5DK1A

S. erythraea trypsin mixed catalytic intermediate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
230
structure length
230
Chain Sequence
b'IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLEAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPNAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQINAGAVSAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title High resolution structures of S. erythraeus trypsin throughout the catalytic cycle
rcsb
source organism Saccharopolyspora erythraea
molecule tags Hydrolase
total genus 59
structure length 230
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dk1A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dk1A01
1PPGE 1EPTA 2BDCA 2W3IA 2O8WA 1GMDF 1LHCH 3RC4A 4DIIH 1FONA 2AIQA 1FNIA 4UFGH 1HAPH 1ZMLA 2OC1A 3DFJA 4DT7B 1NFXA 3SJKA 1MKWK 1GBJA 1QB6A 1GBHA 1HAGE 3OY6U 2FOAA 3TU7H 2ZGCA 5JPMH 2QXGA 5J4SA 3FP8E 4GUXA 1Y5UT 3BTKE 3GCTF 1ESTA 2ZIQH 2A7HA 1OXGA 4J2YB 2V3OH 2Z7FE 4MNXA 3BTEE 5FBIA 1SGYE 1TNJA 5FHTA 3RXVA 1SHHB 1LVYA 2D1JA 1O2TA 2WYGA 1KSNA 1EOLA 4INLA 1FY8E 1GI0A 2QF3A 4BAMB 3P95A 2SNVA 3B9FH 1ZSLA 4AX9H 2OTVA 3BEUA 3RUOA 3ZVGA 2HNTF 4Y11E 3ZZ5A 3KNXA 1PPBH 1O3BA 1LQDB 2D26C 3BG8A 1TE0A 1TONA 3RXGA 4ZKSU 2H5DA 4YTAA 2TGTA 1QR3E 4NIYA 2A4GA 1SMFE 3MNXA 1EP5A 1IQNA 2OC7A 1MD7A 1LKBA 1PPFE 1TYNA 4ABEA 1BTZA 1EOJA 3MU0A 3NPSA 1DWDH 3A7VA 1YCPM 1FUJA 4CRBA 2BTCE 3UOPA 4X2VA 3ATLA 1C4V2 1CA8B 1D3TB 1RTKA 1O0DH 2FLBH 4LZ4B 1CA0C 1BA8B 4HI3A 4JK5A 1TLDA 2BLQA 2CHAB 1P2NA 2XCFA 3B8JA 3LGVA 1C2GA 1HIAA 5A8ZA 4ISIH 1TA2A 3QDZB 2ALVA 1HIAB 4Y0ZE 3M3TA 2W7UA 4ZHMU 3SU1A 1HFDA 5T3HA 1CSOE 2QCYA 5FPSA 1P2OA 2P3TB 2ZFQH 1ZSJA 1AUJA 3PO1B 4THNH 3EE0B 1LHDH 2Q6FA 5EG4A 1F0TA 1RIWB 1VCWA 2FEQH 5C1YA 3MHWU 2BD4A 1OWHA 4Z6AH 2NU0E 2BY8X 1SOTA 2BDBA 3RXSA 3LJJA 4GSOA 1TOCB 1M9UA 3O8RA 1C5SA 2DE9A 1O5EH 1QBNA 4K1TA 5EW1H 1K9OE 4JYUH 3HGPA 1QNJA 1SGQE 1JIRA 1DUEA 1TRMA 2AGEX 3Q76A 1BTYA 1C1TA 1MH0A 5EU8A 5G4BA 1IAUA 1S0RA 3V0XA 3A80A 1BT7A 1BMNH 5C2ZA 1L4DA 1Y5BT 5C5NA 4NIXA 2SGEE 1W7XH 2CJIA 1TFXA 1YLCA 2A1DB 3L3TA 1LTOA 1L1NA 2JKHA 1HRTH 3SNEA 3A8AA 3TIUA 4BAHB 3BG4C 1KY9A 2ZPQA 4HFPB 4Y79A 2HPQH 1O33A 3MOCA 3M5OA 3V13A 2P94A 2F9VA 1TNIA 2VWLA 2OLGA 2VJ1A 4FUHA 2GCTB 1AU8A 3SV8A 2XWAA 4K8BA 1O2MA 1V2QT 1TQ7B 4OS2A 1S5SA 4PROA 1FY4A 1GBCA 1TGBA 4R8TB 1O3AA 2R0LA 4ZKNU 3S7HB 5AHGH 5DP6A 1ETTH 1LVOA 3LU9B 2GP9B 3ZVEA 5A0CA 1QCPA 1O2NA 2SGDE 2VVUA 1S6FA 4WH6A 5FBEA 1C1VH 4FU7A 1LHEH 1O5FH 4FUJA 1C1NA 1AFEH 1GBBA 1SGNE 3RXRA 1DXPA 1V2MT 1YGCH 4ISNA 1IQMA 1O3DA 8ESTE 3SI3H 4X1QU 1ZPBA 1NRQH 1XUKA 2PWXA 2TPIZ 3PROA 5JBCS 3EA8A 2BY7X 4FUBA 3BTME 4A1VA 3PYHA 3UR6A 3ZZ7A 3TK5A 4AFUA 2Z94A 3UUZA 1QB9A 1S0QA 1SGFG 3GY4A 2XBYA 3RXPA 1V6DA 3E0PB 3RXJA 1DT2A 1Q3XA 3GOVB 1GPZA 1TPPA 1D3PB 1AD8H 1P05A 5FX6A 2Y6TA 1V2PT 4AYVB 1ELCA 4NIWA 1HAXB 2BXTH 1ANCA 1HJAC 4CREA 1Z7KA 1BJVA 4B74A 1JWTA 1GJAB 1WUNH 2FPZA 5JYIA 5K7RA 3SHCH 2JETC 4SGAE 1BJUA 1G36A 1BTUA 1ID5H 2J38A 4DJZB 4WF8A 1G3BA 2BXUH 1MUEB 3SU2A 1O2ZA 3R3GB 1LMWB 1K1NA 4NWKA 4VGCB 2C93B 1O2GH 3LONA 1TWXB 4AG1A 5A09A 4CR5A 2QIQA 2F9OA 3SQHE 1RJXB 3W94A 5FX5A 2SFAA 3GCTG 3ATKA 1GWAA 2DUCA 1O31A 1DWEH 1BTHH 4X8UH 3PB1E 3RMLH 1O3OA 3P6ZB 1LPZB 2H2ZA 2XRCA 3P8NA 4O97A 4YOJA 2XWBI 1SQOA 3SV6A 1O3NA 1QJ7B 2BD2A 1K21H 3V12A 1GI7B 1NRRH 2A4QA 2D8WA 1AE8H 4SGBE 1PPEE 5EGMA 2G5NA 2WPIS 4MPUA 3SOSA 1NFYA 1O3CA 4BAKB 3MI4A 2OBQA 3BTGE 3T26A 1C5XB 1W7GH 3DT0H 1UCYH 3ZZBA 2Z3CA 3SJ9A 1G3EA 1HLTH 4X1PU 1K1LA 3STJA 1C5VA 2CN0H 3L33A 1ESBA 4GVUA 1QJ1B 4XFQA 3NXPA 1QL8A 1VR1H 1AWHB 4B71A 2ODYB 2B0FA 5HM9A 1MTWA 1AB9C 1J9CH 1P2QA 3RXHA 5JBTA 5C1XA 1GJ6A 1GI5A 1SGRE 2A5IA 4BAOB 5LPFA 1FIWA 2G4TA 3LC5A 1HV7A 1ZHRA 1V2TT 2UUFB 1Z8JB 1EX3A 2Y82A 1GBIA 5EPNA 3N7OA 1CGJE 1AUTC 1TMTH 2ZP0H 3SQEE 9LPRA 4K3JA 1IQFA 1DDJA 1O32A 2QY0B 3BSQA 5E2PA 2RA0A 3NUMA 1PQ7A 3BTDE 4YESB 2R2MB 1P0SH 3M7UA 1SGTA 3UQVA 2G52A 1JIMA 4FUFA 2Y5FA 3ZZDA 1XKBC 3I29A 2ZGJA 2BDAA 1G9IE 1BBRE 2ESTE 1EAXA 1P2JA 1BTXA 1XUJA 4LZ1H 2XCNA 1CT0E 2F9PA 1C5OH 3HKJB 1CU1A 2OC0A 4FVDA 3ZVFA 1KLIH 3PMHB 2VGCC 2J4IA 1ZHPA 1FY3A 1C5RA 1T4UH 4NWLA 3FP7E 4IC5A 4UONA 1S81A 1HB0B 2J92A 8KME2 3RLYH 2ZZUH 5L2YH 1LHGH 1NM6A 1ZZZA 2GT7A 4ABIA 2BDYA 1XXDA 1MQ5A 3UTUH 2G81E 4A1TA 4H6SB 3RXLA 3M61U 1S6HA 3QGNB 3P70B 2GKVE 5GPIB 1FLEE 2FOEA 4TWYA 4H4FA 3KQEA 3ZYEA 1O2UA 4OGXA 4RSPA 2EI7A 2WINI 1P3EA 3A7ZA 2B9LA 1NRSH 1YM0A 1XVMA 1GMHF 1O2OA 4K1SA 1WTHD 1FAXA 4Q80A 1YP9A 1AY6H 1F0RA 2AGIX 4XOJA 1TQ0B 2Y5HA 3D23A 4HGCA 4DG4A 4OS1A 1OOKB 3UQOA 3BTFE 1O3LA 3RXUA 2RG3A 1TX7A 2SGFE 2ZWLH 1WTGH 1G32B 1CGIE 1E35B 3A8BA 1PQAA 2YNAA 1XUGA 4YZUA 3AASA 2FOFA 1TB6H 1TX8A 2G4UA 3MYWA 2EI6A 2HALA 1CA0B 1P2MA 4X1RU 4I8LA 1T31A 1BB0B 3AAVA 1A2CH 4X2YA 2BDGA 1PPZA 3OYPA 5E0HA 4CRAA 4INKA 1QRWA 4GPGA 2ZPRA 3RXOA 1XVOA 3ATWA 4MNWA 3SGBE 3M37A 3TNTA 2B7DH 1WSSH 1UO6A 1V2LT 1DLKB 1O3FA 1SB1H 3ZZ8A 4BOHA 3SUGA 1THRH 3KF2A 3ODFA 1ZPZA 1DWBH 4BTTB 8GCHF 1ORFA 1UTJA 2A0QB 3RC5A 4F4OC 1DFPA 2R3YA 1MZAA 1V2ST 2H6MA 2A4OA 3ZV9A 4FUCA 4NGAH 1DXWA 1P04A 3UIRA 1XUIA 2H9HA 4FU8A 4A5TS 1Z1IA 1BHXB 5DP3A 4YOGA 2TGAA 4AZ2B 1XUFA 4Y71A 4NA9H 3FAOA 1C1RA 3E1XB 3RC6A 1TMBH 2QN5T 3SNDA 2W26A 2P95A 1PYTD 1C5YB 1TPOA 1WQSA 2EA3A 5I25A 1C5WB 1LPKB 3KQDA 1MZDA 3QX5H 1AE5A 2Y7XA 4OS4A 3RXEA 5EODA 3EDXB 1YCPK 3M5MA 1Y3VA 4IW4E 1KTTB 1UVUH 4NSYA 3S9BA 2BD3A 1AI8H 3PWBA 5CHAC 2FX6A 4I8GA 4IN2A 3RXKA 4Y8XA 3QUMP 1K1OA 1E34B 3LH1A 1ELTA 3QN7A 2IPHA 1ANDA 2A7CA 2BOHB 4K5ZA 1LCYA 1UJ1A 4IC6A 1BQYA 1K2I1 3BG4B 1CGHA 1J14A 2UWOA 1C1WH 1MAXA 1ZSKA 1ZGIA 1J17T 2XTTB 1SLXB 2V0BA 1QL9A 1B7XB 1NS3A 1D6RA 1LHFH 4FUIA 1JXPA 1AFQC 1O2YA 3GCHC 3IG6B 3BV9B 3KN2A 2ZI2H 3E0NB 5T6FA 2ZFSA 4QT8C 1GJ4H 1HGTH 4A7IB 3BTTE 1YKTA 1F5RA 3FZZA 4JCNA 1DANH 3MU5A 2A4RA 1PYTC 4A6LA 3SU4A 3PTBA 3GY8A 1V3XA 1EPTB 1QIXB 2VH6A 5DGJA 9ESTA 1ZGVA 5HM2A 3FP6E 1LVBA 3UPEA 2CXVA 1EB2A 2P8OC 5GDSH 3U69H 3MNBA 2A31A 1QRXA 3ZZCA 1GBDA 1NRNH 3P8GA 2C8XB 1LQEA 1ELEE 1NFWA 3OTJE 1MQ6A 3Q00A 2D2DA 1C5ZB 1F0SA 3SNAA 3WY8A 2P59A 1O2WA 4MPVA 1CT4E 4X8VH 1A3BH 1O5AB 1ESAA 1UCYE 1QFKH 3GY5A 4INHA 1D3QB 1H9HE 4Z0KA 1O30A 3OX7U 4NG9H 4DCDA 1BIOA 1FQ3A 4DY7B 1IOEA 3GISB 4KTUA 2R3UA 1LVMA 1TNGA 2XC4A 3C27B 4Y0YE 4XE4A 2TGPZ 1AMHA 3RMNH 3ESTA 1O2RA 5ESTE 1HYLA 1HJAB 2PR3A 1Q31A 5AFYH 4NSVA 2H9EH 3M5NA 2JETB 3S69A 5J4QA 1SGPE 1O2SA 3SNBA 3P8FA 3SN8A 1RGQA 3V7TA 2JH0D 3GY2A 4DURA 3S0NA 3TGJE 4UFDH 3V3MA 4X8SH 3E6PH 4TWWA 1AKSA 1A0LA 1AN1E 1W10U 3JZ2B 1LKAA 4X8TH 1EP6A 4AOQA 2FTMA 2K1QA 3AW0A 1ELVA 2FP7B 3NKKA 1H1BA 2ZDVH 5T6GA 2SGPE 1GBKA 2GD4B 2QGRA 1ZOMA 5A8YA 4UE7H 5GCHF 3LGTA 2VIOA 2M5TA 1O3MA 2ZG0H 1BBRH 1DM4B 1DWCH 4WMFA 5BPEA 3E3TA 1L1JA 4B75A 1CQQA 2ASUB 3RXAA 1MBMA 1TRNA 3TPIZ 1GJ5H 2BLOA 4ISOA 3SV2H 2VINA 1UMAH 2NU1E 3EA9A 3RLWH 4ASHA 3TJNA 1HAVA 5A2MH 1O39A 4B73A 1H9LB 4XBDA 1GMHG 1SG8B 4D9QA 2PUXB 2CF9H 3MH5A 2LNCA 2IOTA 3RP2A 1AB9B 1TNHA 4YO9A 1ELAA 1SBWA 2ZQ1A 4MQAA 1GI2A 4MLFB 1GHZA 3VXEH 1UTNA 1PQ5A 4E7NA 2BY9X 1UTPA 5DKMA 1BCUH 2QC2A 1GBEA 4ZH8A 1D9IA 1OYQA 2BY6X 1GBMA 3MNCA 2EI8A 3B23B 1TPAE 5F8ZA 4BAQB 2C90B 1P9UA 1C1QA 3SGQE 3U1JB 1IQJA 3KGPA 5H4IB 2GDDA 3VPKA 5HXFA 1RXPA 1BZXE 1UVOA 1BRCE 3NCLA 2ANYA 3RXQA 5FXLA 1BHXF 1QY6A 1PFXC 4ZMAH 4U2WA 1KLJH 1T8OA 1HDTH 3MU8A 2A5AA 4U30A 2R2WU 3SU6A 3DA9B 2GZ8A 1FDPA 1YPHE 5DP5A 1C4U2 2V6NA 1F5KU 2BZAA 3PLKA 1C5LH 1P09A 3F6UH 4IGDA 2ZFFH 2CF8H 8GCHG 1UK3A 4CRGA 4LOYH 4I31A 3EAJA 1CO7E 1ZTKA 4TY6A 1C5MD 2ODPA 4HZHA 5A0AE 1GGDC 3FVFB 1A1RA 1TGSZ 1YF4A 2ZDLA 1GI8B 3LDXH 2J94A 5EQQA 1DY8A 2ZA5A 2W3KA 1ANEA 1GHAF 1S82A 2OXSA 2Z6BD 2PKSC 3ODDA 2TIOA 1F2SE 4ABBA 1ARCA 2HVXA 1GHWH 1GJ8B 1XMNB 2PHBA 3MU4A 5JBBS 1Y8TA 1DSUA 3T27A 1HAHH 1IQGA 1L0ZA 1W3CA 3BTHE 1Z8GA 3O8BA 2Z9JA 1AVGH 2Z9LA 5JBAS 2BLVA 1MMJN 2ZFRH 1N1LA 4KTCA 2ILNA 1W2KH 4LK4A 1SOZA 3DD2H 4AGJA 4ABJA 2AMPA 4DIHH 2PSXA 4AORA 1K1JA 1H8IH 2WUBA 3SBKA 1MU8B 1IQEA 1SVPA 2PGQB 1EZUC 3TJOA 1G3CA 2J95A 2BVXH 4BNRA 2ZGHA 4FXGH 1KLTA 1JRSA 1D3DB 4GAWA 4AFQA 2ZU3A 1GJ7B 1FIZA 2ZPSA 3F1SB 1ZR0A 2XBVA 2Q6GA 3FFGA 3IITA 3H7OA 1E36B 1DX5M 1YYY1 4TPIZ 1EJNA 5JDUB 1ZPCA 6CHAC 1EXFA 4RKOB 1C5PA 5L2ZH 1UVSH 3A88A 1OP0A 1C1PA 1P2KA 4JZIA 1GL1A 1TPSA 3K65B 2B8OH 4KKDA 1UVPA 3RMMH 2JH6D 1L2EA 1OYTH 1ZJDA 3LGWA 3MO3A 4AN7A 1D6WA 5EPYA 4WVPE 3NZIA 1NC6A 1CT2E 1THSH 2VWMA 5A0BA 2FZZA 1QL7A 1GJBB 4YT7H 7LPRA 2C8ZB 2OUAA 3SORA 3MO9A 1HAIH 1C4Y2 4D76A 2OINA 2FO9A 3RMOH 1QHRB 1MTNC 1OWJA 2BY5X 3HK6B 2O8MA 2OC8A 3MU1A 1SFQB 1J8AA 3P8OA 4CRFA 1GCTC 2GMTC 1FXYA 4D7FA 1VZQH 3GDVA 2BX3A 2Y7ZA 5CHAB 4NCYA 4IBLH 4D7GA 1Z6JH 3TLOA 1T8MA 1C1OA 2JH5D 1KDQA 1OPHB 4MPXA 7GCHF 3M5LA 2YOLA 5EW2H 1KDQB 2FESH 1IQLA 2QXIA 2OD3B 6GCHF 1O3KA 5F03A 1L4ZA 3LGYA 1SGFA 3PM3A 4Q7YA 4NZQA 2W7SA 2AH4X 2EEKA 3VB4A 1AFQB 3GCHB 7KMEH 4DVAU 3K2UA 1A3EH 1CBWC 4B76A 4K8YA 1UHBA 1CHOG 1GHVH 1T32A 2Y81A 3VB6A 2FOMB 1AZZA 1UHBB 1DSTA 2J9NA 1OS8A 2HGTH 4ZHAA 5GCHG 3TJVA 1MD8A 2FDAA 3RXFA 5EQSA 3DFLA 3SU5A 1C2FA 3T2NA 2IN2A 2HOBA 1P8VC 1BDAA 1TGTA 5LPEA 2P8OB 1O2PA 3M35A 4NZLA 2GZ9A 2BDHA 4JZFH 4MDSA 1ZTJA 1FMGA 1WYKA 4MPWA 5EOKA 2A2QH 4K2YA 4M7GA 5DK1A 3RM2H 2YNBA 3A7XA 1HBTH 3H7TA 5AFZH 1T7CA 3Q3KA 4O9VA 4D8NA 1AIXH 2LPRA 1UCYK 4CRDA 2A45B 2VVVA 1SQAA 2FTLE 1GDQA 3URCA 3M7TA 2BLWA 5FCRA 3F9FA 1CVWH 1O5DH 3LJOA 3MO6A 4BXWA 1GDNA 2XYAA 3PLBA 1QRZA 2HWLB 5TCAA 4B2BA 3A87A 1W0ZU 2G8TA 3SJIA 3D62A 1H4WA 4Y8YA 4CBOA 2PUQH 5HMAA 3DUXH 1V2RT 2BD7A 3LH3A 4Y10E 3KEEA 1FN8A 1F92A 1P57B 3ENSB 1SGIB 3CENA 2NU3E 3SUDA 3W95A 4ZXYH 1TX6A 4E05H 1ELFA 4WXIA 3Q77A 1TGNA 3TH2H 2ZFPH 1N8OC 2BVSH 2AYWA 1LDTT 1A4WH 1EUFA 1O37A 2C4FH 5DG6A 2UWPA 2I6QA 1ZRKA 4XDEA 2FOGA 5AF9H 3A86A 3T25A 1HXEH 3TH3H 1O2HA 4BANB 1G37A 2O8UA 2PKAA 2PGBB 2ZU1A 3ZVAA 1IQIA 2PKAB 1NESE 1BITA 1PPCE 1MTSA 2C3SA 4ZHLU 1JOUB 2AEIH 1RTFB 3KQCA 1C2KA 1YPMH 1MKXH 2FI5E 1O2IA 2ZTZA 1C9PA 1GHYH 3MTYA 2VB0A 1HUTH 2WPKS 1W0YH 2TGDA 3HPTB 2HRVA 1O3GA 1SGDE 2QXJA 3I77A 1F0UA 2O8LA 3KQBA 4WWYA 3QTOH 2GV7A 1TOMH 1XM1A 1BTWA 4Y7BA 4ZKRU 4ISLA 1GHAG 1P01A 1GI9B 2OBOA 2BDIA 2ZHFH 4GHQA 3ZZ6A 5GWZA 3HATH 2J34A 1U6QA 1SI5H 2ZCLP 1P11E 1PQ8A 2Z9GA 3MH7A 3Q3XA 4JK6A 4YOIA 1ZYOA 2F83A 2WYJA 1OWDA 1VJAU 3ZV8A 3BEFB 1ZHMA 1E0FD 2HPPH 1C5QA 5ABWA 1UTLM 1V2NT 2F91A 1FAKH 2FXRA 2Q6DA 1PPHE 3SJ8A 4DOQA 2FIRH 3QGJA 3SZNA 1IQKA 2AIPA 1HXFH 1N6XA 1TBQH 5TCCA 2ZU2A 4CRCA 1O2JA 1W8BH 5E2OA 1P06A 2BQ6B 3FANA 3M36A 2B5TB 3UWJH 4GCHF 4CHAC 1XXFA 1THPB 5DP7A 5C20A 4FUDA 1XKAC 3GYLB 1YPKH 2ZCKP 1UK4A 4NIVA 3GY3A 2FODA 3K9XB 1UK2A 1GHBF 3GCNA 4IS5A 4K1EA 1HJ8A 1YPEH 2FOBA 5EXMA 1MKWH 1FPCH 1O2XA 1ZTLA 2ZHQH 4MNYA 3QLPH 3AVZA 1QQUA 3RXCA 1RD3B 3SV7A 3BIVH 4X1SU 1EJMA 2SGAA 1SGEE 3IWMA 1XX9A 1YPGH 1GG6C 1MAYA 2OQ5A 2GVFA 3MH4A 2VVCA 3ZYDA 2WV4A 3EYDA 1ABIH 1V2UT 1TALA 3ITIA 4YM9A 4TYDA 3LGIA 1GVKB 3E91A 4JYVH 1SC8U 1ELGA 1GGDB 1O35A 2GCHF 3BEIB 1HAZB 3PLPA 1X7AC 2V3HH 1VCQA 2PKSB 1IQHA 1Y3UA 2OP9A 3LC3A 1VITH 2W5EA 3UREA 2HLCA 4DW2U 5LH8A 1OSSA 3A85A 2F9NA 1NU9A 5IYTA 2A5KA 1QA0A 2ULLA 3A8CA 2FMJA 1E38B 2CMYA 1O2QA 3SHAH 5JB8S 4FUEA 1C5NH 4RN6A 2PFEA 1O3JA 4BTUB 3T29A 3ZVDA 1O3HA 4O3UA 4Q2KA 4E7RG 5CE1A 5DP4A 3RXIA 7GCHG 1TIOA 4JZDH 4WH8A 2ZDAH 1Y59T 4OGYA 3TGKE 1FN6A 3SU3A 1GJCB 2EC9H 3MNSA 4AFSA 6GCHG 4H42U 1BMAA 4X2XA 2WPJS 3GYMA 1NFUA 1O36A 1XUHA 4OS6A 3F9GA 1QA7A 2ZU5A 3A81A 3BF6H 3F9HA 3QZRA 1K1IA 4WMDA 3TH4H 1BRAA 4ABGA 1DY9A 1MU6B 3TITA 3M3SA 2VH0A 3S9CA 5E0JA 1YLDA 3RDZA 4B2AA 1HAYB 4B2CA 1HNEE 1QURH 1OP2A 4HTCH 1WOFA 2SNWA 1W13U 1E37B 2C8YB 2H9TH 2HNTC 6CHAB 5F8TA 4IMZA 3VB5A 5EXLA 1V2VT 1K22H 4AB9A 1B0FA 3EGKH 3RXTA 1OKXA 3RXMA 4ABFA 1GVZA 4Q7ZA 1VITF 2ANWA 2H1UA 3U8OH 4CH2B 1EB1H 1F7ZA 4KELA 2RCEA 4Q7XA 2ZTYA 3DHKH 5C5OA 7ESTE 4X6PA 1AKSB 3A89A 4CR9A 5CMXH 1AWFH 3QZQA 1O2VA 3G01A 1CHOF 2TBSA 1ANBA 1OWKA 2XW9A 1NN6A 2BD5A 2H5CA 4CH8B 4GLYA 1O2KA 3PMAB 1GCDA 3RU4D 1MTNB 3M3VA 6LPRA 1Z1JA 2R9PA 2QAAA 3UY9A 3ZZAA 2V35A 5ESBA 1QTFA 1BTPA 2Z3DA 1GCTB 2Z9KA 1O34A 5FPTA 2GMTB 1QQ4A 1VGCC 1AQ7A 2NWNA 1EAWA 3SNCA 4AB8A 1O5CB 5PTPA 3STIA 2IJOB 1ACBE 8LPRA 2FYRA 1SL3A 2P3FH 1S84A 2STBE 4ZKOU 1YBWA 3QTVH 1Z8IB 3U9AH 4CBNA 5T6DA 1Z6EA 1YC0A 3MFJA 3CP7A 2O8TA 1GI3A 2XBXA 1GBAA 2ZQ2A 1AVXA 1HAVB 1JBUH 2ZHWH 1O5GH 1TNKA 3A83A 3A7YA 3S7KB 1ELDE 4Y6DA 2ALPA 1C2IA 1CBWB 1TMUH 5B6OA 1DITH 3C1KA 5FAHA 4UDWH 2ZGBH 1LO6A 1YPLH 2BYAX 3QK1A 1IHTH 5DP9A 1ELBA 3UWIA 1JRTA 2ZDMA 2F9BH 1BRBE 3VB3A 4R0IA 1C2JA 2QYIA 3T28A 1ABJH 2WPMS 3OY5U 3GY7A 3ZZ3A 2P3UB 1DICA 1A5GH 4KGAA 3PTNA 2BD9A 2UUYA 3H5CB 1P2IA 1GI6A 1NROH 2VWOA 2G00A 1LPGB 1BBRK 2VU8E 2ZU4A 2BOKA 2PV9B 5AVDA 1NO9H 1D4PB 4ZROA 1A5HA 2ZO3H 1J16A 1ZJKA 4WJG2 2ODQA 2VGCB 1IHSH 1S83A 1G2LA 1NTPA 3A8DA 2GZ7A 2CGAA 4BTIB 3SUEA 3VGCC 1GBFA 1BMMH 4B1TA 2AFQB 4GHTA 3VXFH 2RDLA 1C2LA 5BRRE 3VB7A 3PWCA 3LPRA 2UWLA 2ZKSA 4A92A 3D49H 4RKJB 4U01A 2A32A 4TPYA 3URDA 4BXSA 3F9EA 3OSYA 1QBOA 5ETXA 1V2JT 1TAWA 1BMLA 2J2UA 4GCHG 3AW1A 2AMQA 1FY5A 1Z71A 4UD9H 3U8RH 1S85A 4E06H 1ARBA 3PMBB 2G5VA 2XNIA 1Q2WA 1T8NA 1HJ9A 1N8OB 1GHBG 1V2WT 2XXLA 1GBTA 1A0HB 1GJDB 4WY3A 2UUKB 2OCVB 3OU0A 3K6YA 2XC0A 4UFFH 5JB9S 1O38A 3SJOA 1EPTC 2Q1JA 2AERH 1SFIA 1UTOA 1UTMA 1KXCA 2AGGX 4OS5A 2BB4A 1EZQA 1B5GH 2WPLS 2TRMA 3ZZ9A 2ANMH 5A8XA 1WQVH 3TK9A 3SV9A 1BRUP 1SPJA 3QWCH 1RFNA 1GMCF 3E90B 3MMGA 4KTSA 4O03A 3CS0A 3KL6A 2Y80A 5LGOA 4Y7AA 1V2OT 2GCHG 4O3TA 2BHGA 3AAUA 5EXNA 2BX4A 4AFZA 1AGJA 1TABE 4XBBA 4I8JA 2ZFTA 3U8TH 2Z3EA 3A7TA 5C67A 1UTQA 1L1GA 1W14U 2ZC9H 2PTCE 1TNLA 4K69A 1P3CA 4MTBA 1GI1A 4WXVA 1PJPA 3QO6A 1NY22 1C2EA 4AYYB 1SGCA 1F5LA 3BTWE 3HKIB 1MBQA 1DE7H 1KTSB 1GMDG 2AMDA 2HNTE 2ZCHP 2UUJB 3T62A 2GT8A 4K60A 2FX4A 1FI8A 3GICB 5DO4H 4CHAB 3GCOA 1WU1A 1K28D 3I78A 3NWUA 5IDKA 3ELAH 1BUIA 1NZQH 1EAUA 4NA8A 5I46H 2Y5GA 2NU4E 3P17H 3RXBA 1GBLA 1K1PA 1GI4A 1A7SA 2FS9A 3EA7A 1RS0A 2WPHS 5E0GA 1NRPH 2OQUA 3Q3YA 2FM2A 3HK3B 3U1IB 1AZ8A 5K0HA 2BD8A 2BZ6H 1VITG 2F3CE 5GXPA 1OWEA 3CS7A 1CHGA 1DVAH 1GG6B 1SLVB 3ZVCA 3A82A 4ZAEA 4D9RA 1GDUA 2BMGB 4H6TA 4YLUA 2KAIA 3SW2B 1SR5C 3KIDU 1HPGA 2CHAC 2KAIB 1TGCA 2ZEBA 3JZ1B 1JMOH 1Y3WA 1RRKA 2ZDKA 3KCGH 2PSYA 1CE5A 3PV4A 4JZEH 1GL0E 1ZLRA 2VIWA 2C8WB 3RU4T 3TVJB 4I8KA 3SU0A 3E8LA 5F8XA 1MCTA 1TBRH 3PO1C 4FVBA 1DUAA 4DGJA 4I7YH 1SSXA 2XBWA 1QBVH 1RIWC 2A7JA 1DPOA 2A2XH 1DOJA 3GDSA 1C1SA 1ETSH 1TRYA 1ZMNA 1TBZH 1NU7B 1SQTA 2QXHA 3KHVA 1K1MA 1O2LA 4J1YA 4UFEH 2WUCA 4NFEA 2ZDNA 1KXDA 2GV6A 1VJ9U 4I8HA 3SGAE 1FY1A 4X0WU 1C5TA 1O3PB 3RU4E 1MTVA 3LKWA 2ZGXH 4MG3A 4ABDA 1GVLA 2FYQA 1A61H 5L30H 2ZNKH 4FUGA 1TA6A 3D65E 3O8DA 4Y76A 2F9UA 4YT6H 2PTNA 1GJ9B 5EQRA 1P10A 1ZRBA 3MWIU 1OWIA 1HCGA 3EQ0H 4NA7A 1FJSA 1WBGB 1T4VH 1WCZA 2ZECA 4FU9A 1GHXH 3HGNA 2THFB 2RA3A 2VWNA 1KXBA 5SGAE 5E8EH 5GJ4B 3RXDA 2GCTC 3SUFA 1AO5A 3A84A 2ZF0H 1B0EA 2P93A 1C1MA 4LXBH 4JZ1A 2VNTA 1SHYA 1Y5AT 3LT3A 4Y8ZA 3UFAA 3VEQB 1DLEA 1O3EA 4ZXXH 4JMYA 2VIDA 2I6SA 1EATA 1UTKA 3S9AA 1HAOH 2FI3E 4NFFA 3O8CA 1KXFA 3ATMA 3SI4H 1EAIA 1ZMJA 1INCA 4X2WA 2PLXA 3M7QA 2BQWB 1VCPA 2FI4E 1V2KT 4X6NA 1NT1A 1VGCB 4TY7A 4X1NU 1KYNA 1MTUA 5FCKA 2QA9E 1P03A 5DPAA 3UOUA 5C3NA 2ZHDA 4XBCA 5L6NH 4UEHH 3T5FH 1C2HA 1YCPH 3UR9A 2P16A 4XSKU 1DS2E 2FOCA 1C2MA 1T8LA 1NPMA 2FWWA 2ZTXA 3BN9A 3VFEA 3MH6A 1SLUB 2ZHEH 2STAE 2G55A 3GDUA 1H9IE 2CV3A 2AS9A 2QF0A 5DP8A 1FPHH 1H8DH 3TNSA 1P12E 4IMQA 2FLRH 3K6ZA 1QGFA 1EASA 3UNSA 1YPJH 4AGKA 1FV9A 3E16B 3BIUH 1MCVA 4ISHH 2Z9IA 2BM2A 2R0KA 3NK8A 1ETRH 4MVNA 4F49A 2G51A 4MNVA 6ESTA 2SGQE 2ANKH 4KP0A 1G2MA 1W12U 3A7WA 2O9QA 2WV5A 3LGUA 1W11U 5FPYA 3UNQA 1EKBB 1AVWA 3ZZ4A 5C1UA 1N6YA 1P9SA 2FS8A 5DJ7A 4YLQH 4VGCC 4ESTE 1C1UH 1GMCG 3BTQE 1EZSC 1Y3XA 1KXEA 1G30B 4X6MA 1SLWB 4ABAA 2GDEH 1O5BB 4I32A 4A1XA 1G3DA 1YPHC 1A46H 1MKXK 1C9TA 3F68H 3TJUA 2VIVA 2BQ7B 1EZXC 4X6OA 2XC5A 1BOQA 2PW8H 1A0JA 3TGIE 3FZDA 1KIGH 1P02A 3LIWA 1WAYB 5LPRA 1WV7H 4OS7A 4WMEA 2FOHA 3VGCB 5F6MA 2GX4A 1FZZA 3U98H 1EJAA 1RTLA 1UVTH 2GTBA 4AG2A 5TJXA 3ZVBA 5HYOA 1C5UA 1Z8RA 4U32A 3SO3A 2BVRH 1AHTH 3L6PA 3TK6A 3GY6A 4IN1A 5HGGA 2VIQA 1OP8A 5GIBA 4ZUHA 2QV1A 2VIPA 1Y3YA 1OX1A 1EQ9A 2GGVB 3R0FA 1J15A 3ATIA 1QB1A 2NU2E 4I33A 3UNRA 1A5IA 4ABHA 1O3IA 3LOXA 3PMJA 3RM0H 1KXAA 1QJ6B 2DE8A 4JYTA 1C2DA 3P92A
chains in the Genus database with same CATH superfamily
1PPGE 1EPTA 2BDCA 2W3IA 2O8WA 3DCLA 1GMDF 1LHCH 3RC4A 4DIIH 1FONA 1KMHB 2AIQA 1FNIA 4Z1MD 4UFGH 1HAPH 1ZMLA 2OC1A 3DFJA 4DT7B 1NFXA 3SJKA 1MKWK 1GBJA 1QB6A 3F2HA 1GBHA 1HAGE 3OY6U 2FOAA 3TU7H 2ZGCA 5JPMH 2QXGA 5J4SA 3FP8E 4GUXA 1Y5UT 3BTKE 1FX0B 3GCTF 1ESTA 2ZIQH 2A7HA 1OXGA 4J2YB 2V3OH 2Z7FE 4MNXA 3BTEE 5FBIA 1SGYE 1TNJA 5FHTA 3RXVA 1SHHB 1LVYA 2D1JA 1O2TA 2WYGA 1KSNA 1EOLA 4INLA 1FY8E 2VBCA 1GI0A 2QF3A 4BAMB 3P95A 2SNVA 3B9FH 1ZSLA 4AX9H 2OTVA 3BEUA 3RUOA 3ZVGA 2HNTF 4Y11E 3ZZ5A 3KNXA 1PPBH 1O3BA 1LQDB 2D26C 3BG8A 1TE0A 1TONA 3RXGA 4ZKSU 2H5DA 2HVYB 4YTAA 2TGTA 1QR3E 4NIYA 2A4GA 1SMFE 2QF5A 3MNXA 1EP5A 1IQNA 2OC7A 1MD7A 1LKBA 1PPFE 1TYNA 4ABEA 1BTZA 1EOJA 3MU0A 3NPSA 1DWDH 3A7VA 1YCPM 1FUJA 4CRBA 2BTCE 3UOPA 4X2VA 3ATLA 1C4V2 1CA8B 1D3TB 1RTKA 1O0DH 2FLBH 4LZ4B 2WPDD 1CA0C 1BA8B 4HI3A 4JK5A 1TLDA 2BLQA 2CHAB 1P2NA 2XCFA 3B8JA 3LGVA 1C2GA 1HIAA 3ZIAD 5A8ZA 4ISIH 1TA2A 3QDZB 2ALVA 1HIAB 4Y0ZE 3M3TA 2W7UA 4ZHMU 3SU1A 1HFDA 5T3HA 1CSOE 2QCYA 5FPSA 1P2OA 2P3TB 2ZFQH 1ZSJA 1AUJA 3PO1B 4THNH 3EE0B 1LHDH 2Q6FA 5EG4A 1F0TA 2FEQH 1RIWB 1VCWA 5C1YA 1SQRA 3UAIC 3MHWU 2BD4A 1OWHA 4Z6AH 2NU0E 2BY8X 1SOTA 2BDBA 3RXSA 3LJJA 4GSOA 1TOCB 1M9UA 2PP6A 3O8RA 1C5SA 2QE7D 2DE9A 1O5EH 1QBNA 4K1TA 5EW1H 1K9OE 4JYUH 1K0HA 3HGPA 1QNJA 1SGQE 1JIRA 1DUEA 1TRMA 2AGEX 3Q76A 2CK3D 1BTYA 1C1TA 4Q4LA 1MH0A 5EU8A 5G4BA 1IAUA 1S0RA 3V0XA 3A80A 4AC9A 1BMNH 1BT7A 5C2ZA 1L4DA 1Y5BT 5C5NA 4NIXA 2SGEE 1W7XH 2CJIA 1TFXA 1YLCA 2A1DB 3L3TA 1LTOA 1L1NA 2JKHA 1HRTH 3SNEA 3A8AA 3TIUA 4BAHB 3BG4C 1KY9A 2ZPQA 4HFPB 4RT1A 4Y79A 2HPQH 1O33A 3MOCA 3M5OA 3V13A 2P94A 2F9VA 1TNIA 2VWLA 2OLGA 2VJ1A 4FUHA 2GCTB 1AU8A 3SV8A 2XWAA 4K8BA 1O2MA 1V2QT 1TQ7B 4OS2A 1S5SA 4PROA 1FY4A 1GBCA 1TGBA 4R8TB 1O3AA 2R0LA 4ZKNU 3S7HB 5AHGH 3OAAD 5DP6A 1ETTH 1LVOA 3LU9B 2GP9B 3ZVEA 5A0CA 1QCPA 1O2NA 2SGDE 2VVUA 1S6FA 4WH6A 5FBEA 1C1VH 4FOUC 4FU7A 1LHEH 1O5FH 4FUJA 1NBME 1OHHD 3F2FA 1C1NA 1AFEH 1GBBA 1SGNE 4DT4A 3RXRA 1DXPA 1V2MT 1YGCH 4ISNA 1IQMA 1O3DA 8ESTE 3SI3H 4X1QU 1ZPBA 1NRQH 1XUKA 2PWXA 2TPIZ 3PROA 5JBCS 3EA8A 2BY7X 4FUBA 3BTME 4A1VA 3PYHA 3UR6A 3ZZ7A 3TK5A 4AFUA 2Z94A 2LELA 3UUZA 4RI0A 1QB9A 1S0QA 1SGFG 1COWD 3GY4A 2XBYA 3RXPA 1V6DA 3E0PB 3RXJA 1DT2A 1Q3XA 3GOVB 1GPZA 1TPPA 1D3PB 1AD8H 1P05A 5FX6A 2Y6TA 1V2PT 4AYVB 1ELCA 4NIWA 1HAXB 2BXTH 1ANCA 1HJAC 4CREA 1Z7KA 1BJVA 4B74A 1JWTA 1GJAB 1WUNH 2FPZA 5JYIA 5K7RA 3SHCH 2JETC 4SGAE 1BJUA 1G36A 1BTUA 1ID5H 2J38A 4DJZB 4WF8A 1G3BA 2BXUH 1MUEB 3SU2A 1O2ZA 3R3GB 1LMWB 1K1NA 4NWKA 4VGCB 2C93B 1O2GH 3LONA 1TWXB 4AG1A 5A09A 4CR5A 2QIQA 2F9OA 3SQHE 1RJXB 5HIZA 3W94A 5FX5A 2SFAA 3GCTG 3ATKA 1GWAA 2DUCA 1O31A 1DWEH 1BTHH 4X8UH 3PB1E 3RMLH 1O3OA 3P6ZB 1LPZB 2H2ZA 2XRCA 3DSOA 3P8NA 4O97A 4YOJA 2XWBI 1SQOA 3SV6A 1O3NA 1QJ7B 2BD2A 1K21H 3V12A 1GI7B 1NRRH 2A4QA 2D8WA 1VKYA 1AE8H 4SGBE 1PPEE 5EGMA 2G5NA 2WPIS 4MPUA 3SOSA 1NFYA 1O3CA 4BAKB 3MI4A 4RT0A 2OBQA 3BTGE 3T26A 1YLNA 1C5XB 1W7GH 3DT0H 1UCYH 3ZZBA 2Z3CA 3SJ9A 1G3EA 1HLTH 4X1PU 1K1LA 3STJA 1C5VA 2CN0H 3L33A 1ESBA 4GVUA 1QJ1B 4XFQA 1H8HD 3NXPA 1QL8A 1VR1H 1AWHB 2KCPA 2ODYB 4B71A 2B0FA 5HM9A 1MTWA 1AB9C 1J9CH 1P2QA 3RXHA 5JBTA 5C1XA 1GJ6A 1GI5A 1SGRE 2A5IA 4BAOB 5LPFA 1FIWA 2G4TA 3LC5A 1HV7A 1ZHRA 2V3MA 1V2TT 2UUFB 1Z8JB 1EX3A 2Y82A 1GBIA 5EPNA 3N7OA 3N99A 1CGJE 1AUTC 1TMTH 2ZP0H 3SQEE 9LPRA 4K3JA 5KECA 1IQFA 1DDJA 1O32A 2RFKC 2QY0B 3BSQA 5E2PA 2RA0A 3NUMA 1PQ7A 3BTDE 4YESB 2R2MB 1P0SH 3M7UA 1SGTA 3KYGA 3UQVA 2G52A 1JIMA 4FUFA 2Y5FA 3ZZDA 1XKBC 2KFWA 3I29A 2ZGJA 2BDAA 1G9IE 1BBRE 2ESTE 1EAXA 1P2JA 1BTXA 1XUJA 1QZ8A 4LZ1H 2XCNA 1CT0E 2F9PA 1C5OH 3HKJB 5EJZA 1YY3A 1CU1A 2OC0A 4FVDA 3ZVFA 1KLIH 3PMHB 2VGCC 2J4IA 1ZHPA 1FY3A 1C5RA 1T4UH 4NWLA 3FP7E 1H8ED 4IC5A 4UONA 1S81A 1HB0B 2J92A 8KME2 3RLYH 2ZZUH 5L2YH 1LHGH 1NM6A 1ZZZA 2GT7A 4ABIA 2BDYA 1XXDA 1MQ5A 3UTUH 2G81E 4A1TA 4H6SB 3RXLA 3M61U 1S6HA 3QGNB 3P70B 2GKVE 5GPIB 1FLEE 2FOEA 4TWYA 4H4FA 3KQEA 3ZYEA 1O2UA 4OGXA 4RSPA 2EI7A 2WINI 1P3EA 1E1RD 3A7ZA 2B9LA 1NRSH 1YM0A 1XVMA 1GMHF 1O2OA 4K1SA 1WTHD 1FAXA 4Q80A 1YP9A 1AY6H 1F0RA 2AGIX 4XOJA 1TQ0B 2Y5HA 3D23A 4HGCA 4DG4A 4OS1A 1OOKB 3UQOA 3BTFE 1O3LA 3RXUA 2RG3A 1TX7A 2SGFE 2ZWLH 1WTGH 1G32B 1CGIE 1E35B 3A8BA 1PQAA 2YNAA 5T1VA 1XUGA 4YZUA 3AASA 2FOFA 1TB6H 1TX8A 2G4UA 3MYWA 2EI6A 2HALA 1CA0B 1P2MA 4X1RU 4I8LA 1T31A 1BB0B 3AAVA 1A2CH 4X2YA 2BDGA 1PPZA 3OYPA 5E0HA 4CRAA 4INKA 2J5UA 1QRWA 4GPGA 2ZPRA 3RXOA 1XVOA 5DSFA 3ATWA 4MNWA 3SGBE 3M37A 3MQKC 3TNTA 2B7DH 1WSSH 1UO6A 1V2LT 1DLKB 1O3FA 1SB1H 3ZZ8A 4BOHA 3SUGA 1THRH 3KF2A 3ODFA 1ZPZA 1DWBH 4BTTB 8GCHF 1ORFA 1UTJA 2A0QB 3RC5A 4F4OC 1DFPA 2R3YA 1MZAA 1V2ST 2H6MA 2A4OA 3ZV9A 4FUCA 4F55A 4NGAH 1DXWA 1P04A 3UIRA 1XUIA 2H9HA 4FU8A 4A5TS 1Z1IA 1BHXB 5DP3A 4YOGA 2TGAA 4AZ2B 1XUFA 4Y71A 4NA9H 3FAOA 1C1RA 3E1XB 3RC6A 1TMBH 2QN5T 3SNDA 2W26A 2P95A 1PYTD 1C5YB 5C0UA 1TPOA 1WQSA 2EA3A 5I25A 1C5WB 1LPKB 3KQDA 1MZDA 3QX5H 1AE5A 2Y7XA 4OS4A 3RXEA 5EODA 3EDXB 1YCPK 3M5MA 1Y3VA 4IW4E 1KTTB 1UVUH 4NSYA 3S9BA 2BD3A 1AI8H 3PWBA 5CHAC 2FX6A 4I8GA 4IN2A 3RXKA 4Y8XA 3QUMP 1K1OA 1E34B 2KZ4A 3LH1A 1ELTA 3QN7A 2IPHA 1ANDA 2A7CA 2BOHB 4K5ZA 1LCYA 1WDIA 1UJ1A 4IC6A 1BQYA 1K2I1 3BG4B 1CGHA 1J14A 2UWOA 1C1WH 1MAXA 1ZSKA 1ZGIA 1J17T 2XTTB 1SLXB 2V0BA 1QL9A 1B7XB 1NS3A 1D6RA 1LHFH 4FUIA 1JXPA 1AFQC 1O2YA 3GCHC 3IG6B 3BV9B 3KN2A 3VG8A 2ZI2H 3E0NB 5T6FA 2ZFSA 4QT8C 1GJ4H 1HGTH 4A7IB 3BTTE 1YKTA 2F43B 1F5RA 3FZZA 4JCNA 1DANH 3MU5A 2A4RA 1PYTC 4A6LA 3SU4A 3PTBA 3GY8A 1V3XA 5EIYA 1EPTB 1QIXB 5EJ1A 2VH6A 5DGJA 9ESTA 1ZGVA 5HM2A 3FP6E 1LVBA 3UPEA 2CXVA 1EB2A 2P8OC 3OE7D 5GDSH 3U69H 3MNBA 2XNDD 2A31A 3PRDA 1QRXA 3ZZCA 1GBDA 1NRNH 3P8GA 2C8XB 1LQEA 1ELEE 1NFWA 3OTJE 1MQ6A 3Q00A 2D2DA 1C5ZB 1F0SA 3SNAA 3WY8A 2P59A 1O2WA 4MPVA 1CT4E 4X8VH 1A3BH 1O5AB 1ESAA 1UCYE 1QFKH 3GY5A 4INHA 1D3QB 1H9HE 4Z0KA 1O30A 3OX7U 4NG9H 4DCDA 1BIOA 1FQ3A 4DY7B 1IOEA 3GISB 4KTUA 2R3UA 3FKSD 1LVMA 1TNGA 2XC4A 3C27B 4Y0YE 4XE4A 2TGPZ 1AMHA 3RMNH 3ESTA 1O2RA 5ESTE 1HYLA 1HJAB 2PR3A 1Q31A 5AFYH 4NSVA 2H9EH 3M5NA 2JETB 3S69A 5J4QA 1SGPE 1O2SA 3SNBA 3P8FA 3SN8A 1RGQA 3V7TA 2JH0D 3GY2A 4DURA 3S0NA 3TGJE 4UFDH 3V3MA 4X8SH 1MABB 3E6PH 4TWWA 1AKSA 1A0LA 1AN1E 1W10U 3JZ2B 1LKAA 2JDID 4X8TH 1EP6A 4AOQA 2FTMA 2K1QA 3AW0A 1ELVA 2FP7B 3NKKA 1H1BA 2ZDVH 5T6GA 2SGPE 1GBKA 2GD4B 2QGRA 1ZOMA 5A8YA 4UE7H 5GCHF 3LGTA 2VIOA 2M5TA 1O3MA 2ZG0H 1BBRH 1DM4B 1DWCH 4WMFA 5BPEA 3E3TA 1L1JA 4B75A 1CQQA 2ASUB 3RXAA 1MBMA 1TRNA 3TPIZ 1GJ5H 2BLOA 5C17A 4ISOA 3SV2H 2VINA 1UMAH 2LP6A 2NU1E 3EA9A 3RLWH 4ASHA 3TJNA 3PRBA 1HAVA 5A2MH 1O39A 4B73A 1H9LB 4XBDA 1GMHG 1SG8B 4D9QA 2PUXB 2CF9H 4FETA 3MH5A 2LNCA 2IOTA 3RP2A 1AB9B 1TNHA 4YO9A 1ELAA 1SBWA 2KX4A 2ZQ1A 4MQAA 1GI2A 3FO8D 4MLFB 1GHZA 3VXEH 1UTNA 1PQ5A 4E7NA 2BY9X 1UTPA 5DKMA 1BCUH 2QC2A 1GBEA 4ZH8A 1D9IA 1OYQA 2BY6X 1GBMA 3MNCA 2EI8A 3B23B 1TPAE 5F8ZA 4BAQB 2C90B 1P9UA 1C1QA 3SGQE 3U1JB 1IQJA 2F4LA 3KGPA 5H4IB 2GDDA 3VPKA 5HXFA 1RXPA 1BZXE 1UVOA 1BRCE 3NCLA 2ANYA 3RXQA 5FXLA 1BHXF 1QY6A 1PFXC 2IPQX 4ZMAH 4U2WA 1KLJH 1T8OA 1HDTH 3MU8A 2A5AA 4U30A 2R2WU 3SU6A 3DA9B 2GZ8A 1FDPA 1YPHE 5DP5A 1C4U2 2V6NA 1F5KU 2BZAA 4XD7D 3PLKA 1C5LH 1P09A 3F6UH 4IGDA 2ZFFH 2CF8H 8GCHG 1UK3A 4CRGA 4LOYH 4I31A 3EAJA 1CO7E 1ZTKA 4TY6A 1C5MD 2ODPA 4HZHA 5A0AE 1GGDC 3FVFB 1A1RA 1TGSZ 1YF4A 2ZDLA 1GI8B 3LDXH 1WXRA 2J94A 5EQQA 1DY8A 2ZA5A 2W3KA 1ANEA 1GHAF 1S82A 2OXSA 2Z6BD 2PKSC 3ODDA 2TIOA 1F2SE 4ABBA 1ARCA 2HVXA 1GHWH 1GJ8B 1XMNB 2PHBA 3MU4A 5JBBS 1Y8TA 1DSUA 3T27A 1HAHH 1IQGA 1L0ZA 3OTPA 1W3CA 3BTHE 1Z8GA 3O8BA 2Z9JA 1AVGH 2Z9LA 5JBAS 2BLVA 1MMJN 2ZFRH 1N1LA 4KTCA 2ILNA 1W2KH 4LK4A 1SOZA 3DD2H 4AGJA 4ABJA 2AMPA 4DIHH 2PSXA 4AORA 1K1JA 1H8IH 2WUBA 3SBKA 1MU8B 5FL7D 1IQEA 1SVPA 2KCOA 2PGQB 1EZUC 3TJOA 1G3CA 2J95A 2BVXH 4BNRA 2ZGHA 4FXGH 1KLTA 3OEED 1JRSA 2WHXA 1D3DB 4GAWA 4AFQA 2ZU3A 1GJ7B 1FIZA 5IK2D 2ZPSA 3F1SB 1ZR0A 2XBVA 2KM0A 3FFGA 3IITA 2Q6GA 3H7OA 1E36B 1DX5M 1YYY1 4TPIZ 1EJNA 5JDUB 1E1QD 1ZPCA 6CHAC 2K0QA 1EXFA 4RKOB 1C5PA 5L2ZH 1UVSH 3A88A 1OP0A 1C1PA 1P2KA 4JZIA 1GL1A 1TPSA 3K65B 2B8OH 4KKDA 1UVPA 3RMMH 2JH6D 1L2EA 1OYTH 1ZJDA 3LGWA 3MO3A 4AN7A 1D6WA 5EPYA 4WVPE 3NZIA 1NC6A 3U28C 1CT2E 1THSH 2VWMA 5A0BA 2FZZA 1QL7A 1GJBB 4YT7H 7LPRA 2QF4A 2C8ZB 3EE7A 2OUAA 3SORA 3MO9A 1HAIH 1C4Y2 4D76A 2OINA 2FO9A 3RMOH 1QHRB 1MTNC 1OWJA 2BY5X 3HK6B 2O8MA 2OC8A 1W0JD 3MU1A 1SFQB 1J8AA 3P8OA 4CRFA 1GCTC 2GMTC 1FXYA 4D7FA 1VZQH 3GDVA 2BX3A 2Y7ZA 5CHAB 4NCYA 4IBLH 4D7GA 1Z6JH 2WZQA 2RDEA 3TLOA 5EJLA 1T8MA 1C1OA 2JH5D 1KDQA 1OPHB 4MPXA 7GCHF 3M5LA 2YOLA 5EW2H 1KDQB 2L6OA 2FESH 1IQLA 1BMFD 2QXIA 2OD3B 6GCHF 1O3KA 5F03A 1L4ZA 3LGYA 1SGFA 3PM3A 4Q7YA 3N7EA 4NZQA 2W7SA 2AH4X 2EEKA 3VB4A 1AFQB 3GCHB 7KMEH 4DVAU 3K2UA 1A3EH 2W6JD 1CBWC 2XOKD 4B76A 4K8YA 1UHBA 1CHOG 1GHVH 1T32A 2Y81A 3VB6A 2FOMB 1AZZA 1UHBB 1DSTA 2J9NA 1OS8A 3WW7A 2HGTH 4ZHAA 5GCHG 3TJVA 1MD8A 2FDAA 3RXFA 5EQSA 3DFLA 3SU5A 1C2FA 3T2NA 2IN2A 2HOBA 4I86A 1P8VC 1BDAA 1TGTA 5LPEA 2P8OB 1O2PA 3M35A 4NZLA 2GZ9A 2BDHA 4JZFH 4MDSA 1ZTJA 1FMGA 1WYKA 4MPWA 5EOKA 2A2QH 4K2YA 4M7GA 5DK1A 3RM2H 2YNBA 3A7XA 1HBTH 3H7TA 5AFZH 1T7CA 3Q3KA 4O9VA 4D8NA 1AIXH 2LPRA 1UCYK 4CRDA 2A45B 2VVVA 1SQAA 2FTLE 1GDQA 3URCA 3M7TA 2BLWA 5FCRA 3F9FA 1CVWH 1O5DH 3LJOA 3MO6A 3PV2A 4BXWA 1GDNA 2XYAA 3PLBA 1QRZA 2HWLB 5TCAA 4B2BA 3A87A 1W0ZU 2G8TA 3SJIA 3D62A 1H4WA 4Y8YA 4CBOA 2PUQH 5HMAA 3DUXH 1V2RT 5C94A 2BD7A 3LH3A 4Y10E 3KEEA 1FN8A 1F92A 1P57B 3ENSB 1SGIB 3CENA 2NU3E 3SUDA 3W95A 4ZXYH 1TX6A 4E05H 1ELFA 4WXIA 3Q77A 1TGNA 3TH2H 2ZFPH 1N8OC 4OM9A 2BVSH 2AYWA 1LDTT 1A4WH 1EUFA 1O37A 1SKYE 2C4FH 2UWPA 5DG6A 2I6QA 1ZRKA 4XDEA 2FOGA 2KCYA 4TT3D 5AF9H 3A86A 3T25A 1HXEH 3TH3H 1O2HA 4BANB 1G37A 2O8UA 2PKAA 2PGBB 2ZU1A 3ZVAA 1IQIA 2PKAB 1NESE 1BITA 3CNRA 1PPCE 1MTSA 2C3SA 4ZHLU 1JOUB 4P00A 2AEIH 1RTFB 3KQCA 1C2KA 1YPMH 1MKXH 2FI5E 1O2IA 2ZTZA 1C9PA 1GHYH 3MTYA 2VB0A 1HUTH 2WPKS 1W0YH 2TGDA 3HPTB 2HRVA 1O3GA 1SGDE 2QXJA 2YMSD 1F0UA 2O8LA 3I77A 3KQBA 4WWYA 3QTOH 2GV7A 1TOMH 1XM1A 1BTWA 4Y7BA 4ZKRU 4ISLA 1GHAG 1P01A 1GI9B 2OBOA 2BDIA 2ZHFH 4GHQA 3ZZ6A 5GWZA 2WV9A 3HATH 2J34A 1U6QA 1SI5H 2ZCLP 1P11E 1PQ8A 2Z9GA 3MH7A 4F48B 3Q3XA 4JK6A 4YOIA 1ZYOA 2F83A 2WYJA 1OWDA 1VJAU 3ZV8A 3BEFB 1ZHMA 1E0FD 2HPPH 1C5QA 5ABWA 1UTLM 1V2NT 2F91A 1FAKH 2FXRA 2Q6DA 1PPHE 3SJ8A 4DOQA 2FIRH 3QGJA 3SZNA 1IQKA 2AIPA 1HXFH 1N6XA 1TBQH 5TCCA 2ZU2A 4CRCA 1O2JA 1W8BH 4ASUD 5E2OA 1P06A 2BQ6B 3FANA 3M36A 2B5TB 3UWJH 4GCHF 4CHAC 1XXFA 1THPB 5DP7A 5C20A 4FUDA 1XKAC 3GYLB 1YPKH 2ZCKP 1UK4A 4NIVA 3GY3A 2FODA 3K9XB 2YMSC 1UK2A 1GHBF 3GCNA 4IS5A 4K1EA 1HJ8A 1YPEH 2FOBA 5EXMA 1MKWH 1FPCH 1O2XA 1ZTLA 4XRNA 2ZHQH 4MNYA 3QLPH 3AVZA 1S6LA 5KEDA 1QQUA 3RXCA 1RD3B 3SV7A 3BIVH 4X1SU 1EJMA 2SGAA 1SGEE 3IWMA 1XX9A 1YPGH 1GG6C 1MAYA 2OQ5A 2GVFA 3MH4A 2VVCA 3ZYDA 2WV4A 3EYDA 1ABIH 1V2UT 1TALA 3ITIA 4YM9A 4TYDA 4ZCNA 3LGIA 1GVKB 3E91A 4JYVH 1SC8U 1ELGA 1GGDB 1O35A 2GCHF 3BEIB 4ACBA 1HAZB 3PLPA 1X7AC 2V3HH 1VCQA 2PKSB 1IQHA 1Y3UA 2OP9A 3LC3A 1VITH 1EFRD 2W5EA 2HLCA 3UREA 4DW2U 5LH8A 1OSSA 3A85A 2F9NA 1NU9A 5IYTA 2A5KA 1QA0A 2ULLA 3A8CA 2FMJA 1E38B 4B6EA 2CMYA 1O2QA 3SHAH 5JB8S 4FUEA 1C5NH 4RN6A 2PFEA 1O3JA 4BTUB 3T29A 3ZVDA 1O3HA 4O3UA 4Q2KA 4E7RG 5CE1A 5DP4A 3RXIA 7GCHG 1TIOA 4JZDH 4WH8A 2ZDAH 1Y59T 4OGYA 3TGKE 1FN6A 3SU3A 1GJCB 2EC9H 3MNSA 4AFSA 6GCHG 4H42U 1BMAA 4X2XA 2WPJS 3GYMA 1NFUA 1O36A 1XUHA 4OS6A 1YWUA 3F9GA 1QA7A 2ZU5A 3A81A 3BF6H 3F9HA 3QZRA 1K1IA 4WMDA 3TH4H 1BRAA 4ABGA 1DY9A 1MU6B 3TITA 3M3SA 2VH0A 3S9CA 5E0JA 1YLDA 3RDZA 4B2AA 1HAYB 4B2CA 1HNEE 1QURH 1OP2A 4HTCH 1WOFA 2SNWA 1W13U 1E37B 2C8YB 2H9TH 2HNTC 6CHAB 5F8TA 4IMZA 3VB5A 2KR7A 1V2VT 1K22H 5EXLA 1B0FA 4AB9A 3EGKH 3RXTA 1OKXA 3RXMA 4ABFA 1GVZA 4Q7ZA 5CDFE 1VITF 2ANWA 2H1UA 3U8OH 4CH2B 1EB1H 1F7ZA 3DSGA 4KELA 2RCEA 4Q7XA 2ZTYA 3DHKH 5C5OA 7ESTE 4X6PA 1AKSB 3A89A 4CR9A 5CMXH 1AWFH 2GJGA 1O2VA 3QZQA 3G01A 1CHOF 2TBSA 1ANBA 1OWKA 2XW9A 1NN6A 2BD5A 2H5CA 5GNDA 4CH8B 4GLYA 1O2KA 3PMAB 1GCDA 3GS9A 3RU4D 1MTNB 3M3VA 6LPRA 1Z1JA 2R9PA 2QAAA 3UY9A 5C0TA 3ZZAA 2V35A 5ESBA 1QTFA 2EY4C 1BTPA 2Z3DA 1GCTB 2Z9KA 1O34A 5FPTA 2GMTB 1QQ4A 1VGCC 1AQ7A 2NWNA 1EAWA 3SNCA 4AB8A 1O5CB 5PTPA 3STIA 2IJOB 1ACBE 8LPRA 2FYRA 1SL3A 2P3FH 1S84A 2STBE 4ZKOU 2EQNA 3H09A 1YBWA 3QTVH 1Z8IB 3U9AH 4CBNA 4ACAA 5T6DA 1Z6EA 1YC0A 3MFJA 3CP7A 2O8TA 1GI3A 2XBXA 1GBAA 2ZQ2A 1AVXA 1HAVB 1JBUH 2ZHWH 1O5GH 1TNKA 3A83A 3A7YA 3S7KB 1ELDE 4Y6DA 2ALPA 1C2IA 1CBWB 1TMUH 5B6OA 5CHBA 1DITH 3C1KA 5FAHA 4UDWH 2JJ1D 2ZGBH 1LO6A 1YPLH 2BYAX 3QK1A 1IHTH 5DP9A 1ELBA 3UWIA 1JRTA 2ZDMA 2F9BH 3F0PA 1BRBE 3VB3A 4R0IA 3UB0A 1C2JA 2QYIA 3T28A 1ABJH 2WPMS 3OY5U 5F53A 3GY7A 3KYFA 3ZZ3A 2P3UB 1DICA 1A5GH 4KGAA 3PTNA 2BD9A 2UUYA 3H5CB 1P2IA 1GI6A 1NROH 2VWOA 2G00A 1LPGB 1BBRK 2VU8E 2ZU4A 2BOKA 2PV9B 5AVDA 1NO9H 1D4PB 4ZROA 1A5HA 2ZO3H 1J16A 1ZJKA 4WJG2 2ODQA 2VGCB 1IHSH 1S83A 1G2LA 1NTPA 3A8DA 2M2AA 4YXWD 2GZ7A 2CGAA 4BTIB 3SUEA 3VGCC 1GBFA 1BMMH 4B1TA 2AFQB 4GHTA 3VXFH 2RDLA 1C2LA 5BRRE 3VB7A 3PWCA 3LPRA 2UWLA 2ZKSA 4A92A 3D49H 4RKJB 4U01A 2A32A 4TPYA 3URDA 4BXSA 3F9EA 3OSYA 1QBOA 5ETXA 4TSFD 1V2JT 1TAWA 1BMLA 2J2UA 4GCHG 3AW1A 2AMQA 1FY5A 1Z71A 4UD9H 3U8RH 1S85A 4E06H 1ARBA 3PMBB 2G5VA 2XNIA 1Q2WA 2JJ2D 1T8NA 1HJ9A 1N8OB 1GHBG 1V2WT 2XXLA 3W1EA 1GBTA 1A0HB 1GJDB 4WY3A 2UUKB 2OCVB 3OU0A 3FOAA 3K6YA 2XC0A 4UFFH 5JB9S 1O38A 3SJOA 1EPTC 2Q1JA 2AERH 1SFIA 1UTOA 3OFND 1UTMA 1KXCA 2AGGX 4OS5A 2BB4A 1EZQA 1B5GH 2WPLS 2TRMA 3ZZ9A 2ANMH 5A8XA 1WQVH 3TK9A 3SV9A 2KCAA 1BRUP 1SPJA 3QWCH 1RFNA 3OEHD 1GMCF 3E90B 3MMGA 4KTSA 4O03A 3CS0A 3KL6A 2Y80A 5LGOA 4Y7AA 1V2OT 2GCHG 4O3TA 2BHGA 3AAUA 5EXNA 2BX4A 3WWFA 4AFZA 1AGJA 1TABE 4XBBA 4I8JA 2ZFTA 3U8TH 2Z3EA 3A7TA 5C67A 1UTQA 1L1GA 1W14U 2ZC9H 2PTCE 1TNLA 4K69A 1P3CA 4MTBA 1GI1A 4WXVA 1PJPA 3QO6A 1NY22 1C2EA 4AYYB 3FN8A 1SGCA 1F5LA 3BTWE 3HKIB 1MBQA 1DE7H 1KTSB 5DN6D 1GMDG 2AMDA 2J98A 1E79D 2HNTE 2J98B 2ZCHP 2UUJB 3T62A 2WSSD 2GT8A 4K60A 2FX4A 1FI8A 3GICB 5DO4H 4CHAB 2W6ID 3GCOA 1WU1A 1K28D 3I78A 3NWUA 5IDKA 3ELAH 1BUIA 1NZQH 1EAUA 4NA8A 5I46H 2Y5GA 2NU4E 3P17H 5B6LA 3RXBA 2YMSB 1GBLA 1K1PA 1GI4A 1A7SA 2FS9A 3EA7A 1RS0A 2WPHS 5E0GA 1NRPH 2OQUA 3Q3YA 2FM2A 3HK3B 3U1IB 3DSPA 1AZ8A 3F0OA 5K0HA 2BD8A 2BZ6H 1VITG 2F3CE 3NRLA 5GXPA 1OWEA 3CS7A 1CHGA 1DVAH 1GG6B 1SLVB 3ZVCA 3A82A 4ZAEA 4D9RA 1GDUA 2BMGB 4H6TA 4YLUA 2KAIA 3SW2B 2HLDD 1SR5C 3KIDU 1HPGA 2CHAC 2KAIB 1TGCA 2ZEBA 3JZ1B 1JMOH 1Y3WA 1RRKA 2ZDKA 3KCGH 2PSYA 1CE5A 3PV4A 4JZEH 1GL0E 1ZLRA 2VIWA 2C8WB 3RU4T 3TVJB 4I8KA 3SU0A 3E8LA 5F8XA 1MCTA 1TBRH 3PO1C 4FVBA 1DUAA 3SZEA 2K8IA 4DGJA 4I7YH 1SSXA 2XBWA 1QBVH 1RIWC 2A7JA 1DPOA 2A2XH 1DOJA 3GDSA 1C1SA 4HG6A 1ETSH 1TRYA 1ZMNA 1TBZH 1NU7B 1SQTA 2QXHA 3KHVA 1K1MA 1O2LA 3KQ5A 4J1YA 4UFEH 2WUCA 4NFEA 2ZDNA 1KXDA 2GV6A 1VJ9U 3AK5A 4I8HA 3SGAE 1FY1A 4X0WU 1C5TA 1O3PB 3RU4E 1MTVA 3LKWA 2ZGXH 4MG3A 4ABDA 1GVLA 2FYQA 1A61H 5L30H 2ZNKH 4P02A 4FUGA 1TA6A 3D65E 3O8DA 4Y76A 2J97A 2F9UA 4YT6H 2PTNA 1GJ9B 5EQRA 1P10A 1ZRBA 3MWIU 1OWIA 2L74A 1HCGA 3EQ0H 2OK5A 4NA7A 1FJSA 1WBGB 1T4VH 1WCZA 2ZECA 4FU9A 1GHXH 3HGNA 2THFB 2RA3A 3F2GA 2VWNA 1KXBA 5SGAE 5E8EH 5GJ4B 3RXDA 2GCTC 3SUFA 1AO5A 3A84A 2ZF0H 1B0EA 2P93A 1C1MA 4LXBH 2AHME 2VNTA 4JZ1A 1SHYA 1Y5AT 3LT3A 4Y8ZA 3UFAA 3VEQB 1DLEA 1O3EA 4ZXXH 4JMYA 2VIDA 2I6SA 1EATA 1UTKA 3S9AA 4B6FA 1HAOH 2FI3E 4NFFA 3O8CA 2V7QD 1KXFA 3ATMA 3SI4H 1EAIA 1ZMJA 1INCA 4X2WA 2PLXA 3M7QA 2BQWB 1VCPA 2FI4E 1V2KT 4X6NA 1NT1A 1VGCB 4TY7A 4X1NU 1KYNA 1MTUA 5FCKA 2QA9E 1P03A 5DPAA 3UOUA 3F3BA 5C3NA 2ZHDA 4XBCA 5L6NH 4UEHH 3T5FH 1C2HA 1YCPH 3UR9A 2P16A 4XSKU 1DS2E 2FOCA 1C2MA 1T8LA 1NPMA 2FWWA 2ZTXA 3BN9A 3VFEA 3MH6A 1SLUB 2ZHEH 2STAE 3PV5A 2G55A 3GDUA 1H9IE 2CV3A 2AS9A 2QF0A 5DP8A 1FPHH 1H8DH 1W0KD 3TNSA 1P12E 4IMQA 2FLRH 3K6ZA 1QGFA 1EASA 3UNSA 1YPJH 4AGKA 1FV9A 3E16B 3BIUH 1MCVA 4ISHH 2Z9IA 2BM2A 2R0KA 3NK8A 1ETRH 4MVNA 4F49A 2G51A 4MNVA 6ESTA 2SGQE 2ANKH 4KP0A 1G2MA 1W12U 3A7WA 2O9QA 2WV5A 2IJD1 3LGUA 1W11U 5HKKD 5FPYA 3UNQA 1EKBB 1AVWA 3ZZ4A 5C1UA 5KGOA 1N6YA 1P9SA 2FS8A 5DJ7A 4YLQH 3SYJA 1NBMD 4VGCC 4ESTE 1C1UH 1GMCG 3BTQE 1EZSC 1UW7A 1Y3XA 1KXEA 3WWBA 1G30B 4X6MA 1SLWB 4ABAA 2GDEH 1O5BB 4I32A 4A1XA 4Q63A 1G3DA 1YPHC 1A46H 1MKXK 1C9TA 3F68H 3TJUA 2VIVA 2BQ7B 1EZXC 4X6OA 2XC5A 1BOQA 2PW8H 1A0JA 3TGIE 3FZDA 1KIGH 1P02A 3N7DA 3LIWA 1WAYB 5LPRA 1WV7H 4OS7A 4WMEA 2FOHA 3VGCB 5F6MA 2GX4A 1FZZA 3U98H 1EJAA 1RTLA 1UVTH 2GTBA 4AG2A 5TJXA 3ZVBA 5HYOA 1C5UA 1Z8RA 4M9FA 4U32A 3SO3A 2BVRH 1AHTH 3L6PA 3TK6A 3GY6A 4IN1A 5HGGA 2VIQA 5HIYA 1OP8A 5GIBA 4ZUHA 2QV1A 2VIPA 1Y3YA 1OX1A 1EQ9A 2GGVB 3R0FA 1J15A 3ATIA 1QB1A 2NU2E 4I33A 3UNRA 1A5IA 4ABHA 1O3IA 3LOXA 3PMJA 3RM0H 1KXAA 1QJ6B 2DE8A 4JYTA 1C2DA 2JIZD 3P92A
chains in the Genus database with same CATH topology
1PPGE 1EPTA 2BDCA 2W3IA 2O8WA 1GMDF 1LHCH 3RC4A 4DIIH 1FONA 2AIQA 1FNIA 4UFGH 1HAPH 1ZMLA 2OC1A 3DFJA 4DT7B 1NFXA 3SJKA 1MKWK 1GBJA 1QB6A 1GBHA 1HAGE 3OY6U 2FOAA 3TU7H 2ZGCA 5JPMH 2QXGA 5J4SA 3FP8E 4GUXA 1Y5UT 3BTKE 3GCTF 1ESTA 2ZIQH 2A7HA 1OXGA 4J2YB 2V3OH 2Z7FE 4MNXA 3BTEE 5FBIA 1SGYE 1TNJA 5FHTA 3RXVA 1SHHB 1LVYA 2D1JA 1O2TA 2WYGA 1KSNA 1EOLA 4INLA 1FY8E 1GI0A 2QF3A 4BAMB 3P95A 2SNVA 3B9FH 1ZSLA 4AX9H 2OTVA 3BEUA 3RUOA 3ZVGA 2HNTF 4Y11E 3ZZ5A 3KNXA 1PPBH 1O3BA 1LQDB 2D26C 3BG8A 1TE0A 1TONA 3RXGA 4ZKSU 2H5DA 4YTAA 2TGTA 1QR3E 4NIYA 2A4GA 1SMFE 3MNXA 1EP5A 1IQNA 2OC7A 1MD7A 1LKBA 1PPFE 1TYNA 4ABEA 1BTZA 1EOJA 3MU0A 3NPSA 1DWDH 3A7VA 1YCPM 1FUJA 4CRBA 2BTCE 3UOPA 4X2VA 3ATLA 1C4V2 1CA8B 1D3TB 1RTKA 1O0DH 2FLBH 4LZ4B 1CA0C 1BA8B 4HI3A 4JK5A 1TLDA 2BLQA 2CHAB 1P2NA 2XCFA 3B8JA 3LGVA 1C2GA 1HIAA 5A8ZA 4ISIH 1TA2A 3QDZB 2ALVA 1HIAB 4Y0ZE 3M3TA 2W7UA 4ZHMU 3SU1A 1HFDA 5T3HA 1CSOE 2QCYA 5FPSA 1P2OA 2P3TB 2ZFQH 1ZSJA 1AUJA 3PO1B 4THNH 3EE0B 1LHDH 2Q6FA 5EG4A 1F0TA 1RIWB 1VCWA 2FEQH 5C1YA 3MHWU 2BD4A 1OWHA 4Z6AH 2NU0E 2BY8X 1SOTA 2BDBA 3RXSA 3LJJA 4GSOA 1TOCB 1M9UA 3O8RA 1C5SA 2DE9A 1O5EH 1QBNA 4K1TA 5EW1H 1K9OE 4JYUH 3HGPA 1QNJA 1SGQE 1JIRA 1DUEA 1TRMA 2AGEX 3Q76A 1BTYA 1C1TA 1MH0A 5EU8A 5G4BA 1IAUA 1S0RA 3V0XA 3A80A 1BT7A 1BMNH 5C2ZA 1L4DA 1Y5BT 5C5NA 4NIXA 2SGEE 1W7XH 2CJIA 1TFXA 1YLCA 2A1DB 3L3TA 1LTOA 1L1NA 2JKHA 1HRTH 3SNEA 3A8AA 3TIUA 4BAHB 3BG4C 1KY9A 2ZPQA 4HFPB 4Y79A 2HPQH 1O33A 3MOCA 3M5OA 3V13A 2P94A 2F9VA 1TNIA 2VWLA 2OLGA 2VJ1A 4FUHA 2GCTB 1AU8A 3SV8A 2XWAA 4K8BA 1O2MA 1V2QT 1TQ7B 4OS2A 1S5SA 4PROA 1FY4A 1GBCA 1TGBA 4R8TB 1O3AA 2R0LA 4ZKNU 3S7HB 5AHGH 5DP6A 1ETTH 1LVOA 3LU9B 2GP9B 3ZVEA 5A0CA 1QCPA 1O2NA 2SGDE 2VVUA 1S6FA 4WH6A 5FBEA 1C1VH 4FU7A 1LHEH 1O5FH 4FUJA 1C1NA 1AFEH 1GBBA 1SGNE 3RXRA 1DXPA 1V2MT 1YGCH 4ISNA 1IQMA 1O3DA 8ESTE 3SI3H 4X1QU 1ZPBA 1NRQH 1XUKA 2PWXA 2TPIZ 3PROA 5JBCS 3EA8A 2BY7X 4FUBA 3BTME 4A1VA 3PYHA 3UR6A 3ZZ7A 3TK5A 4AFUA 2Z94A 3UUZA 1QB9A 1S0QA 1SGFG 3GY4A 2XBYA 3RXPA 1V6DA 3E0PB 3RXJA 1DT2A 1Q3XA 3GOVB 1GPZA 1TPPA 1D3PB 1AD8H 1P05A 5FX6A 2Y6TA 1V2PT 4AYVB 1ELCA 4NIWA 1HAXB 2BXTH 1ANCA 1HJAC 4CREA 1Z7KA 1BJVA 4B74A 1JWTA 1GJAB 1WUNH 2FPZA 5JYIA 5K7RA 3SHCH 2JETC 4SGAE 1BJUA 1G36A 1BTUA 1ID5H 2J38A 4DJZB 4WF8A 1G3BA 2BXUH 1MUEB 3SU2A 1O2ZA 3R3GB 1LMWB 1K1NA 4NWKA 4VGCB 2C93B 1O2GH 3LONA 1TWXB 4AG1A 5A09A 4CR5A 2QIQA 2F9OA 3SQHE 1RJXB 3W94A 5FX5A 2SFAA 3GCTG 3ATKA 1GWAA 2DUCA 1O31A 1DWEH 1BTHH 4X8UH 3PB1E 3RMLH 1O3OA 3P6ZB 1LPZB 2H2ZA 2XRCA 3P8NA 4O97A 4YOJA 2XWBI 1SQOA 3SV6A 1O3NA 1QJ7B 2BD2A 1K21H 3V12A 1GI7B 1NRRH 2A4QA 2D8WA 1AE8H 4SGBE 1PPEE 5EGMA 2G5NA 2WPIS 4MPUA 3SOSA 1NFYA 1O3CA 4BAKB 3MI4A 2OBQA 3BTGE 3T26A 1C5XB 1W7GH 3DT0H 1UCYH 3ZZBA 2Z3CA 3SJ9A 1G3EA 1HLTH 4X1PU 1K1LA 3STJA 1C5VA 2CN0H 3L33A 1ESBA 4GVUA 1QJ1B 4XFQA 3NXPA 1QL8A 1VR1H 1AWHB 4B71A 2ODYB 2B0FA 5HM9A 1MTWA 1AB9C 1J9CH 1P2QA 3RXHA 5JBTA 5C1XA 1GJ6A 1GI5A 1SGRE 2A5IA 4BAOB 5LPFA 1FIWA 2G4TA 3LC5A 1HV7A 1ZHRA 1V2TT 2UUFB 1Z8JB 1EX3A 2Y82A 1GBIA 5EPNA 3N7OA 1CGJE 1AUTC 1TMTH 2ZP0H 3SQEE 9LPRA 4K3JA 1IQFA 1DDJA 1O32A 2QY0B 3BSQA 5E2PA 2RA0A 3NUMA 1PQ7A 3BTDE 4YESB 2R2MB 1P0SH 3M7UA 1SGTA 3UQVA 2G52A 1JIMA 4FUFA 2Y5FA 3ZZDA 1XKBC 3I29A 2ZGJA 2BDAA 1G9IE 1BBRE 2ESTE 1EAXA 1P2JA 1BTXA 1XUJA 4LZ1H 2XCNA 1CT0E 2F9PA 1C5OH 3HKJB 1CU1A 2OC0A 4FVDA 3ZVFA 1KLIH 3PMHB 2VGCC 2J4IA 1ZHPA 1FY3A 1C5RA 1T4UH 4NWLA 3FP7E 4IC5A 4UONA 1S81A 1HB0B 2J92A 8KME2 3RLYH 2ZZUH 5L2YH 1LHGH 1NM6A 1ZZZA 2GT7A 4ABIA 2BDYA 1XXDA 1MQ5A 3UTUH 2G81E 4A1TA 4H6SB 3RXLA 3M61U 1S6HA 3QGNB 3P70B 2GKVE 5GPIB 1FLEE 2FOEA 4TWYA 4H4FA 3KQEA 3ZYEA 1O2UA 4OGXA 4RSPA 2EI7A 2WINI 1P3EA 3A7ZA 2B9LA 1NRSH 1YM0A 1XVMA 1GMHF 1O2OA 4K1SA 1WTHD 1FAXA 4Q80A 1YP9A 1AY6H 1F0RA 2AGIX 4XOJA 1TQ0B 2Y5HA 3D23A 4HGCA 4DG4A 4OS1A 1OOKB 3UQOA 3BTFE 1O3LA 3RXUA 2RG3A 1TX7A 2SGFE 2ZWLH 1WTGH 1G32B 1CGIE 1E35B 3A8BA 1PQAA 2YNAA 1XUGA 4YZUA 3AASA 2FOFA 1TB6H 1TX8A 2G4UA 3MYWA 2EI6A 2HALA 1CA0B 1P2MA 4X1RU 4I8LA 1T31A 1BB0B 3AAVA 1A2CH 4X2YA 2BDGA 1PPZA 3OYPA 5E0HA 4CRAA 4INKA 1QRWA 4GPGA 2ZPRA 3RXOA 1XVOA 3ATWA 4MNWA 3SGBE 3M37A 3TNTA 2B7DH 1WSSH 1UO6A 1V2LT 1DLKB 1O3FA 1SB1H 3ZZ8A 4BOHA 3SUGA 1THRH 3KF2A 3ODFA 1ZPZA 1DWBH 4BTTB 8GCHF 1ORFA 1UTJA 2A0QB 3RC5A 4F4OC 1DFPA 2R3YA 1MZAA 1V2ST 2H6MA 2A4OA 3ZV9A 4FUCA 4NGAH 1DXWA 1P04A 3UIRA 1XUIA 2H9HA 4FU8A 4A5TS 1Z1IA 1BHXB 5DP3A 4YOGA 2TGAA 4AZ2B 1XUFA 4Y71A 4NA9H 3FAOA 1C1RA 3E1XB 3RC6A 1TMBH 2QN5T 3SNDA 2W26A 2P95A 1PYTD 1C5YB 1TPOA 1WQSA 2EA3A 5I25A 1C5WB 1LPKB 3KQDA 1MZDA 3QX5H 1AE5A 2Y7XA 4OS4A 3RXEA 5EODA 3EDXB 1YCPK 3M5MA 1Y3VA 4IW4E 1KTTB 1UVUH 4NSYA 3S9BA 2BD3A 1AI8H 3PWBA 5CHAC 2FX6A 4I8GA 4IN2A 3RXKA 4Y8XA 3QUMP 1K1OA 1E34B 3LH1A 1ELTA 3QN7A 2IPHA 1ANDA 2A7CA 2BOHB 4K5ZA 1LCYA 1UJ1A 4IC6A 1BQYA 1K2I1 3BG4B 1CGHA 1J14A 2UWOA 1C1WH 1MAXA 1ZSKA 1ZGIA 1J17T 2XTTB 1SLXB 2V0BA 1QL9A 1B7XB 1NS3A 1D6RA 1LHFH 4FUIA 1JXPA 1AFQC 1O2YA 3GCHC 3IG6B 3BV9B 3KN2A 2ZI2H 3E0NB 5T6FA 2ZFSA 4QT8C 1GJ4H 1HGTH 4A7IB 3BTTE 1YKTA 1F5RA 3FZZA 4JCNA 1DANH 3MU5A 2A4RA 1PYTC 4A6LA 3SU4A 3PTBA 3GY8A 1V3XA 1EPTB 1QIXB 2VH6A 5DGJA 9ESTA 1ZGVA 5HM2A 3FP6E 1LVBA 3UPEA 2CXVA 1EB2A 2P8OC 5GDSH 3U69H 3MNBA 2A31A 1QRXA 3ZZCA 1GBDA 1NRNH 3P8GA 2C8XB 1LQEA 1ELEE 1NFWA 3OTJE 1MQ6A 3Q00A 2D2DA 1C5ZB 1F0SA 3SNAA 3WY8A 2P59A 1O2WA 4MPVA 1CT4E 4X8VH 1A3BH 1O5AB 1ESAA 1UCYE 1QFKH 3GY5A 4INHA 1D3QB 1H9HE 4Z0KA 1O30A 3OX7U 4NG9H 4DCDA 1BIOA 1FQ3A 4DY7B 1IOEA 3GISB 4KTUA 2R3UA 1LVMA 1TNGA 2XC4A 3C27B 4Y0YE 4XE4A 2TGPZ 1AMHA 3RMNH 3ESTA 1O2RA 5ESTE 1HYLA 1HJAB 2PR3A 1Q31A 5AFYH 4NSVA 2H9EH 3M5NA 2JETB 3S69A 5J4QA 1SGPE 1O2SA 3SNBA 3P8FA 3SN8A 1RGQA 3V7TA 2JH0D 3GY2A 4DURA 3S0NA 3TGJE 4UFDH 3V3MA 4X8SH 3E6PH 4TWWA 1AKSA 1A0LA 1AN1E 1W10U 3JZ2B 1LKAA 4X8TH 1EP6A 4AOQA 2FTMA 2K1QA 3AW0A 1ELVA 2FP7B 3NKKA 1H1BA 2ZDVH 5T6GA 2SGPE 1GBKA 2GD4B 2QGRA 1ZOMA 5A8YA 4UE7H 5GCHF 3LGTA 2VIOA 2M5TA 1O3MA 2ZG0H 1BBRH 1DM4B 1DWCH 4WMFA 5BPEA 3E3TA 1L1JA 4B75A 1CQQA 2ASUB 3RXAA 1MBMA 1TRNA 3TPIZ 1GJ5H 2BLOA 4ISOA 3SV2H 2VINA 1UMAH 2NU1E 3EA9A 3RLWH 4ASHA 3TJNA 1HAVA 5A2MH 1O39A 4B73A 1H9LB 4XBDA 1GMHG 1SG8B 4D9QA 2PUXB 2CF9H 3MH5A 2LNCA 2IOTA 3RP2A 1AB9B 1TNHA 4YO9A 1ELAA 1SBWA 2ZQ1A 4MQAA 1GI2A 4MLFB 1GHZA 3VXEH 1UTNA 1PQ5A 4E7NA 2BY9X 1UTPA 5DKMA 1BCUH 2QC2A 1GBEA 4ZH8A 1D9IA 1OYQA 2BY6X 1GBMA 3MNCA 2EI8A 3B23B 1TPAE 5F8ZA 4BAQB 2C90B 1P9UA 1C1QA 3SGQE 3U1JB 1IQJA 3KGPA 5H4IB 2GDDA 3VPKA 5HXFA 1RXPA 1BZXE 1UVOA 1BRCE 3NCLA 2ANYA 3RXQA 5FXLA 1BHXF 1QY6A 1PFXC 4ZMAH 4U2WA 1KLJH 1T8OA 1HDTH 3MU8A 2A5AA 4U30A 2R2WU 3SU6A 3DA9B 2GZ8A 1FDPA 1YPHE 5DP5A 1C4U2 2V6NA 1F5KU 2BZAA 3PLKA 1C5LH 1P09A 3F6UH 4IGDA 2ZFFH 2CF8H 8GCHG 1UK3A 4CRGA 4LOYH 4I31A 3EAJA 1CO7E 1ZTKA 4TY6A 1C5MD 2ODPA 4HZHA 5A0AE 1GGDC 3FVFB 1A1RA 1TGSZ 1YF4A 2ZDLA 1GI8B 3LDXH 2J94A 5EQQA 1DY8A 2ZA5A 2W3KA 1ANEA 1GHAF 1S82A 2OXSA 2Z6BD 2PKSC 3ODDA 2TIOA 1F2SE 4ABBA 1ARCA 2HVXA 1GHWH 1GJ8B 1XMNB 2PHBA 3MU4A 5JBBS 1Y8TA 1DSUA 3T27A 1HAHH 1IQGA 1L0ZA 1W3CA 3BTHE 1Z8GA 3O8BA 2Z9JA 1AVGH 2Z9LA 5JBAS 2BLVA 1MMJN 2ZFRH 1N1LA 4KTCA 2ILNA 1W2KH 4LK4A 1SOZA 3DD2H 4AGJA 4ABJA 2AMPA 4DIHH 2PSXA 4AORA 1K1JA 1H8IH 2WUBA 3SBKA 1MU8B 1IQEA 1SVPA 2PGQB 1EZUC 3TJOA 1G3CA 2J95A 2BVXH 4BNRA 2ZGHA 4FXGH 1KLTA 1JRSA 1D3DB 4GAWA 4AFQA 2ZU3A 1GJ7B 1FIZA 2ZPSA 3F1SB 1ZR0A 2XBVA 2Q6GA 3FFGA 3IITA 3H7OA 1E36B 1DX5M 1YYY1 4TPIZ 1EJNA 5JDUB 1ZPCA 6CHAC 1EXFA 4RKOB 1C5PA 5L2ZH 1UVSH 3A88A 1OP0A 1C1PA 1P2KA 4JZIA 1GL1A 1TPSA 3K65B 2B8OH 4KKDA 1UVPA 3RMMH 2JH6D 1L2EA 1OYTH 1ZJDA 3LGWA 3MO3A 4AN7A 1D6WA 5EPYA 4WVPE 3NZIA 1NC6A 1CT2E 1THSH 2VWMA 5A0BA 2FZZA 1QL7A 1GJBB 4YT7H 7LPRA 2C8ZB 2OUAA 3SORA 3MO9A 1HAIH 1C4Y2 4D76A 2OINA 2FO9A 3RMOH 1QHRB 1MTNC 1OWJA 2BY5X 3HK6B 2O8MA 2OC8A 3MU1A 1SFQB 1J8AA 3P8OA 4CRFA 1GCTC 2GMTC 1FXYA 4D7FA 1VZQH 3GDVA 2BX3A 2Y7ZA 5CHAB 4NCYA 4IBLH 4D7GA 1Z6JH 3TLOA 1T8MA 1C1OA 2JH5D