH 4QT8C 1F0SA 2BQ6B 3QWCH 1AI8H 3FAOA 2Q6GA 1OP2A 4WWYA 1W12U 3RXSA 1TBRH 2OD3B 3MNCA 1UK2A 6CHAB 4YLQH 3S9AA 4KGAA 4JZIA 1AVXA 1O5FH 2PGBB 5EXMA 1A0HB 4B76A 1NFUA 2G4UA 1AFQC 1KTTB 2Z9LA 5C20A 1O2TA 3RC6A 2ZG0H 2QV1A 3JZ2B 5DP6A 1C1PA 2Q1JA 1YF4A 3KQDA 2ZO3H 2AMDA 3ATIA 1GG6C 3M3TA 2AIQA 2GCTC 3KN2A 2C8ZB 3MOCA 2VINA 2BX4A 1DANH 2RG3A 3ATKA 1MU6B 3M3SA 4AFQA 2PTCE 1O3NA 1A7SA 4Y7BA 3STIA 2WPIS 1L1NA 3SHAH 2ZFRH 2FOAA 2OBQA 2OLGA 3SGQE 1BZXE 2FI3E 5H4IB 1PPGE 2VVUA 1RTKA 1TPSA 1P8VC 2R3YA 1FN8A 2G55A 3FZDA 4YT6H 2PSYA 4D7GA 3PMHB 1EPTC 1RTLA 1ZTJA 3MO3A 1G3EA 3VB6A 3SJ8A 2J34A 1LPGB 1Z1IA 1SGIB 5A0CA 2FESH 1H9IE 1SGYE 5AHGH 3OY5U 4DGJA 2ESTE 1PPCE 2FP7B 2A7CA 3BTFE 1C1WH 3SBKA 1PQ7A 1UTPA 1NRNH 3VPKA 3LGYA 2OTVA 1C5WB 5GPIB 1W10U 1OKXA 2PHBA 1IQGA 2GP9B 1YPHE 2I6QA 3ZZDA 4ZKNU 1O32A 3MH5A 2IOTA 4ISNA 3UUZA 1XUJA 1OYTH 1O3IA 1NFYA 2BLWA 3DUXH 8GCHG 1GHYH 2CHAB 2FX4A 4BXSA 1F5RA 3ESTA 5EODA 1ESTA 4U32A 2PUXB 2Z9GA 1KSNA 1NRSH 1SGQE 1DX5M 3GDVA 4GHTA 1TBZH 1GBBA 3M61U 1U6QA 2C90B 1V2PT 2VWNA 1GDUA 4UD9H 1UTMA 4IGDA 3GCHB 3GICB 5JBBS 1DOJA 2GVFA 5EU8A 1MTNB 4X2YA 3PO1C 1T31A 2FOBA 1GBJA 4MG3A 1OPHB 4ISLA 1FY5A 2Z6BD 1MQ6A 1Y3XA 2FZZA 4J1YA 4MVNA 4AYYB 3FFGA 3RMNH 3LONA 3A81A 2STBE 1FLEE 2BB4A 3PLBA 3SU0A 1UVTH 2FOGA 1KYNA 1GHXH 1TNJA 1AZ8A 2VWMA 2HRVA 2OQ5A 1T4VH 5DO4H 3KGPA 4AG1A 2BY9X 1FN6A 4ABFA 4X1NU 5TJXA 2XC4A 1THSH 1WTHD 4H6TA 3F1SB 4NCYA 4WXVA 5J4SA 1EUFA 1CQQA 1OS8A 3QDZB 4DW2U 1A46H 1S5SA 4LZ4B 1QRXA 2OCVB 4CH2B 4FUEA 1UTKA 4MPWA 4IN1A 1ANEA 3VB5A 1XMNB 1C2EA 1O37A 2XCNA 1P03A 1WU1A 1EB1H 1QL9A 4ZKOU 3MWIU 2SGFE 3PM3A 1GHAG 1T8NA 2VGCB 2PUQH 1Q3XA 1D3TB 1A3BH 1HAHH 3RXIA 1ZPBA 1QCPA 2R3UA 3W95A 1GMHG 1G2LA 1O34A 1W8BH 1SPJA 1O5GH 3I77A 1FIZA 3M5NA 2HVXA 4I31A 2ZCLP 1XXDA 1CA0B 1JIRA 2ANMH 2ZA5A 1P2KA 4O3UA 1NU7B 1DS2E 2GCHF 3BTQE 2ZGBH 1CHOF 3L6PA 1RXPA 3SHCH 1TGTA 2VVCA 4K1SA 1FY4A 3UPEA 3O8CA 4A92A 1ZR0A 2BDGA 3BEIB 5K7RA 1O2LA 2NU2E 2QXGA 2SNWA 3RLWH 4NSVA 3A89A 1QA7A 1QB9A 3E0PB 1C9PA 1WBGB 3A88A 1BRBE 5T3HA 1BITA 2P95A 3GY4A 3TK6A 1O2ZA 1C2FA 1KXDA 2ZU3A 4TWWA 2ZHFH 3ATLA 4Z0KA 1P06A 1MBQA 4YOJA 2XYAA 1H8DH 1MD8A 1BB0B 1OP8A 2R0KA 3SV7A 3RMMH 1OSSA 1WQVH 1HJ9A 4DIHH 1O2GH 1BUIA 4Q7YA 1FPCH 2G51A 4OS2A 2P16A 1T4UH 2ZDLA 3SJOA 2P3UB 4LZ1H 1ZJDA 3NPSA 3P6ZB 1QHRB 4NA7A 2EA3A 1AN1E 3I78A 2BXTH 1SLUB 4A5TS 4NIYA 4ZROA 3SV8A 2TGDA 3PYHA 3TNTA 4UDWH 3CS0A 3QGJA 3QGNB 2BMGB 3RXPA 1A5IA 2F83A 1A5HA 1SVPA 3BEUA 1AHTH 2A31A 1AB9C 1A61H 2VGCC 1F2SE 1EAWA 2ZDAH 5A0BA 4O9VA 1SQOA 3RXTA 1G30B 3S7KB 4NGAH 5AF9H 2BDBA 2SGAA 3UQOA 1GBFA 2B0FA 1NROH 2ILNA 2HNTC 1W7XH 1BBRK 1W14U 4I8LA 4X8VH 2HALA 1O31A 4Y76A 1SGDE 3FP7E 1CSOE 5J4QA 1G36A 3SNAA 1JXPA 4NWLA 4TYDA 1KLIH 5FPSA 4J2YB 3SU5A 2HOBA 1WYKA 1VGCB 2O8LA 7KMEH 3RXCA 3KQCA 2XNIA 1HAZB 3BEFB 5F8ZA 1P3EA 1UTOA 3FVFB 1VITH 3D62A 3V7TA 2IJOB 3M5MA 2Y7XA 2STAE 1SGPE 1K1OA 3M36A 2BD3A 2Z9KA 4CREA 4E05H 3S9CA 4YO9A 2JKHA 2K1QA 1BRAA 4FUHA 1CGIE 2Q6FA 3LDXH 3D49H 1KDQA 1H1BA 5FBIA 4NZLA 1Z8JB 4TWYA 1UHBA 3ZZ6A 5C67A 2R9PA 3TNSA 1T8OA 3GYMA 3A84A 5I25A 4RKJB 4AFZA 3TH4H 1BTWA 1GHVH 1DVAH 3TGKE 1KLJH 1TLDA 4GCHG 4GUXA 4X8UH 1IQJA 1L0ZA 1DXWA 3L3TA 2YNAA 1WQSA 1ZTKA 2FOFA 1EZUC 1C2IA 1EJMA 1O3JA 3RXHA 1HAGE 3UNQA 2PSXA 1OWHA 3VFEA 6GCHF 4D7FA 1O3CA 2PKAB 2Y6TA 3VXEH 5IYTA 3ZVBA 3HK3B 2ZQ2A 2NU4E 4DVAU 5JBAS 3O8RA 4NFEA 5E2PA 1JWTA 4BXWA 4Y8YA 1N1LA 1MUEB 2CF9H 4AGKA 2ZF0H 1D3PB 4BAQB 3LGVA 3MO6A 1BTPA 1L2EA 4Y10E 5TCAA 1UCYE 1GBMA 2FODA 3OYPA 1ELEE 2C8WB 2TGTA 1K21H 1NC6A 4XBBA 1HJ8A 1GI4A 4K3JA 1BDAA 1FDPA 1TNIA 2Q6DA 3AVZA 1GBHA 3S9BA 1YCPM 5ETXA 2XWBI 1GMDG 3DT0H 2O8WA 4BAHB 3SI4H 3BTKE 3MNXA 3ODDA 3MH7A 3MTYA 2Y7ZA 4SGAE 1DM4B 3MH4A 1QFKH 5DG6A 2V3HH 5ABWA 1DLKB 1GI9B 5A8ZA 1ZLRA 3LKWA 1L1JA 4THNH 1YCPK 3M35A 1HIAB 4X2VA 1F5LA 1NZQH 4Y0YE 1VITG 4K8YA 1O2PA 1N6YA 3UWJH 1C5ZB 2GV7A 1SFIA 3RXGA 1GVKB 2EI7A 1O2XA 4GVUA 2WPMS 4HZHA 1PPEE 2GT7A 1TX7A 1E38B 1Z8GA 1QY6A 4BAKB 2QC2A 3CENA 1O5EH 4Y7AA 2FI4E 2H5CA 2FX6A 1DUEA 1C4Y2 3EA9A 2ZKSA 1MTWA 2FYRA 2F91A 1GHZA 4YOIA 4JYTA 5I46H 1GVZA 4Y79A 4ZXYH 2TPIZ 5A09A 2VIQA 1MTVA 3SW2B 1Q2WA 1YLDA 5EOKA 1LKBA 1IQMA 1EZQA 2W5EA 4B74A 4I33A 3RLYH 1EAIA 3QZQA 2QF3A 3UFAA 1Y5BT 2VIDA 3PLPA 5EXLA 2ZC9H 3ATWA 4MTBA 2IPHA 5HMAA 3VGCB 1SG8B 3TGJE 3TVJB 2BYAX 1AFQB 3BG8A 5FPYA 1A1RA 3RXQA 2XC0A 2F9OA 3PROA 4ZHLU 4GHQA 4B73A 1GG6B 1O3OA 1SLVB 4FVBA 2GCTB 2ZHWH 1EQ9A 1ZYOA 1GI2A 1PPZA 2A4GA 3SU6A 3RXMA 1ORFA 4JYUH 1THRH 1UCYH 1S83A 1FY3A 1DT2A 1EOLA 4DG4A 4ZUHA 1IQKA 2A45B 1LHDH 1RFNA 1AWFH 2OBOA 1MKXH 1Z6JH 3UR9A 1TE0A 5FX6A 4LXBH 3ELAH 3LC3A 1N8OB 1HV7A 1LQEA 1BT7A 2OC8A 2OUAA 2ZGCA 4CRFA 4ZKRU 1LO6A 1SGFA 2UWPA 2VU8E 3QX5H 5GWZA 1S85A 3F6UH 2ZFTA 3RP2A 1KXEA 5DJ7A 4DURA 3ZZ3A 2R0LA 4A1XA 2F9BH 1EPTB 3U8TH 3M7QA 2QYIA 1TB6H 3SN8A 1A0JA 2QA9E 1GHWH 4E7RG 5F6MA 1N6XA 1Y8TA 5EPNA 3TK9A 2VIWA 3RDZA 4WMEA 1P3CA 3NZIA 1EASA 1OWJA 1MTSA 3DHKH 3LT3A 3UWIA 1CHGA 4JZ1A 2SGDE 1A2CH 1Z1JA 2V0BA 1GDNA 2ZDMA 1O36A 2ZPSA 1ANCA 1C5RA 4ZH8A 4JK5A 2Z3EA 2ALPA 1DUAA 7GCHG 2HNTE 3GCTG 1FPHH 5A8XA 1O2RA 1J9CH 1O2QA 3MNSA 4HI3A 1O2NA 2DE8A 4ABEA 4Y11E 2I6SA 1JRSA 2KAIB 5C5NA 3VGCC 5DP3A 1ZHRA 2C3SA 4TY6A 1PQ8A 4BANB 1Z6EA 1VJ9U 2J38A 4KP0A 5GIBA 1SHYA 4Q2KA 3SGAE 3PV4A 2BOHB 4DCDA 1O39A 1GI5A 5LPFA 5C1XA 1KXFA 1AKSA 1XM1A 3D23A 1DSUA 3FZZA 2ANWA 1HAXB 3OTJE 1BRUP 4NA9H 1SOZA 2P59A 1KXBA 2GDDA 3FP8E 3T28A 4Y8XA 4B2BA 1HCGA 3PO1B 4JK6A 1HRTH 1Y3YA 4X6MA 2ZU5A 4ISIH 1GJ6A 3ATMA 1N8OC 5BPEA 2ZU2A 4MDSA 1A4WH 2PFEA 1RRKA 1SGRE 4UEHH 1C5XB 3Q3XA 2JH5D 5F03A 4GAWA 3TH2H 2ZU1A 3E8LA 1K28D 5JBCS 1O2IA 3RXUA 1M9UA 1SLXB 3F9FA 2CMYA 4RSPA 2FEQH 3SGBE 1V3XA 4O97A 3M5OA 5A2MH 2PTNA 1ANBA 1OWDA 4FUIA 4CBOA 5C1UA 3L33A 3SJKA 2H1UA 1NO9H 1SQTA 1C2JA 1YPEH 4ABHA 1ZSLA 1FI8A 3MMGA 2DUCA 3U1JB 3SNEA 2BOKA 5L30H 1XUFA 3GY7A 1C5TA 3E90B 1ZSJA 3C27B 3MH6A 3SJIA 4MPVA 9ESTA 1C1SA 1FMGA 3VB4A 1JIMA 2FOMB 4D9QA 4NA8A 1GMDF 3N7OA 3LH1A 3P8OA 4Q7ZA 1TOMH 1MMJN 1ZRBA 3ZVFA 5C1YA 2FWWA 1O2HA 2BD9A 3SU1A 3SORA 1UO6A 2A1DB 3KQBA 4TY7A 4U30A 2OQUA 3SZNA 2ZCHP 3S0NA 2FIRH 4INKA 1AU8A 1UVOA 2AMQA 1AO5A 2WPKS 1OOKB 3KHVA 1QIXB 3SJ9A 2BQ7B 1BHXB 2FTLE 3KCGH 1ACBE 1S0QA 1FZZA 4UONA 1Y3UA 4XDEA 4D9RA 1P2IA 3OU0A 1C2LA 1P2NA 1C5UA 1GCTB 1P57B 5HXFA 1AD8H 1B7XB 5E8EH 2O8UA 3UOUA 4AG2A 3P92A 1BTZA 2WV5A 2A5KA 3ZVAA 2IN2A 2VWOA 1OP0A 1MZDA 1TONA 1RGQA 3U98H 1GJCB 5GDSH 4U01A 1C1MA 1SMFE 4WMFA 3LU9B 4AB8A 2LPRA 2Z9JA 3SUEA 3BTWE 2QGRA 3RC5A 3QO6A 3BTGE 1TGCA 3TPIZ 1YLCA 3RXOA 3M5LA 5EW2H 2BD7A 5E0HA 4ASHA 1V2ST 1TNLA 1AE8H 2CF8H 1P9UA 4ISOA 1TPOA 3QZRA 1CGJE 5C5OA 4K60A 3SUFA 4DY7B 2QIQA 2SGEE 3H5CB 1D3DB 1HBTH 1O3HA 1LVMA 2XRCA 2QY0B 1V2KT 1DWDH 1GBKA 3ZVEA 2ZDVH 3V12A 4ABDA 1VZQH 1BMMH 1FV9A 1TQ0B 3E91A 4FXGH 2WINI 1INCA 2BDCA 2VIOA 1AB9B 3SNDA 4FVDA 1WAYB 4X8TH 3ZZ9A 1HAIH 3BF6H 3BTHE 1GL1A 4K2YA 1AZZA 1MCVA 4IN2A 1QRWA 4XBDA 3IWMA 1V2UT 2ODYB 1EXFA 1QBNA 1HFDA 1MU8B 3MO9A 2VJ1A 4FUGA 1MKWH 2GZ9A 1GI1A 1BTYA 4UFDH 3GDSA 3PMAB 2AGIX 5TCCA 4I8JA 2VH6A 1YC0A 3TJOA 1AMHA 4CH8B 1TRMA 1C5QA 4UFFH 3E16B 2FI5E 5BRRE 1LPZB 2B7DH 5PTPA 3NK8A 4O3TA 3KNXA 3SNCA 4CRDA 4OS1A 1Y5UT 2OC7A 4JCNA 3SQHE 3MHWU 4AOQA 4AYVB 1QJ1B 1JMOH 1GCTC 5T6DA 5E0JA 1P02A 1TX6A 4MLFB 1V6DA 1F7ZA 4OS4A 3T5FH 1FONA 4MQAA 1HNEE 2Y80A 2ZHEH 1FAXA 1C1RA 1SGTA 2GZ7A 3UTUH 3EDXB 2WYJA 1S6FA 2QCYA 1F5KU 3BV9B 2A2XH 3G01A 2GGVB 3ZVCA 1C1QA 1BCUH 4HGCA 3EYDA 1EZXC 3SUDA 3KEEA 1TNGA 2BY7X 3EQ0H 3LJOA 4X6OA 2BVXH 2NWNA 4YESB 1L4ZA 3F9GA 2D26C 4AX9H 1P04A 4A1TA 5DP4A 1SGCA 4F4OC 2BD8A 1OWIA 2Z9IA 3HGPA 5F8XA 1PJPA 2D2DA 1EB2A 4WXIA 5AFZH 2GX4A 2GTBA 2FS9A 3GY5A 1O33A 1J17T 1O38A 3RXKA 1Y59T 1GBAA 2ZEBA 2W26A 3ZYEA 2ZECA 2OC1A 2VH0A 3M7UA 1AY6H 3RXLA 4B2AA 5CE1A 1T32A 3LH3A 4K8BA 1SSXA 2V6NA 4WMDA 1O2SA 5T6GA 3CS7A 3OSYA 1GMCG 3SV6A 3ZZ8A 1ELGA 3RXBA 3ENSB 2ULLA 4ZMAH 1OWEA 1T8MA 1C1UH 1AIXH 2ODQA 2ODPA 2BD2A 1KXCA 2ZHQH 1K1PA 3PWCA 2QF0A 1SR5C 1UVPA 2P3TB 3BIUH 2A4RA 2CV3A 3A7ZA 2EI8A 3LGUA 1WCZA 3DA9B 2BDHA 1TPPA 4INHA 3RM0H 5DP5A 1FY8E 3SU4A 3QUMP 3V3MA 1P2OA 3EAJA 4NIVA 3P95A 1TMUH 1TQ7B 1GJ9B 3LJJA 1XUHA 5CHAC 1GJ4H 2VVVA 4I8GA 1YM0A 3NXPA 1Q31A 1G3CA 1VCQA 3ZYDA 4LK4A 2Z3CA 2WPLS 3A86A 5HM2A 1GJ5H 3B23B 5HYOA 1BRCE 4X1QU 5FHTA 5C2ZA 1S84A 1B0FA 4MPUA 5DPAA 3RMLH 3BTTE 2EC9H 1A0LA 4KTUA 1P12E 1TRYA 1CT2E 1K1MA 1PYTD 1K2I1 4Y6DA 8GCHF 2ZHDA 3E3TA 2C93B 4ABGA 8KME2 1QNJA 4I32A 3SV9A 1DLEA 5DP9A 4ABJA 5DP7A 5EW1H 2FLBH 1UVUH 1KTSB 1W13U 1P05A 3A8AA 1DWCH 1GJBB 1QB1A 2TBSA 1YPMH 2C8XB 4HTCH 5FAHA 1G3DA 2W3IA 5EGMA 1BHXF 3NWUA 4MNYA 3F68H 3U8RH 3A7TA 1MAXA 4Y0ZE 1O3EA 2JETC 3UIRA 1LHFH 1AGJA 2WPHS 2F9NA 1GL0E 1KDQB 2G52A 4BAOB 1HAVB 1UHBB 2H9HA 3LGWA 1BMLA 2ZPQA 1DPOA 2TRMA 1TGNA 2BDIA 1GVLA 2QAAA 2UWLA 1GBLA 3LPRA 2J94A 1CA8B 2VIVA 1NM6A 5SGAE 1LVBA 1E35B 2UUFB 3V0XA 5GCHG 4BOHA 4BTTB 1EATA 3BIVH 1HPGA 1ZJKA 2PLXA 4DT7B 4FUBA 5EQSA 1YCPH 1JBUH 1YGCH 1NY22 2WUBA 2FM2A 1JRTA 3UOPA 1H4WA 1PPFE 3A7YA 1BMAA 2XWAA 1YP9A 3AW0A 4RKOB 4XBCA 1P9SA 2H5DA 5JB9S 5L2YH 2BQWB 1THPB 4YZUA 1TX8A 1NFXA 2YOLA 3TH3H 3URCA 1ELTA 1MH0A 4YM9A 1J16A 3GOVB 3HK6B 4K1TA 1C5MD 3A7VA 4XOJA 2ZTYA 2R2WU 1GHAF 1QJ7B 1L4DA 1GHBG 1P10A 3KF2A 4Q7XA 1ZMNA 4NZQA 2PGQB 2V35A 4X6NA 1GMHF 2AIPA 2VWLA 1IHSH 2BY6X 1CBWC 1W7GH 2C8YB 3NCLA 2JH6D 3ZZ7A 1IQFA 2BVSH 2ANKH 4I8HA 4ZXXH 4WH8A 2GT8A 2SGPE 2BD4A 1C2HA 1O2OA 1P0SH 5ESTE 2FLRH 1QBVH 1HDTH 5HM9A 2XBWA 4NG9H 3MU5A 3P8NA 1O3GA 1ZZZA 3A7XA 1GGDC 1DWBH 4ZAEA 1F0UA 3KIDU 4NSYA 4MPXA 4GSOA 5JBTA 1TA2A 2HGTH 2SGQE 1EAUA 2Z3DA 1TWXB 1FNIA 5A0AE 2CGAA 3URDA 2A32A 1ETSH 4U2WA 1XKBC 1Z8IB 1C9TA 1G2MA 1C2DA 1YBWA 3O8DA 2AS9A 1GI7B 2J2UA 4FUDA 4DIIH 3RU4T 2JH0D 1GBEA 4A6LA 1ZRKA 1LTOA 1E0FD 7LPRA 4A1VA 8ESTE 2ZCKP 2GMTC 2HLCA 3CP7A 2O8TA 3A80A 1W0ZU 4NIWA 1K1JA 1ARCA 3B8JA 2D8WA 5GJ4B 1ZPZA 4O03A 3S69A 1WOFA 1UCYK 1HYLA 1TGBA 1O5CB 4WJG2 4KTSA 1BTHH 1O5AB 3F9HA 1O3KA 1UK3A 4TPYA 2GCHG 1CHOG 1DICA 1IAUA 4D8NA 1K1NA 2G5VA 3LIWA 2P8OC 1SGFG 1EX3A 2F9PA 1DY8A 2PV9B 2ZGJA 1GBTA 4BNRA 2ASUB 2XXLA 1S6HA 1SI5H 1BIOA 1HXEH 1SGNE 4X2WA 3SQEE 2BY8X 2ZDKA 2HPPH 5DK1A 1O30A 1WSSH 4YTAA 4AB9A 1BJVA 5F8TA 1CO7E 2SNVA 2EEKA 1HJAC 3P17H 3RXFA 1QRZA 1ESAA 3ZVGA 1XX9A 4ISHH 3KL6A 1O5BB 1IQEA 2A4OA 1FJSA 3HKJB 1C5OH 5JDUB 5FPTA 1EAXA 2G4TA 4GPGA 2W7SA 1ZMJA 1LHEH 2BX3A 1LCYA 3F9EA 3GYLB 3PB1E 4AZ2B 1GI8B 1L1GA 3A82A 3PMJA 3MNBA 3MI4A 3IITA 4UE7H 1GI6A 2HWLB 4H4FA 2F3CE 2G5NA 1Y3VA 2PR3A 4UFGH 1IOEA 1GI3A 3E1XB 3QLPH 3S7HB 2XBVA 4IBLH 3M3VA 2QN5T 3OX7U 2TIOA 4CR9A 1FQ3A 2O8MA 1X7AC 1ABIH 2FXRA 3SI3H 5FCRA 5EG4A 3GCNA 1TA6A 4FUCA 5LH8A 2P3FH 1BJUA 3TK5A 3VEQB 2OXSA 3TU7H 3K9XB 1EKBB 1BQYA 4GCHF 2PKSC 1DXPA 4VGCC 1D3QB 1XVOA 4CRGA 1KLTA 3EGKH 4KELA 4X8SH 3PLKA 5LPRA 3A7WA 2Z7FE 4I7YH 2H2ZA 6LPRA 1ARBA 2QXJA 2G8TA 1AKSB 3PTBA 1K1LA 2Y5FA 1MCTA 4BAMB 1SGEE 2AYWA 4FU8A 1O35A 2V3OH 3Q3YA 1W11U 4YT7H 1UTJA 5AVDA 1PPBH 1IQIA 4XFQA 1GPZA 1LKAA 3A83A 2ZPRA 1GCDA 1Z8RA 2Z94A 1C1OA 1NS3A 1BOQA 4NWKA 3BTDE 5LGOA 4JMYA 3PWBA 2A2QH 1PQAA 1NPMA 2RCEA 1K1IA 4CBNA 1G37A 5GCHF 3MFJA 1P2JA 1FAKH 2FS8A 3D65E 4AN7A 5L6NH 2Y5GA 2G00A 2SFAA 4XE4A 2CJIA 4IMZA 1RJXB 2B9LA 4ZHAA 1TGSZ 1BTUA 1UVSH 1ZSKA 2J9NA 2GZ8A 2YNBA 1NU9A 5C3NA 1ABJH 5JB8S 6CHAC 1AE5A 1J15A 3PMBB 3ZZCA 1O3FA 2W7UA 2ZFSA 1AQ7A 1LHGH 1ZMLA 5FCKA 4JZEH 1ELCA 1VITF 3B9FH 4X6PA 4ABAA 3BG4B 7ESTE 2AGGX 3HGNA 4BTIB 2F9UA 1PPHE 1ID5H 2G81E 4ZHMU 1LPKB 4DJZB 1ZTLA 4FU9A 3UY9A 2BTCE 4LOYH 3RXVA 1GHBF 1LVOA 2BZAA 2XCFA 3BTME 3DFLA 1B0EA 5B6OA 6GCHG 3NUMA 4ZKSU 3ZZAA 4AGJA 4B1TA 2A7JA 2P93A 1HAOH 4DOQA 2A7HA 3EA8A 1YPKH 1KXAA 2BM2A 4F49A 1T7CA 4MNVA 4X0WU 2OC0A 1V2LT 1W2KH 5A8YA 1S81A 3MU0A 4WF8A 1O2UA 1CU1A 3TIUA 1FUJA 1NRRH 1P01A 3JZ1B 6ESTA 3RU4D 2RA3A 4RN6A 5T6FA 3U69H 3T62A 2Y82A 2BDYA 1G32B 1ETRH 1P11E 3BN9A 3KQEA 3U8OH 1C5LH 3TJUA 1WTGH 1HUTH 1F0RA 5ESBA 1BBRE 3NKKA 2AFQB 4Y8ZA 1QL8A 1TALA 1V2OT 4E06H 1O2MA 3MU8A 1GI0A 2FMJA 1V2VT 3MYWA 3SNBA 5EPYA 2WUCA 4CR5A 1PFXC 5FXLA 3E6PH 1ETTH 4WVPE 1KY9A 3K2UA 1LHCH 3ZVDA 1OXGA 1SC8U 2M5TA 1ZHPA 1HAYB 4SGBE 4Q80A 1HLTH 1GJ8B 5EXNA 1W3CA 1UTLM 1VCPA 1OYQA 1H9HE 1O2VA 1NFWA 3RXEA 2BXUH 2CHAC 1PYTC 2XC5A 2D1JA 1J8AA 1C5NH 3BG4C 1V2TT 3R3GB 3TJNA 1ZGVA 3IG6B 1OX1A 3AW1A 2PWXA 3U9AH 4H6SB 1GBIA 1EOJA 1RD3B 1TABE 2FDAA 2RDLA 2QXIA 3AASA 1ELAA 4WY3A 2FOCA 4BTUB 2AERH 1TPAE 1E34B 1TMBH 3SO3A 1DY9A 3GCHC 4E7NA 1O3BA 2GDEH 1AUTC 2ANYA 1EJAA 2XTTB 3RXAA 1MTNC 1G3BA 2B8OH 2ZI2H 3U1IB 1MKWK 5CHAB 7GCHF 3ODFA 1ESBA 3ZV8A 1SL3A 1LMWB 3GCTF 3RXDA 3ITIA 2ZZUH 3Q76A 4OS6A 2ZFPH 4B71A 1SLWB 1O3LA 1HXFH 3M7TA 1G9IE 3EA7A 1GWAA 4YLUA 2NU0E 2UUJB 2UWOA 4ABIA 1TMTH 4TPIZ 3W94A 1DFPA 1TNHA 4IC6A 1IQLA 2RA0A 3FP6E 1WV7H 2OP9A 4D76A 3Q77A 1QA0A 2ALVA 1ZHMA 1QTFA 4CRAA 1FY1A 4CRBA 3MU1A 1V2RT 1VCWA 1YPLH 2FPZA 4IMQA 1HB0B 1C2MA 4AFSA 2P94A 2CXVA 2XBXA 1P2QA 3RU4E 2J92A 3P70B 1C4V2 1GBCA 1BBRH 3RMOH 1B5GH 3GY3A 3M37A 1QQ4A 1QBOA 2JETB 4M7GA 3TJVA 2Y81A 1OWKA 2NU1E 2HPQH 3HKIB 3WY8A 3PTNA 4MNWA 2O9QA 2GD4B 1C2GA 1O3PB 1QQUA 1FXYA 1TIOA 3LGIA 3AAUA 5JYIA 1K9OE 2BLVA 3R0FA 4KTCA 1QR3E 2UUKB 1ZPCA 2ZTXA 1F0TA 1VJAU 2FYQA 1AFEH 1H8IH 1F92A 2F9VA 1C1VH 1AWHB 1MD7A 1V2WT 2H9EH 3UREA 3QTOH 1DDJA 3BSQA 1TBQH 3LC5A 3TGIE 2B5TB 1CA0C 1VR1H 1C5PA 3STJA 3GDUA 5DP8A 1UTQA 2BD5A 1UTNA 1CT4E 4X1RU 1TAWA 1LVYA 1DE7H 1ELFA 5K0HA 1P2MA 2ZTZA 1AVGH 1S0RA 1TYNA 1C5VA 2ZP0H 1Z71A 1TFXA 3EE0B 1D6WA 1JOUB 1BTXA 1NRPH 1QJ6B 3K6ZA 1A3EH 2A4QA 3QTVH 1AVWA 2GV6A 1GDQA 3O8BA 1UJ1A 2UUYA 3T25A 2WPJS 3K65B 3SU3A 4IC5A 1EP5A 4NFFA 4K69A 1PQ5A 2ZWLH 2PKAA 1A5GH 1C1TA 3SV2H 2NU3E 1CBWB 3SUGA 3BTEE 4IW4E 1H9LB 4X1PU 2ZQ1A 3SU2A 2A0QB 4FU7A 1HAVA 1IHTH 1QGFA 1QB6A 4A7IB 2AGEX 4MNXA 5GXPA 1Y5AT 2ZFQH 3RUOA 2A5AA 4YOGA 3QN7A 1S82A 3RM2H 1O2JA 5EQRA 4HFPB 3UNSA 1D4PB 1O3DA 1QL7A 2ZGXH 1NT1A 1DITH 3H7TA 1GGDB 2ZNKH 3T29A 1ELBA 1CE5A 4OGXA 3AAVA 5L2ZH 1QURH 5FX5A 8LPRA 1EZSC 1GJDB 4OS5A 1Z7KA 5AFYH 2ZGHA 1XVMA 4KKDA 2GKVE 1GBDA 3FANA 2EI6A 4FUJA 1D9IA 2THFB 4R8TB 3ZZBA 1O2KA 1HIAA 2H9TH 2FOHA 3VB7A 4JZDH 1XKAC 1FIWA 4I8KA 4OGYA 5DGJA 2ZDNA 1YPHC 3Q00A 2LNCA 2Y5HA 1MAYA 1TOCB 4X1SU 1XUIA 3A8DA
chains in the Genus database with same CATH superfamily
2XW9A 4H42U 1YYY1 4B6FA 1CT0E 4K1EA 1O3AA 3GY2A 1VGCC 2AH4X 1GJAB 1V2QT 2GMTB 1XXFA 4AFUA 4R0IA 2OINA 1LDTT 1C4U2 1C5SA 3I29A 1GJ7B 2FOEA 2A5IA 1MTUA 1K22H 5EQQA 4GLYA 3MU4A 1SBWA 2FO9A 2W3KA 4INLA 4JYVH 2VNTA 2TGPZ 4CHAB 3LGTA 4PROA 1E36B 3RXJA 3TLOA 3ZV9A 3A8BA 1E1RD 1MBMA 4B2CA 1NESE 1EP6A 5LPEA 2AEIH 1AUJA 2VB0A 3DSOA 3HPTB 4ASUD 5IDKA 1J14A 3UNRA 3TITA 1XUGA 1BMNH 2HNTF 4OS7A 1ELDE 1UMAH 1LQDB 2WV4A 1SB1H 3SOSA 1CGHA 2P8OB 1YKTA 2YMSB 1NTPA 3OY6U 1D6RA 1P09A 1UK4A 1RIWB 5E2OA 3DFJA 1T8LA 1ZGIA 1XUKA 3T2NA 1V2MT 3T26A 1Y3WA 5JPMH 2ZFFH 1TRNA 4JZFH 1EJNA 4Y71A 3Q3KA 1HJAB 1O3MA 3T27A 1O2YA 2BLOA 3ZZ5A 2BLQA 1MZAA 1YPJH 5HGGA 5DKMA 3NRLA 1CVWH 5CMXH 3GY8A 3QK1A 1KIGH 2WYGA 2J95A 3VB3A 4K5ZA 4WH6A 2BVRH 3LOXA 1K0HA 3P8GA 1ANDA 4NIXA 5FBEA 5IK2D 1TNKA 2TGAA 1EPTA 1O5DH 1DWEH 2PW8H 4ABBA 3RC4A 2BDAA 1SOTA 1ELVA 3A8CA 1C5YB 2H6MA 2ZIQH 3KYGA 1O0DH 1SHHB 1DSTA 2BZ6H 4Z6AH 1NN6A 2OK5A 3ZZ4A 1MQ5A 1IQNA 1V2NT 1V2JT 2AMPA 1NRQH 3V13A 3DD2H 4ESTE 3PRDA 3RXRA 1HGTH 2PKSB 2R2MB 3EE7A 3H7OA 4VGCB 1BA8B 1W0YH 2XBYA 3A85A 3GCOA 1RTFB 4CHAC 2BY5X 4HG6A 2VIPA 3E0NB 1HAPH 2FTMA 3A87A 1MKXK 2CN0H 3K6YA 2KAIA 3VXFH 3UQVA 4X2XA 1GMCF 4AORA 4XSKU 5EIYA 4UFEH 3UR6A 4IS5A 5G4BA 1SQAA 2QXHA 3P8FA 3VG8A 9LPRA 1C1NA 1RIWC 1E37B 3GY6A 2C4FH 1ZOMA 2BHGA 1RS0A 2J4IA 4CRCA 1C2KA 3C1KA 3GISB 4FUFA 1SFQB 2DE9A 5E0GA 1O2WA 1YPGH 5HKKD 4B75A 2ZU4A 3HATH 1IQHA 1WUNH 4QT8C 1F0SA 2BQ6B 3QWCH 1AI8H 3FAOA 2Q6GA 1OP2A 3F2GA 1W12U 4WWYA 1TBRH 2OD3B 3RXSA 3MNCA 1UK2A 6CHAB 4YLQH 3S9AA 4KGAA 4JZIA 1AVXA 1O5FH 2PGBB 5EXMA 1A0HB 4B76A 1NFUA 2G4UA 1AFQC 1KTTB 2Z9LA 5C20A 1EFRD 1O2TA 3RC6A 2ZG0H 5C0TA 2QV1A 3JZ2B 5DP6A 1C1PA 2Q1JA 1YF4A 3KQDA 2ZO3H 2AMDA 3ATIA 1GG6C 3M3TA 2AIQA 5KECA 2GCTC 3KN2A 2C8ZB 3MOCA 2VINA 1QZ8A 2BX4A 1DANH 4Q4LA 2RG3A 3ATKA 1MU6B 3M3SA 4AFQA 2PTCE 1O3NA 1A7SA 4Y7BA 3STIA 2WPIS 1L1NA 3SHAH 2ZFRH 2FOAA 2OBQA 2OLGA 3SGQE 1BZXE 2FI3E 5H4IB 1PPGE 2VVUA 1RTKA 1TPSA 1P8VC 2R3YA 1FN8A 2G55A 3FZDA 2W6ID 4YT6H 2PSYA 4D7GA 3PMHB 1EPTC 1RTLA 1ZTJA 3MO3A 4ACAA 1G3EA 3VB6A 4F55A 3SJ8A 2J34A 1LPGB 1Z1IA 1SGIB 5A0CA 2FESH 1H9IE 1SGYE 5AHGH 3OY5U 4DGJA 2ESTE 1PPCE 2FP7B 2A7CA 4F48B 3BTFE 1C1WH 3SBKA 1PQ7A 1UTPA 1NRNH 3VPKA 3LGYA 2OTVA 1C5WB 5GPIB 1W10U 1OKXA 2PHBA 1IQGA 2GP9B 1YPHE 2I6QA 3ZZDA 4ZKNU 1O32A 3MH5A 2IOTA 4ISNA 3UUZA 1XUJA 1OYTH 1O3IA 1NFYA 2BLWA 3DUXH 8GCHG 1GHYH 2CHAB 2FX4A 3UB0A 4BXSA 1F5RA 1W0KD 3ESTA 5EODA 1ESTA 4U32A 2PUXB 2Z9GA 1KSNA 1NRSH 1SGQE 3WW7A 1DX5M 3GDVA 4GHTA 2WSSD 1TBZH 1GBBA 3M61U 1U6QA 2V7QD 2C90B 1V2PT 2VWNA 1GDUA 4UD9H 1UTMA 4IGDA 3GCHB 3GICB 5JBBS 1DOJA 2GVFA 5EU8A 2HLDD 1MTNB 4X2YA 3PO1C 1T31A 2FOBA 1GBJA 4MG3A 1OPHB 4ISLA 1FY5A 2Z6BD 1MQ6A 1Y3XA 2FZZA 4J1YA 4MVNA 4FETA 3WWBA 4AYYB 2WHXA 3FFGA 3RMNH 3LONA 3A81A 2STBE 1FLEE 2BB4A 3PLBA 3SU0A 1UVTH 2FOGA 1KYNA 1GHXH 1TNJA 1AZ8A 2VWMA 2HRVA 2OQ5A 1T4VH 5DO4H 3KGPA 4AG1A 2BY9X 1FN6A 4ABFA 4X1NU 5TJXA 2XC4A 1THSH 1WTHD 4H6TA 3F1SB 4NCYA 4WXVA 5J4SA 1EUFA 1CQQA 1OS8A 3QDZB 3SYJA 4DW2U 1A46H 1S5SA 4LZ4B 1QRXA 1H8ED 2OCVB 4CH2B 4FUEA 1UTKA 4MPWA 4IN1A 1ANEA 3VB5A 1XMNB 1C2EA 1O37A 3FN8A 2XCNA 1P03A 1WU1A 1EB1H 1QL9A 4ZKOU 3MWIU 2SGFE 3PM3A 1GHAG 3N99A 1T8NA 2VGCB 2PUQH 1Q3XA 1D3TB 1A3BH 1HAHH 3RXIA 1ZPBA 1QCPA 2R3UA 3W95A 1GMHG 1G2LA 1O34A 2LP6A 1W8BH 1SPJA 1UW7A 1O5GH 3I77A 1FIZA 3M5NA 2HVXA 4I31A 2KCOA 2ZCLP 1XXDA 1CA0B 1JIRA 2ANMH 2ZA5A 1P2KA 4O3UA 1NU7B 1DS2E 2GCHF 3BTQE 2ZGBH 1CHOF 3L6PA 1RXPA 3SHCH 1TGTA 2VVCA 4K1SA 1FY4A 3UPEA 3O8CA 4A92A 1ZR0A 5CDFE 2BDGA 3BEIB 5K7RA 1O2LA 2NU2E 2QXGA 2SNWA 3H09A 3WWFA 3RLWH 4NSVA 3A89A 1QA7A 1QB9A 3E0PB 1C9PA 1WBGB 3A88A 1BRBE 5T3HA 1BITA 2P95A 3GY4A 3TK6A 1O2ZA 1C2FA 1KXDA 3F0OA 2ZU3A 4TWWA 2ZHFH 3ATLA 4Z0KA 1P06A 1MBQA 4YOJA 2XYAA 1H8DH 1MD8A 1BB0B 1OP8A 2R0KA 3SV7A 3RMMH 1OSSA 1WQVH 1HJ9A 4DIHH 1O2GH 1BUIA 4Q7YA 1FPCH 2G51A 4OS2A 2P16A 1T4UH 2ZDLA 3SJOA 2P3UB 4LZ1H 1ZJDA 3NPSA 3P6ZB 1QHRB 4NA7A 2EA3A 1AN1E 3I78A 2BXTH 1SLUB 4A5TS 4NIYA 4ZROA 2K0QA 3SV8A 2TGDA 3PYHA 2IJD1 3TNTA 4UDWH 3CS0A 3QGJA 3QGNB 2BMGB 3RXPA 1A5IA 2F83A 1A5HA 1SVPA 3BEUA 1AHTH 2A31A 1AB9C 1A61H 2VGCC 1F2SE 1EAWA 2ZDAH 5A0BA 4O9VA 1SQOA 3RXTA 1G30B 3S7KB 4NGAH 3KQ5A 5AF9H 2BDBA 2SGAA 3UQOA 1GBFA 2B0FA 1NROH 2ILNA 2HNTC 1W7XH 1BBRK 1W14U 4I8LA 4X8VH 2HALA 1O31A 4Y76A 1SGDE 1BMFD 3FP7E 1CSOE 5J4QA 1G36A 3SNAA 1JXPA 4NWLA 4TYDA 1KLIH 2F43B 5FPSA 4J2YB 3SU5A 2HOBA 1WYKA 1VGCB 2O8LA 7KMEH 3RXCA 3KQCA 2XNIA 1HAZB 3BEFB 5F8ZA 5C94A 1P3EA 1UTOA 3FVFB 1VITH 2QE7D 3D62A 3V7TA 2IJOB 3M5MA 2Y7XA 2PP6A 2STAE 1SGPE 1K1OA 3M36A 2BD3A 2Z9KA 4CREA 4E05H 3S9CA 4YO9A 2JKHA 2K1QA 1BRAA 4FUHA 1CGIE 2Q6FA 3LDXH 3D49H 1KDQA 1H1BA 5FBIA 4NZLA 1Z8JB 4TWYA 1UHBA 3ZZ6A 5C67A 2R9PA 3TNSA 1T8OA 3GYMA 3A84A 5I25A 4RKJB 4AFZA 3TH4H 1BTWA 1GHVH 1DVAH 3TGKE 1KLJH 1TLDA 4GCHG 4GUXA 2HVYB 4X8UH 1IQJA 1L0ZA 1DXWA 3L3TA 2YNAA 1WQSA 1ZTKA 2FOFA 1EZUC 1C2IA 1EJMA 1KMHB 1O3JA 3RXHA 1HAGE 3UNQA 2PSXA 1OWHA 3VFEA 6GCHF 4D7FA 1O3CA 2PKAB 2Y6TA 3VXEH 5IYTA 3DSGA 3ZVBA 3HK3B 2ZQ2A 2NU4E 2J98B 4DVAU 5JBAS 3O8RA 4NFEA 3DSPA 5E2PA 1JWTA 4BXWA 4Y8YA 1N1LA 1MUEB 2CF9H 4AGKA 2ZF0H 1D3PB 4BAQB 3LGVA 3MO6A 1BTPA 1L2EA 4Y10E 5TCAA 1UCYE 1GBMA 2FODA 3OYPA 1ELEE 2C8WB 2TGTA 1K21H 1NC6A 4XBBA 1HJ8A 1FX0B 1GI4A 4K3JA 4P02A 1BDAA 1FDPA 1TNIA 2Q6DA 3AVZA 1GBHA 3S9BA 1YCPM 5ETXA 2XWBI 1GMDG 3DT0H 2O8WA 4BAHB 3SI4H 3BTKE 3MNXA 3ODDA 3MH7A 3MTYA 4ZCNA 2Y7ZA 4SGAE 1DM4B 3MH4A 4XRNA 1E1QD 1QFKH 5DG6A 2V3HH 5ABWA 1DLKB 1GI9B 5A8ZA 1ZLRA 3LKWA 1L1JA 4THNH 1YCPK 3M35A 1HIAB 4X2VA 1F5LA 1NZQH 4Y0YE 1VITG 4K8YA 1O2PA 1N6YA 3UWJH 1C5ZB 2GV7A 1SFIA 3RXGA 1GVKB 2EI7A 1O2XA 4GVUA 2WPMS 5DN6D 4HZHA 1PPEE 2GT7A 1TX7A 1E38B 1Z8GA 1QY6A 4BAKB 2QC2A 3CENA 1O5EH 4Y7AA 5HIYA 2FI4E 2H5CA 2FX6A 1DUEA 1C4Y2 3EA9A 2ZKSA 1MTWA 2FYRA 2F91A 1GHZA 4YOIA 4JYTA 5I46H 1GVZA 2JDID 4Y79A 4ZXYH 2TPIZ 5A09A 2VIQA 1MTVA 3SW2B 1Q2WA 1YLDA 5EOKA 1LKBA 1IQMA 1EZQA 2W5EA 4B74A 4I33A 3RLYH 1EAIA 3QZQA 2QF3A 3UFAA 1Y5BT 2VIDA 3PLPA 5EXLA 2ZC9H 3ATWA 5CHBA 4MTBA 2IPHA 5HMAA 3VGCB 1SG8B 2KCPA 3TGJE 2LELA 3TVJB 2BYAX 1AFQB 3BG8A 5FPYA 1A1RA 3RXQA 2XC0A 2F9OA 3PROA 4ZHLU 4GHQA 4B73A 1GG6B 1O3OA 1SLVB 5HIZA 4FVBA 2GCTB 2ZHWH 1EQ9A 1ZYOA 1GI2A 1PPZA 2A4GA 3SU6A 3RXMA 1ORFA 4JYUH 1THRH 1UCYH 1S83A 1FY3A 1DT2A 1EOLA 4DG4A 4ZUHA 1IQKA 2A45B 1LHDH 1RFNA 1AWFH 2OBOA 1MKXH 1Z6JH 3UR9A 1TE0A 5FX6A 4LXBH 3ELAH 3LC3A 1N8OB 1HV7A 1LQEA 1BT7A 2OC8A 2OUAA 2ZGCA 4CRFA 4ZKRU 1LO6A 1SGFA 2UWPA 2VU8E 3QX5H 5GWZA 1S85A 5C17A 3F6UH 2ZFTA 3RP2A 1KXEA 5DJ7A 4DURA 3ZZ3A 2R0LA 4A1XA 2F9BH 1WDIA 1EPTB 3U8TH 3M7QA 2QYIA 1TB6H 3SN8A 1A0JA 2QA9E 1GHWH 4E7RG 5F6MA 1N6XA 1Y8TA 5EPNA 3TK9A 2VIWA 3RDZA 4WMEA 1P3CA 3NZIA 1EASA 1MABB 1OWJA 1MTSA 3DHKH 3LT3A 3UWIA 1CHGA 4JZ1A 2SGDE 1A2CH 1Z1JA 2V0BA 1GDNA 2ZDMA 1O36A 2ZPSA 1ANCA 1C5RA 4ZH8A 4JK5A 2Z3EA 2ALPA 1DUAA 7GCHG 5F53A 2HNTE 3GCTG 1FPHH 5A8XA 1O2RA 1J9CH 1O2QA 3MNSA 4HI3A 1O2NA 2DE8A 4ABEA 4Y11E 2I6SA 1JRSA 2KAIB 5C5NA 3VGCC 5DP3A 1ZHRA 2C3SA 4TY6A 1PQ8A 5FL7D 4BANB 2CK3D 1Z6EA 1VJ9U 2J38A 4KP0A 5GIBA 1SHYA 4Q2KA 3SGAE 3PV4A 2BOHB 4DCDA 1O39A 1GI5A 5LPFA 5C1XA 1KXFA 1AKSA 1XM1A 3D23A 1DSUA 3FZZA 2ANWA 1HAXB 3OTJE 3OFND 1BRUP 4NA9H 1SOZA 2P59A 1KXBA 2GDDA 3FP8E 3T28A 4Y8XA 4B2BA 1HCGA 3PO1B 4JK6A 1HRTH 1Y3YA 4X6MA 2ZU5A 4ISIH 3PV5A 1GJ6A 3ATMA 1N8OC 5BPEA 2ZU2A 4MDSA 1A4WH 2PFEA 1RRKA 1SGRE 4UEHH 1C5XB 3Q3XA 2JH5D 5F03A 4GAWA 3TH2H 2ZU1A 3E8LA 1K28D 5JBCS 1O2IA 3RXUA 1M9UA 1SLXB 3F9FA 2CMYA 4RSPA 2FEQH 3SGBE 1V3XA 4O97A 3M5OA 5A2MH 2PTNA 1ANBA 2JJ1D 1OWDA 4FUIA 4CBOA 5C1UA 2GJGA 3L33A 3SJKA 2H1UA 1NO9H 1SQTA 1C2JA 5KEDA 1YPEH 4ABHA 1ZSLA 1FI8A 3MMGA 2DUCA 3U1JB 3SNEA 2BOKA 5L30H 1XUFA 3GY7A 2W6JD 1C5TA 3E90B 1ZSJA 3C27B 3MH6A 3SJIA 5C0UA 4MPVA 9ESTA 1C1SA 1FMGA 3VB4A 1JIMA 2FOMB 4D9QA 4NA8A 1GMDF 3N7OA 3LH1A 3P8OA 4Q7ZA 1TOMH 1MMJN 1ZRBA 3ZVFA 5C1YA 2FWWA 1O2HA 2BD9A 3SU1A 3SORA 1UO6A 2A1DB 3KQBA 4TY7A 4U30A 2OQUA 3SZNA 2ZCHP 3S0NA 2FIRH 4INKA 1AU8A 1UVOA 2AMQA 1AO5A 2WPKS 1OOKB 3KHVA 1QIXB 3SJ9A 2BQ7B 1BHXB 2FTLE 3KCGH 1ACBE 1S0QA 1FZZA 4UONA 1Y3UA 4XDEA 4D9RA 1P2IA 3OU0A 2YMSD 1C2LA 1P2NA 1C5UA 1GCTB 1P57B 5HXFA 1AD8H 1B7XB 5E8EH 2O8UA 3UOUA 4AG2A 3P92A 1BTZA 2WV5A 2A5KA 3ZVAA 2IN2A 2VWOA 1OP0A 1MZDA 1TONA 1RGQA 3U98H 1GJCB 5GDSH 4U01A 1C1MA 1SMFE 4WMFA 3LU9B 4AC9A 1S6LA 2LPRA 4AB8A 2Z9JA 3SUEA 2VBCA 3BTWE 2QGRA 3RC5A 3QO6A 4I86A 3BTGE 1TGCA 3TPIZ 1YLCA 3RXOA 3M5LA 5EW2H 2BD7A 5E0HA 4ASHA 1V2ST 1TNLA 1AE8H 2CF8H 1P9UA 4ISOA 1TPOA 3QZRA 1CGJE 5C5OA 4K60A 3SUFA 4DY7B 2QIQA 2JIZD 2SGEE 3H5CB 1D3DB 1HBTH 1O3HA 1LVMA 2EQNA 2QY0B 2XRCA 1V2KT 1DWDH 1GBKA 3ZVEA 2ZDVH 3V12A 4ABDA 1VZQH 1BMMH 1FV9A 1TQ0B 3E91A 4FXGH 2WINI 1INCA 2BDCA 2VIOA 1AB9B 3SNDA 4FVDA 1WAYB 4X8TH 3ZZ9A 1HAIH 3BF6H 3BTHE 1GL1A 4K2YA 1AZZA 1MCVA 4IN2A 1QRWA 4XBDA 3IWMA 1V2UT 2ODYB 1EXFA 1QBNA 1HFDA 1MU8B 3MO9A 2VJ1A 4FUGA 1MKWH 2GZ9A 1GI1A 3UAIC 1BTYA 4UFDH 3GDSA 3PMAB 2AGIX 5TCCA 4I8JA 2VH6A 1YC0A 3TJOA 1AMHA 4CH8B 1TRMA 1C5QA 4UFFH 3E16B 2FI5E 5BRRE 1LPZB 2B7DH 5PTPA 3NK8A 4O3TA 3KNXA 3SNCA 4CRDA 4OS1A 1Y5UT 2OC7A 4JCNA 3SQHE 3MHWU 4AOQA 4AYVB 1QJ1B 1JMOH 1GCTC 5T6DA 5E0JA 1P02A 1TX6A 4MLFB 1V6DA 1F7ZA 4B6EA 4OS4A 3T5FH 1FONA 4MQAA 1HNEE 2Y80A 2ZHEH 1FAXA 1C1RA 1SGTA 2GZ7A 3UTUH 3EDXB 2WYJA 1S6FA 2QCYA 1F5KU 3BV9B 2A2XH 3G01A 2GGVB 3ZVCA 1C1QA 1BCUH 4HGCA 3EYDA 1EZXC 3SUDA 3KEEA 1TNGA 2BY7X 3EQ0H 3LJOA 3SZEA 4X6OA 2BVXH 2NWNA 4YESB 1L4ZA 3F9GA 2D26C 4DT4A 4AX9H 1P04A 4A1TA 5DP4A 1SGCA 1YWUA 4F4OC 3CNRA 2BD8A 1OWIA 2Z9IA 3HGPA 5F8XA 1PJPA 2D2DA 1EB2A 4WXIA 5AFZH 2GX4A 2GTBA 2FS9A 3GY5A 1O33A 1J17T 1O38A 3RXKA 1Y59T 1GBAA 2ZEBA 2KCAA 2W26A 3ZYEA 2ZECA 2OC1A 2VH0A 3M7UA 1AY6H 3RXLA 4B2AA 5CE1A 1T32A 3LH3A 4K8BA 1SSXA 2V6NA 4WMDA 1O2SA 5T6GA 3CS7A 3OSYA 1GMCG 3SV6A 3ZZ8A 1ELGA 3RXBA 3ENSB 2ULLA 4ZMAH 1OWEA 1T8MA 1C1UH 1AIXH 2ODQA 2ODPA 4ACBA 2BD2A 1KXCA 2ZHQH 1K1PA 3PWCA 2RDEA 2QF0A 1SR5C 1UVPA 2P3TB 3BIUH 2A4RA 2CV3A 3A7ZA 2EI8A 3LGUA 1WCZA 3DA9B 2BDHA 4TT3D 1TPPA 4INHA 3RM0H 5DP5A 1FY8E 3SU4A 3QUMP 3V3MA 1P2OA 3EAJA 4NIVA 3P95A 1TMUH 1TQ7B 1GJ9B 3LJJA 1XUHA 1E79D 5EJLA 5CHAC 1GJ4H 2VVVA 4I8GA 1YM0A 2KFWA 3NXPA 1Q31A 1G3CA 1VCQA 3ZYDA 4LK4A 2Z3CA 2WPLS 3A86A 1WXRA 5HM2A 1GJ5H 3B23B 5HYOA 1COWD 1BRCE 4X1QU 5FHTA 5C2ZA 1S84A 1B0FA 4MPUA 5DPAA 3RMLH 3BTTE 2EC9H 1A0LA 4KTUA 1P12E 1TRYA 1CT2E 1K1MA 1PYTD 1K2I1 4Y6DA 8GCHF 2ZHDA 3E3TA 2C93B 4ABGA 8KME2 1QNJA 4I32A 3SV9A 1DLEA 5DP9A 4ABJA 5DP7A 5EW1H 2FLBH 1UVUH 1KTSB 1W13U 1P05A 2J98A 3A8AA 1DWCH 3W1EA 1GJBB 1QB1A 2L6OA 2TBSA 2J5UA 1YPMH 2C8XB 4HTCH 5FAHA 1G3DA 2W3IA 5EGMA 1BHXF 3NWUA 4MNYA 3F68H 3U8RH 3A7TA 1MAXA 4Y0ZE 1O3EA 2JETC 3UIRA 1LHFH 1AGJA 2WPHS 2F9NA 1GL0E 1KDQB 2G52A 4BAOB 1HAVB 1UHBB 2H9HA 3LGWA 1BMLA 2WV9A 2L74A 1DPOA 2TRMA 1TGNA 2ZPQA 2BDIA 1GVLA 2QAAA 2UWLA 1GBLA 4FOUC 3LPRA 2J94A 1CA8B 2VIVA 1NM6A 5SGAE 1W0JD 1LVBA 1E35B 2UUFB 3V0XA 3F2HA 5GCHG 4BOHA 4BTTB 1EATA 3BIVH 1HPGA 1ZJKA 2PLXA 4DT7B 3KYFA 4FUBA 5EQSA 1YCPH 1JBUH 1YGCH 1NY22 2WUBA 2FM2A 1JRTA 3UOPA 1H4WA 1PPFE 3A7YA 1BMAA 2XWAA 1YP9A 3AW0A 4RKOB 4XBCA 1P9SA 2H5DA 5JB9S 5L2YH 2KZ4A 3N7EA 2BQWB 1THPB 4YZUA 1TX8A 1NFXA 2YOLA 3TH3H 3URCA 1ELTA 1MH0A 4YM9A 1J16A 3GOVB 3HK6B 4K1TA 1C5MD 3A7VA 4XOJA 2ZTYA 2R2WU 1GHAF 1QJ7B 1L4DA 1GHBG 1P10A 2WPDD 3KF2A 4Q7XA 1ZMNA 3F3BA 4NZQA 2PGQB 2V35A 4X6NA 1GMHF 2AIPA 2VWLA 1IHSH 2BY6X 1CBWC 1W7GH 2C8YB 3NCLA 2JH6D 3ZZ7A 1IQFA 2BVSH 3PV2A 2ANKH 4I8HA 4ZXXH 4WH8A 2F4LA 2GT8A 2SGPE 2BD4A 1C2HA 1O2OA 1P0SH 5ESTE 2QF4A 2FLRH 1QBVH 1HDTH 2AHME 5HM9A 2XBWA 3FOAA 4NG9H 3MU5A 3P8NA 2QF5A 1O3GA 1ZZZA 3A7XA 1GGDC 1DWBH 4ZAEA 1F0UA 3KIDU 4NSYA 2KR7A 4YXWD 3N7DA 4MPXA 4GSOA 5JBTA 1TA2A 2HGTH 2SGQE 5B6LA 1EAUA 2Z3DA 1TWXB 1FNIA 5A0AE 3PRBA 2CGAA 3URDA 2A32A 1ETSH 1YY3A 4U2WA 1XKBC 1Z8IB 1C9TA 1G2MA 1C2DA 1YBWA 3O8DA 2AS9A 1GI7B 2J2UA 4FUDA 4DIIH 5KGOA 3RU4T 2JH0D 1GBEA 4A6LA 1ZRKA 1LTOA 1E0FD 7LPRA 4A1VA 8ESTE 2ZCKP 3FO8D 2GMTC 2HLCA 3CP7A 2O8TA 3A80A 1W0ZU 4NIWA 1K1JA 1ARCA 3B8JA 2D8WA 5GJ4B 1ZPZA 4O03A 3S69A 1WOFA 1UCYK 3OE7D 1HYLA 5EJ1A 1TGBA 2V3MA 1O5CB 4WJG2 4KTSA 1BTHH 1O5AB 4TSFD 3F9HA 1O3KA 1UK3A 4TPYA 2GCHG 1CHOG 1DICA 1IAUA 2J97A 4D8NA 1K1NA 2G5VA 3LIWA 2P8OC 1SGFG 2YMSC 1EX3A 2F9PA 1DY8A 2PV9B 2ZGJA 1GBTA 4BNRA 2ASUB 2XXLA 1S6HA 1SI5H 1BIOA 1HXEH 1SGNE 4X2WA 3SQEE 2BY8X 2ZDKA 2XOKD 2HPPH 5DK1A 1O30A 1WSSH 4YTAA 4AB9A 1BJVA 5F8TA 1CO7E 2SNVA 2EEKA 1HJAC 3P17H 3RXFA 1QRZA 1ESAA 3ZVGA 1XX9A 4ISHH 3KL6A 1O5BB 1IQEA 2A4OA 1FJSA 3GS9A 3HKJB 1C5OH 5JDUB 3OEHD 5FPTA 1EAXA 2G4TA 3AK5A 2RFKC 4GPGA 2W7SA 1SKYE 1ZMJA 1LHEH 2BX3A 1LCYA 3F9EA 3GYLB 2IPQX 3PB1E 4AZ2B 1GI8B 1L1GA 3A82A 3PMJA 3MNBA 3MI4A 3IITA 4UE7H 1GI6A 3U28C 2HWLB 4H4FA 2F3CE 2G5NA 1Y3VA 2PR3A 4UFGH 1IOEA 1GI3A 3E1XB 3QLPH 3S7HB 1OHHD 2XBVA 4IBLH 3M3VA 2QN5T 3OX7U 2TIOA 4CR9A 1FQ3A 2O8MA 1X7AC 1ABIH 2FXRA 3SI3H 5T1VA 5FCRA 5EG4A 3GCNA 1TA6A 2M2AA 4FUCA 5LH8A 2P3FH 1BJUA 3TK5A 3VEQB 2OXSA 3TU7H 3K9XB 1EKBB 1BQYA 3ZIAD 4GCHF 2PKSC 1DXPA 4VGCC 1D3QB 1XVOA 4CRGA 1KLTA 3EGKH 3MQKC 1SQRA 4KELA 4X8SH 3PLKA 5LPRA 3A7WA 2Z7FE 4I7YH 2H2ZA 6LPRA 1ARBA 2QXJA 2G8TA 1AKSB 3PTBA 1K1LA 2Y5FA 1MCTA 4BAMB 1SGEE 2AYWA 4FU8A 1O35A 2V3OH 3Q3YA 1W11U 4YT7H 1UTJA 5AVDA 1PPBH 1IQIA 4XFQA 1GPZA 1LKAA 3A83A 2ZPRA 1GCDA 1Z8RA 2Z94A 1C1OA 1NS3A 1BOQA 4NWKA 3BTDE 5LGOA 4JMYA 3PWBA 2A2QH 1PQAA 1NPMA 2RCEA 1K1IA 4CBNA 1G37A 5GCHF 3MFJA 1P2JA 1FAKH 2FS8A 3D65E 4AN7A 5L6NH 2Y5GA 2G00A 2SFAA 4XE4A 2CJIA 4IMZA 1RJXB 4RI0A 2B9LA 4ZHAA 1TGSZ 1BTUA 1UVSH 1ZSKA 2J9NA 2GZ8A 2YNBA 1NU9A 5C3NA 1ABJH 1H8HD 6CHAC 5JB8S 3OEED 1AE5A 1J15A 3PMBB 3ZZCA 1O3FA 2W7UA 2ZFSA 1AQ7A 1LHGH 1ZMLA 2KM0A 5FCKA 4JZEH 1ELCA 1VITF 3B9FH 4X6PA 5GNDA 4ABAA 3BG4B 7ESTE 2AGGX 3HGNA 4BTIB 2F9UA 1PPHE 1ID5H 2G81E 4ZHMU 1LPKB 4DJZB 1ZTLA 4FU9A 3UY9A 2BTCE 4LOYH 3RXVA 1GHBF 1LVOA 2BZAA 2XCFA 3BTME 3DFLA 1B0EA 5B6OA 6GCHG 3NUMA 4ZKSU 3ZZAA 4AGJA 4B1TA 2A7JA 2P93A 1HAOH 4DOQA 2A7HA 3EA8A 1YPKH 1KXAA 2BM2A 2KCYA 4F49A 1T7CA 4MNVA 4X0WU 2OC0A 1V2LT 1W2KH 5A8YA 1S81A 3MU0A 4WF8A 1O2UA 1CU1A 3TIUA 1FUJA 1NRRH 1P01A 3JZ1B 6ESTA 3RU4D 2RA3A 4RN6A 5T6FA 3U69H 3T62A 2Y82A 2BDYA 1G32B 1ETRH 1P11E 3BN9A 3KQEA 3U8OH 1C5LH 3TJUA 1WTGH 1HUTH 1F0RA 5ESBA 1BBRE 3NKKA 2AFQB 4Y8ZA 1QL8A 1TALA 1V2OT 4E06H 1O2MA 1YLNA 3MU8A 4XD7D 1GI0A 2FMJA 1V2VT 3MYWA 3SNBA 5EPYA 2WUCA 4CR5A 1PFXC 5FXLA 3E6PH 1ETTH 4WVPE 1KY9A 3K2UA 1LHCH 3ZVDA 1OXGA 1SC8U 2M5TA 1ZHPA 1HAYB 4SGBE 4Q80A 4Q63A 1HLTH 1GJ8B 5EXNA 1W3CA 1UTLM 1VCPA 1OYQA 1H9HE 1O2VA 4RT0A 1NFWA 3RXEA 2BXUH 2CHAC 1PYTC 2XC5A 2D1JA 1J8AA 1C5NH 3BG4C 1V2TT 3R3GB 3TJNA 1ZGVA 3IG6B 1OX1A 3AW1A 2PWXA 3U9AH 4H6SB 1GBIA 1EOJA 1RD3B 4RT1A 1TABE 2FDAA 2RDLA 2QXIA 3AASA 1ELAA 4WY3A 2FOCA 4BTUB 2AERH 1TPAE 1E34B 1TMBH 3SO3A 1DY9A 3GCHC 4E7NA 1O3BA 2GDEH 1AUTC 2ANYA 1EJAA 2XTTB 3RXAA 1MTNC 1G3BA 3FKSD 2B8OH 2ZI2H 3U1IB 1MKWK 5CHAB 7GCHF 3ODFA 1ESBA 3ZV8A 1SL3A 1LMWB 2JJ2D 3GCTF 3RXDA 3ITIA 2ZZUH 3DCLA 3Q76A 2ZFPH 4OS6A 4B71A 1SLWB 2KX4A 1O3LA 1HXFH 3F0PA 3M7TA 1G9IE 3EA7A 1GWAA 4M9FA 4YLUA 2NU0E 2UUJB 2UWOA 2K8IA 4ABIA 1TMTH 4TPIZ 3W94A 1NBMD 1DFPA 1TNHA 4IC6A 1IQLA 2RA0A 3FP6E 1WV7H 2OP9A 4D76A 3Q77A 1QA0A 2ALVA 3F2FA 1ZHMA 1QTFA 4CRAA 1FY1A 4CRBA 3MU1A 1V2RT 1VCWA 1YPLH 2FPZA 4IMQA 1HB0B 1C2MA 4AFSA 2P94A 2CXVA 2XBXA 1P2QA 3RU4E 2J92A 3P70B 1C4V2 1GBCA 1BBRH 3RMOH 1B5GH 3GY3A 3M37A 1QQ4A 1QBOA 2JETB 4M7GA 3TJVA 2Y81A 1OWKA 2NU1E 2HPQH 3HKIB 3WY8A 3PTNA 4MNWA 2O9QA 2GD4B 1C2GA 1O3PB 1QQUA 1FXYA 1TIOA 3LGIA 3AAUA 5JYIA 1K9OE 2BLVA 3R0FA 4KTCA 1QR3E 4Z1MD 2UUKB 1ZPCA 2ZTXA 4P00A 1F0TA 1VJAU 2FYQA 1AFEH 1H8IH 1F92A 2F9VA 1C1VH 1AWHB 1MD7A 1V2WT 2H9EH 3UREA 3QTOH 1DDJA 3BSQA 1TBQH 3LC5A 5EJZA 3TGIE 2B5TB 1CA0C 1VR1H 3OAAD 1C5PA 3STJA 3GDUA 5DP8A 1UTQA 2BD5A 1UTNA 1CT4E 4X1RU 1TAWA 1LVYA 1DE7H 1ELFA 5K0HA 1P2MA 2ZTZA 1AVGH 1S0RA 1TYNA 2EY4C 1C5VA 2ZP0H 1Z71A 1TFXA 3EE0B 1D6WA 1JOUB 1BTXA 1NRPH 1QJ6B 3K6ZA 1A3EH 2A4QA 3QTVH 1AVWA 2GV6A 1GDQA 3O8BA 1UJ1A 2UUYA 3T25A 2WPJS 2WZQA 3K65B 3SU3A 4IC5A 1EP5A 1VKYA 4NFFA 4K69A 1PQ5A 2XNDD 2ZWLH 2PKAA 1A5GH 1C1TA 3SV2H 2NU3E 1CBWB 3SUGA 3BTEE 4IW4E 1H9LB 4X1PU 2ZQ1A 3SU2A 3OTPA 2A0QB 4FU7A 1HAVA 4OM9A 1IHTH 1QGFA 1QB6A 4A7IB 2AGEX 4MNXA 5GXPA 1Y5AT 2ZFQH 3RUOA 2A5AA 4YOGA 1NBME 3QN7A 1S82A 3RM2H 1O2JA 5EQRA 4HFPB 3UNSA 1D4PB 1O3DA 1QL7A 2ZGXH 1NT1A 1DITH 3H7TA 1GGDB 2ZNKH 3T29A 1ELBA 1CE5A 4OGXA 3AAVA 5L2ZH 5DSFA 1QURH 5FX5A 8LPRA 1EZSC 1GJDB 4OS5A 1Z7KA 5AFYH 2ZGHA 1XVMA 4KKDA 2GKVE 1GBDA 3FANA 2EI6A 4FUJA 1D9IA 2THFB 4R8TB 3ZZBA 1O2KA 1HIAA 2H9TH 2FOHA 3VB7A 4JZDH 1XKAC 1FIWA 4I8KA 4OGYA 5DGJA 2ZDNA 1YPHC 3Q00A 2LNCA 2Y5HA 1MAYA 1TOCB 4X1SU 1XUIA 3A8DA
chains in the Genus database with same CATH topology
2XW9A 4H42U 1YYY1 1CT0E 4K1EA 1O3AA 3GY2A 1VGCC 2AH4X 1GJAB 1V2QT 2GMTB 1XXFA 4AFUA 4R0IA 2OINA 1LDTT 1C4U2 1C5SA 3I29A 1GJ7B 2FOEA 2A5IA 1MTUA 1K22H 5EQQA 4GLYA 3MU4A 1SBWA 2FO9A 2W3KA 4INLA 4JYVH 2VNTA 2TGPZ 4CHAB 3LGTA 4PROA 1E36B 3RXJA 3TLOA 3ZV9A 3A8BA 1MBMA 4B2CA 1NESE 1EP6A 5LPEA 2AEIH 1AUJA 2VB0A 3HPTB 3UNRA 5IDKA 1J14A 3TITA 1XUGA 1BMNH 2HNTF 4OS7A 1ELDE 1UMAH 1LQDB 2WV4A 1SB1H 3SOSA 1CGHA 2P8OB 1YKTA 1NTPA 3OY6U 1D6RA 1P09A 1UK4A 1RIWB 5E2OA 3DFJA 1T8LA 1ZGIA 1XUKA 3T2NA 1V2MT 3T26A 1Y3WA 5JPMH 2ZFFH 1TRNA 4JZFH 1EJNA 4Y71A 3Q3KA 1HJAB 1O3MA 3T27A 1O2YA 2BLOA 3ZZ5A 2BLQA 1MZAA 1YPJH 5HGGA 5DKMA 1CVWH 5CMXH 3GY8A 3QK1A 1KIGH 2WYGA 2J95A 3VB3A 4K5ZA 4WH6A 2BVRH 3LOXA 3P8GA 1ANDA 4NIXA 5FBEA 1TNKA 2TGAA 1EPTA 1O5DH 1DWEH 2PW8H 4ABBA 3RC4A 2BDAA 1SOTA 1ELVA 3A8CA 1C5YB 2H6MA 2ZIQH 1O0DH 1SHHB 1DSTA 2BZ6H 4Z6AH 1NN6A 3ZZ4A 1MQ5A 1IQNA 1V2NT 1V2JT 2AMPA 1NRQH 3V13A 3DD2H 4ESTE 3RXRA 1HGTH 2PKSB 2R2MB 3H7OA 4VGCB 1BA8B 1W0YH 2XBYA 3A85A 3GCOA 1RTFB 4CHAC 2BY5X 2VIPA 3E0NB 1HAPH 2FTMA 3A87A 1MKXK 2CN0H 3K6YA 2KAIA 3VXFH 3UQVA 4X2XA 1GMCF 4AORA 4XSKU 4UFEH 3UR6A 4IS5A 5G4BA 1SQAA 2QXHA 3P8FA 9LPRA 1C1NA 1RIWC 1E37B 3GY6A 2C4FH 1ZOMA 2BHGA 1RS0A 2J4IA 4CRCA 1C2KA 3C1KA 3GISB 4FUFA 1SFQB 2DE9A 5E0GA 1O2WA 1YPGH 4B75A 2ZU4A 3HATH 1IQHA 1WUNH 4QT8C 1F0SA 2BQ6B 3QWCH 1AI8H 3FAOA 2Q6GA 1OP2A 4WWYA 1W12U 3RXSA 1TBRH 2OD3B 3MNCA 1UK2A 6CHAB 4YLQH 3S9AA 4KGAA 4JZIA 1AVXA 1O5FH 2PGBB 5EXMA 1A0HB 4B76A 1NFUA 2G4UA 1AFQC 1KTTB 2Z9LA 5C20A 1O2TA 3RC6A 2ZG0H 2QV1A 3JZ2B 5DP6A 1C1PA 2Q1JA 1YF4A 3KQDA 2ZO3H 2AMDA 3ATIA 1GG6C 3M3TA 2AIQA 2GCTC 3KN2A 2C8ZB 3MOCA 2VINA 2BX4A 1DANH 2RG3A 3ATKA 1MU6B 3M3SA 4AFQA 2PTCE 1O3NA 1A7SA 4Y7BA 3STIA 2WPIS 1L1NA 3SHAH 2ZFRH 2FOAA 2OBQA 2OLGA 3SGQE 1BZXE 2FI3E 5H4IB 1PPGE 2VVUA 1RTKA 1TPSA 1P8VC 2R3YA 1FN8A 2G55A 3FZDA 4YT6H 2PSYA 4D7GA 3PMHB 1EPTC 1RTLA 1ZTJA 3MO3A 1G3EA 3VB6A 3SJ8A 2J34A 1LPGB 1Z1IA 1SGIB 5A0CA 2FESH 1H9IE 1SGYE 5AHGH 3OY5U 4DGJA 2ESTE 1PPCE 2FP7B 2A7CA 3BTFE 1C1WH 3SBKA 1PQ7A 1UTPA 1NRNH 3VPKA 3LGYA 2OTVA 1C5WB 5GPIB 1W10U 1OKXA 2PHBA 1IQGA 2GP9B 1YPHE 2I6QA 3ZZDA 4ZKNU 1O32A 3MH5A 2IOTA 4ISNA 3UUZA 1XUJA 1OYTH 1O3IA 1NFYA 2BLWA 3DUXH 8GCHG 1GHYH 2CHAB 2FX4A 4BXSA 1F5RA 3ESTA 5EODA 1ESTA 4U32A 2PUXB 2Z9GA 1KSNA 1NRSH 1SGQE 1DX5M 3GDVA 4GHTA 1TBZH 1GBBA 3M61U 1U6QA 2C90B 1V2PT 2VWNA 1GDUA 4UD9H 1UTMA 4IGDA 3GCHB 3GICB 5JBBS 1DOJA 2GVFA 5EU8A 1MTNB 4X2YA 3PO1C 1T31A 2FOBA 1GBJA 4MG3A 1OPHB 4ISLA 1FY5A 2Z6BD 1MQ6A 1Y3XA 2FZZA 4J1YA 4MVNA 4AYYB 3FFGA 3RMNH 3LONA 3A81A 2STBE 1FLEE 2BB4A 3PLBA 3SU0A 1UVTH 2FOGA 1KYNA 1GHXH 1TNJA 1AZ8A 2VWMA 2HRVA 2OQ5A 1T4VH 5DO4H 3KGPA 4AG1A 2BY9X 1FN6A 4ABFA 4X1NU 5TJXA 2XC4A 1THSH 1WTHD 4H6TA 3F1SB 4NCYA 4WXVA 5J4SA 1EUFA 1CQQA 1OS8A 3QDZB 4DW2U 1A46H 1S5SA 4LZ4B 1QRXA 2OCVB 4CH2B 4FUEA 1UTKA 4MPWA 4IN1A 1ANEA 3VB5A 1XMNB 1C2EA 1O37A 2XCNA 1P03A 1WU1A 1EB1H 1QL9A 4ZKOU 3MWIU 2SGFE 3PM3A 1GHAG 1T8NA 2VGCB 2PUQH 1Q3XA 1D3TB 1A3BH 1HAHH 3RXIA 1ZPBA 1QCPA 2R3UA 3W95A 1GMHG 1G2LA 1O34A 1W8BH 1SPJA 1O5GH 3I77A 1FIZA 3M5NA 2HVXA 4I31A 2ZCLP 1XXDA 1CA0B 1JIRA 2ANMH 2ZA5A 1P2KA 4O3UA 1NU7B 1DS2E 2GCHF 3BTQE 2ZGBH 1CHOF 3L6PA 1RXPA 3SHCH 1TGTA 2VVCA 4K1SA 1FY4A 3UPEA 3O8CA 4A92A 1ZR0A 2BDGA 3BEIB 5K7RA 1O2LA 2NU2E 2QXGA 2SNWA 3RLWH 4NSVA 3A89A 1QA7A 1QB9A 3E0PB 1C9PA 1WBGB 3A88A 1BRBE 5T3HA 1BITA 2P95A 3GY4A 3TK6A 1O2ZA 1C2FA 1KXDA 2ZU3A 4TWWA 2ZHFH 3ATLA 4Z0KA 1P06A 1MBQA 4YOJA 2XYAA 1H8DH 1MD8A 1BB0B 1OP8A 2R0KA 3SV7A 3RMMH 1OSSA 1WQVH 1HJ9A 4DIHH 1O2GH 1BUIA 4Q7YA 1FPCH 2G51A 4OS2A 2P16A 1T4UH 2ZDLA 3SJOA 2P3UB 4LZ1H 1ZJDA 3NPSA 3P6ZB 1QHRB 4NA7A 2EA3A 1AN1E 3I78A 2BXTH 1SLUB 4A5TS 4NIYA 4ZROA 3SV8A 2TGDA 3PYHA 3TNTA 4UDWH 3CS0A 3QGJA 3QGNB 2BMGB 3RXPA 1A5IA 2F83A 1A5HA 1SVPA 3BEUA 1AHTH 2A31A 1AB9C 1A61H 2VGCC 1F2SE 1EAWA 2ZDAH 5A0BA 4O9VA 1SQOA 3RXTA 1G30B 3S7KB 4NGAH 5AF9H 2BDBA 2SGAA 3UQOA 1GBFA 2B0FA 1NROH 2ILNA 2HNTC 1W7XH 1BBRK 1W14U 4I8LA 4X8VH 2HALA 1O31A 4Y76A 1SGDE 3FP7E 1CSOE 5J4QA 1G36A 3SNAA 1JXPA 4NWLA 4TYDA 1KLIH 5FPSA 4J2YB 3SU5A 2HOBA 1WYKA 1VGCB 2O8LA 7KMEH 3RXCA 3KQCA 2XNIA 1HAZB 3BEFB 5F8ZA 1P3EA 1UTOA 3FVFB 1VITH 3D62A 3V7TA 2IJOB 3M5MA 2Y7XA 2STAE 1SGPE 1K1OA 3M36A 2BD3A 2Z9KA 4CREA 4E05H 3S9CA 4YO9A 2JKHA 2K1QA 1BRAA 4FUHA 1CGIE 2Q6FA 3LDXH 3D49H 1KDQA 1H1BA 5FBIA 4NZLA 1Z8JB 4TWYA 1UHBA 3ZZ6A 5C67A 2R9PA 3TNSA 1T8OA 3GYMA 3A84A 5I25A 4RKJB 4AFZA 3TH4H 1BTWA 1GHVH 1DVAH 3TGKE 1KLJH 1TLDA 4GCHG 4GUXA 4X8UH 1IQJA 1L0ZA 1DXWA 3L3TA 2YNAA 1WQSA 1ZTKA 2FOFA 1EZUC 1C2IA 1EJMA 1O3JA 3RXHA 1HAGE 3UNQA 2PSXA 1OWHA 3VFEA 6GCHF 4D7FA 1O3CA 2PKAB 2Y6TA 3VXEH 5IYTA 3ZVBA 3HK3B 2ZQ2A 2NU4E 4DVAU 5JBAS 3O8RA 4NFEA 5E2PA 1JWTA 4BXWA 4Y8YA 1N1LA 1MUEB 2CF9H 4AGKA 2ZF0H 1D3PB 4BAQB 3LGVA 3MO6A 1BTPA 1L2EA 4Y10E 5TCAA 1UCYE 1GBMA 2FODA 3OYPA 1ELEE 2C8WB 2TGTA 1K21H 1NC6A 4XBBA 1HJ8A 1GI4A 4K3JA 1BDAA 1FDPA 1TNIA 2Q6DA 3AVZA 1GBHA 3S9BA 1YCPM 5ETXA 2XWBI 1GMDG 3DT0H 2O8WA 4BAHB 3SI4H 3BTKE 3MNXA 3ODDA 3MH7A 3MTYA 2Y7ZA 4SGAE 1DM4B 3MH4A 1QFKH 5DG6A 2V3HH 5ABWA 1DLKB 1GI9B 5A8ZA 1ZLRA 3LKWA 1L1JA 4THNH 1YCPK 3M35A 1HIAB 4X2VA 1F5LA 1NZQH 4Y0YE 1VITG 4K8YA 1O2PA 1N6YA 3UWJH 1C5ZB 2GV7A 1SFIA 3RXGA 1GVKB 2EI7A 1O2XA 4GVUA 2WPMS 4HZHA 1PPEE 2GT7A 1TX7A 1E38B 1Z8GA 1QY6A 4BAKB 2QC2A 3CENA 1O5EH 4Y7AA 2FI4E 2H5CA 2FX6A 1DUEA 1C4Y2 3EA9A 2ZKSA 1MTWA 2FYRA 2F91A 1GHZA 4YOIA 4JYTA 5I46H 1GVZA 4Y79A 4ZXYH 2TPIZ 5A09A 2VIQA 1MTVA 3SW2B 1Q2WA 1YLDA 5EOKA 1LKBA 1IQMA 1EZQA 2W5EA 4B74A 4I33A 3RLYH 1EAIA 3QZQA 2QF3A 3UFAA 1Y5BT 2VIDA 3PLPA 5EXLA 2ZC9H 3ATWA 4MTBA 2IPHA 5HMAA 3VGCB 1SG8B 3TGJE 3TVJB 2BYAX 1AFQB 3BG8A 5FPYA 1A1RA 3RXQA 2XC0A 2F9OA 3PROA 4ZHLU 4GHQA 4B73A 1GG6B 1O3OA 1SLVB 4FVBA 2GCTB 2ZHWH 1EQ9A 1ZYOA 1GI2A 1PPZA 2A4GA 3SU6A 3RXMA 1ORFA 4JYUH 1THRH 1UCYH 1S83A 1FY3A 1DT2A 1EOLA 4DG4A 4ZUHA 1IQKA 2A45B 1LHDH 1RFNA 1AWFH 2OBOA 1MKXH 1Z6JH 3UR9A 1TE0A 5FX6A 4LXBH 3ELAH 3LC3A 1N8OB 1HV7A 1LQEA 1BT7A 2OC8A 2OUAA 2ZGCA 4CRFA 4ZKRU 1LO6A 1SGFA 2UWPA 2VU8E 3QX5H 5GWZA 1S85A 3F6UH 2ZFTA 3RP2A 1KXEA 5DJ7A 4DURA 3ZZ3A 2R0LA 4A1XA 2F9BH 1EPTB 3U8TH 3M7QA 2QYIA 1TB6H 3SN8A 1A0JA 2QA9E 1GHWH 4E7RG 5F6MA 1N6XA 1Y8TA 5EPNA 3TK9A 2VIWA 3RDZA 4WMEA 1P3CA 3NZIA 1EASA 1OWJA 1MTSA 3DHKH 3LT3A 3UWIA 1CHGA 4JZ1A 2SGDE 1A2CH 1Z1JA 2V0BA 1GDNA 2ZDMA 1O36A 2ZPSA 1ANCA 1C5RA 4ZH8A 4JK5A 2Z3EA 2ALPA 1DUAA 7GCHG 2HNTE 3GCTG 1FPHH 5A8XA 1O2RA 1J9CH 1O2QA 3MNSA 4HI3A 1O2NA 2DE8A 4ABEA 4Y11E 2I6SA 1JRSA 2KAIB 5C5NA 3VGCC 5DP3A 1ZHRA 2C3SA 4TY6A 1PQ8A 4BANB 1Z6EA 1VJ9U 2J38A 4KP0A 5GIBA 1SHYA 4Q2KA 3SGAE 3PV4A 2BOHB 4DCDA 1O39A 1GI5A 5LPFA 5C1XA 1KXFA 1AKSA 1XM1A 3D23A 1DSUA 3FZZA 2ANWA 1HAXB 3OTJE 1BRUP 4NA9H 1SOZA 2P59A 1KXBA 2GDDA 3FP8E 3T28A 4Y8XA 4B2BA 1HCGA 3PO1B 4JK6A 1HRTH 1Y3YA 4X6MA 2ZU5A 4ISIH 1GJ6A 3ATMA 1N8OC 5BPEA 2ZU2A 4MDSA 1A4WH 2PFEA 1RRKA 1SGRE 4UEHH 1C5XB 3Q3XA 2JH5D 5F03A 4GAWA 3TH2H 2ZU1A 3E8LA 1K28D 5JBCS 1O2IA 3RXUA 1M9UA 1SLXB 3F9FA 2CMYA 4RSPA 2FEQH 3SGBE 1V3XA 4O97A 3M5OA 5A2MH 2PTNA 1ANBA 1OWDA 4FUIA 4CBOA 5C1UA 3L33A 3SJKA 2H1UA 1NO9H 1SQTA 1C2JA 1YPEH 4ABHA 1ZSLA 1FI8A 3MMGA 2DUCA 3U1JB 3SNEA 2BOKA 5L30H 1XUFA 3GY7A 1C5TA 3E90B 1ZSJA 3C27B 3MH6A 3SJIA 4MPVA 9ESTA 1C1SA 1FMGA 3VB4A 1JIMA 2FOMB 4D9QA 4NA8A 1GMDF 3N7OA 3LH1A 3P8OA 4Q7ZA 1TOMH 1MMJN 1ZRBA 3ZVFA 5C1YA 2FWWA 1O2HA 2BD9A 3SU1A 3SORA 1UO6A 2A1DB 3KQBA 4TY7A 4U30A 2OQUA 3SZNA 2ZCHP 3S0NA 2FIRH 4INKA 1AU8A 1UVOA 2AMQA 1AO5A 2WPKS 1OOKB 3KHVA 1QIXB 3SJ9A 2BQ7B 1BHXB 2FTLE 3KCGH 1ACBE 1S0QA 1FZZA 4UONA 1Y3UA 4XDEA 4D9RA 1P2IA 3OU0A 1C2LA 1P2NA 1C5UA 1GCTB 1P57B 5HXFA 1AD8H 1B7XB 5E8EH 2O8UA 3UOUA 4AG2A 3P92A 1BTZA 2WV5A 2A5KA 3ZVAA 2IN2A 2VWOA 1OP0A 1MZDA 1TONA 1RGQA 3U98H 1GJCB 5GDSH 4U01A 1C1MA 1SMFE 4WMFA 3LU9B 4AB8A 2LPRA 2Z9JA 3SUEA 3BTWE 2QGRA 3RC5A 3QO6A 3BTGE 1TGCA 3TPIZ 1YLCA 3RXOA 3M5LA 5EW2H 2BD7A 5E0HA 4ASHA 1V2ST 1TNLA 1AE8H 2CF8H 1P9UA 4ISOA