5DKMA

S. erythraea trypsin michaelis-menten complex
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
230
structure length
229
Chain Sequence
b'IVGGEDANVQDHPFTVALVTPDGQQFCGGTLAAPNKVVTAAHCTVGSQPADINVVSGRTVMSSNEGTVSKVTNVWVHPEYQDAAKGFDVSVLTLAPVKEAPIELAKADDAGYAPDTAATILGWGNTSEGGQQADHLQKATVPVNSDDTCKQAYGEYTPDAMVCAGVPEGGVDTCQGDSGGPMVVNNKLIGVTSWGEGCARPGKPGVYARVGAYYDVLMEQINAGAVSAR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title High resolution structures of S. erythraeus trypsin throughout the catalytic cycle
rcsb
source organism Saccharopolyspora erythraea
molecule tags Hydrolase
total genus 59
structure length 229
sequence length 230
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2015-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dkmA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5dkmA01
2BD2A 3SUGA 1KXBA 2Q6GA 3A85A 4SGAE 1BTHH 1K1OA 4I7YH 5FX5A 3U9AH 2IPHA 3UWJH 4D9RA 1WV7H 1NROH 1V2ST 2A5KA 5HXFA 3KCGH 3EA7A 1KIGH 1QB9A 2HRVA 5EXLA 1K9OE 4ABIA 1D3QB 5DP4A 1VJAU 3F9EA 1FAXA 4AB8A 1C1WH 4X1PU 1OPHB 1NO9H 1F7ZA 3EQ0H 2PGBB 1JRSA 4FUDA 1G3EA 1OWIA 1TYNA 2FIRH 2VJ1A 3BEIB 2ZTZA 1FY4A 1GHXH 1H8IH 2A4OA 4ABHA 1J8AA 2ZPRA 1Q2WA 3RP2A 2Y7XA 2ZU4A 3QGNB 2FOAA 2BZAA 3MWIU 1O5BB 1MKWK 3TJUA 1XUFA 2A31A 2ZDLA 2JETB 1DPOA 1AE8H 4RN6A 1SR5C 2WV5A 3R3GB 2BLWA 3ZZBA 2FYRA 4BANB 8KME2 4O3TA 3CS0A 3P6ZB 1O2JA 4HI3A 3PB1E 3SNAA 1AN1E 2BM2A 1FMGA 1XUGA 3RLWH 4INKA 2DUCA 2V3HH 5EQRA 1EZQA 1DY8A 1BHXB 1NZQH 1QQ4A 4K60A 3MI4A 3O8RA 1MTWA 3ATMA 1WQVH 2VVVA 1CT2E 5HM2A 8GCHG 4YOIA 1HLTH 2ZDVH 2ANWA 3A82A 8GCHF 2G51A 1LPZB 4NA9H 4AG2A 1TLDA 1CHGA 1G3DA 1ID5H 2ZGBH 2QGRA 1C1MA 1EQ9A 5DP6A 3HKJB 1BUIA 4FUEA 1ESAA 3M7TA 2C8WB 6ESTA 5E2PA 2VWOA 2ALPA 2ZZUH 1FIWA 2BB4A 1MTUA 1BMNH 2AIQA 1BRBE 1P06A 1SG8B 3AAVA 5C3NA 1H9HE 2ZGXH 3RXJA 1W10U 2R9PA 3BTFE 3ZVEA 1DUEA 3MHWU 3BTHE 3RXAA 2FZZA 1O2PA 2OLGA 4JZ1A 1GMCG 3SHCH 1PQ7A 3GCOA 4Y0YE 1FIZA 1YPHE 1NM6A 1GMCF 1T8MA 1UTKA 1JXPA 3U8OH 1NRSH 2YNBA 5AFZH 3O8CA 1XUIA 1O2SA 3P92A 3SU3A 3RXGA 4DW2U 2G5VA 5JBTA 2BY9X 4H4FA 3FVFB 3TNTA 4NIXA 3TIUA 1TAWA 5JPMH 1F0UA 1K1LA 1T4UH 2Z3DA 4O3UA 3MO6A 2ZFTA 3E0PB 1SQAA 1YCPH 2ZO3H 3VEQB 1WAYB 1OWEA 5E0JA 3SGAE 1HAVA 1IHTH 5GWZA 3Q3XA 4UD9H 3P95A 1V2NT 4WMEA 1BTWA 2UUYA 2OC8A 1TGCA 1AUTC 8ESTE 1C1QA 1HXFH 1UK2A 4XSKU 1WYKA 3A81A 2FI4E 3NKKA 5HM9A 3S7KB 3LKWA 4FUHA 1EPTC 2TPIZ 4Y71A 2BQ6B 2H5DA 1A5GH 3A8DA 1SQOA 2F9OA 1NRPH 1P2QA 3RXCA 1HNEE 2FPZA 1H1BA 1AU8A 4UDWH 2ZPQA 2SGFE 2PKSC 1IHSH 1O3FA 4AORA 1GI4A 2CV3A 2FLRH 1OXGA 3RXKA 1S82A 4CREA 5FHTA 1Q31A 3BF6H 1W0ZU 4WXVA 4I8JA 1BRAA 1QRWA 1SGDE 3IWMA 4YT7H 2BVRH 4CRGA 3K65B 2BD8A 2OUAA 1F5LA 1LPKB 1ZPZA 3ZZ9A 1C1TA 2VH0A 2EA3A 5EPNA 1OWDA 3P8GA 1BB0B 2ODQA 1OP8A 5GPIB 1FN8A 2BLVA 1UTNA 5DP8A 1O2WA 2BYAX 3RXMA 4KKDA 2WPJS 3ZZ3A 3ATWA 1SHHB 2G55A 3RXTA 3RLYH 1THSH 4FUIA 1F92A 4OS5A 2ESTE 2ZGCA 1O36A 2G4TA 1N6XA 1L1JA 2ZHQH 1AFEH 1IQHA 3KQEA 4X6OA 1LTOA 2FTMA 4RKJB 1GBEA 1O37A 2GX4A 3SNBA 1BTXA 5TCCA 1C1OA 3UQVA 1QB1A 1O3EA 3ZYEA 4I8HA 3M5NA 5L2ZH 1A5IA 2J94A 4E05H 5LPEA 1EOLA 1LKBA 3D62A 1QBVH 4IC6A 3PLPA 1KXAA 1QB6A 4JZDH 4BTIB 4WH6A 1AO5A 1E0FD 2SGDE 4K5ZA 1C9TA 2QC2A 1EP6A 4WXIA 1TNGA 2XXLA 4JCNA 1C5VA 2V3OH 1RRKA 1GBLA 3BG4B 3T26A 1HAVB 1IOEA 2UWOA 2FOMB 3BTDE 1TE0A 2FTLE 4J2YB 4U2WA 2XYAA 1YPKH 2BD4A 1TBRH 3BTWE 5I46H 2B5TB 1ANBA 4FUJA 1K1MA 2VWNA 1O2VA 4Y11E 1ELDE 1ZYOA 3FANA 7ESTE 1M9UA 1NFWA 1Y3YA 4BAMB 2BLOA 1NRQH 1JMOH 4BAHB 3SUDA 5C67A 1W8BH 1B7XB 3H7OA 1OWJA 1YCPM 3K6YA 5IDKA 1W11U 3URCA 3VB7A 1GBIA 3A7YA 2FLBH 2LPRA 5C20A 2CHAB 3V12A 1SLVB 4AFQA 3A8CA 4HGCA 1K2I1 5ETXA 4FUCA 3LGVA 5GXPA 2FS8A 1MKWH 4K1SA 1W7XH 3M5MA 1O3JA 1ELTA 3EGKH 2GDEH 2XTTB 2G5NA 3E1XB 4JZFH 4I32A 1FY1A 2Y5HA 3O8DA 2GCTC 3ZZ5A 1J14A 2VVCA 2FDAA 4B71A 3PWCA 2AH4X 4Q7XA 1EJMA 2HOBA 1QY6A 3UIRA 1BTPA 2HPQH 4X2WA 1C1NA 1Z1JA 3B8JA 1IQNA 3QN7A 4Y8ZA 1ARCA 2NU3E 3V3MA 1EB2A 1LHEH 1ZOMA 1LQDB 3FFGA 2IJOB 3UNQA 8LPRA 5L2YH 4NSVA 4D7GA 4XDEA 1OYTH 3E91A 3GDSA 2VWLA 1CT4E 4FU7A 1WUNH 2Z3EA 5HGGA 3SJIA 1C2KA 4MPUA 3MO9A 1UJ1A 3RUOA 1DITH 2Y6TA 4B76A 3JZ2B 3RXHA 1IQFA 1AD8H 4A1XA 4ZROA 1GI5A 2J9NA 5ESBA 1MKXK 3HGNA 2V35A 1AI8H 1AZ8A 2SGPE 2IN2A 3NXPA 5ESTE 5JBBS 1MBMA 5EODA 4X6MA 2A45B 1GG6C 1TA6A 2JH5D 2GMTC 1UVSH 1A46H 1G2MA 4X6NA 1L4ZA 4XBBA 1QRZA 3ENSB 4GSOA 4Y79A 2O8WA 3KL6A 3QK1A 2HNTE 1P2NA 1P02A 1TNHA 5C1UA 2H9TH 2VIOA 3PYHA 3Q3KA 3E16B 1MU6B 5LH8A 3F68H 4OS2A 2PWXA 2XWBI 1TB6H 3A89A 1B0EA 1HAIH 3E8LA 4K8BA 4THNH 1QBNA 1XXFA 3Q3YA 2WPMS 2HVXA 4XOJA 3A7XA 3QTOH 1GDUA 2XC5A 1TPOA 3T25A 3GISB 3E0NB 2F9PA 3BIUH 1UCYE 1UHBB 3LPRA 1DWCH 3GY5A 4DY7B 2JETC 1P05A 2AEIH 1P03A 1O2OA 1NPMA 5DJ7A 2ZP0H 2YNAA 4MQAA 4IW4E 5J4SA 4LZ4B 3MH5A 4ISIH 2TRMA 3SBKA 2DE8A 2HLCA 3C1KA 1AHTH 1ABJH 3OY6U 1AFQC 3SO3A 1YCPK 5CHAC 1OS8A 3SHAH 1CA0B 3QWCH 1B5GH 1GPZA 1KLIH 2F9NA 2TGTA 3GY7A 4K2YA 3K6ZA 5F03A 1MTNC 1QHRB 2O8LA 1CSOE 2P3UB 3SU2A 1V6DA 5JB9S 1GJ4H 1PPCE 1Y3XA 2ZHEH 3F6UH 5DP7A 1W2KH 4UEHH 2XBWA 3ZVCA 4OS1A 3QDZB 4ABAA 4KGAA 1ELCA 2AYWA 1KYNA 5EXNA 4R0IA 1TMUH 1P11E 1OWKA 3PLKA 3SU6A 4B1TA 3AAUA 4BOHA 1QL8A 2GGVB 4NIYA 5E0HA 1SFIA 3MU5A 1RTFB 1GHAG 1OX1A 4GHTA 1O0DH 1GHAF 1HRTH 1ZGVA 1MTVA 3AASA 1KTTB 2QY0B 2PUQH 3M3SA 4MNVA 3ELAH 4K1TA 2Y80A 2W5EA 1UTMA 1K1JA 1CO7E 1GBMA 3ZZ7A 1DY9A 1SQTA 2P3TB 1FXYA 2B8OH 1FV9A 2ZCHP 4TY7A 1O5DH 1ZMLA 4H6TA 5G4BA 1ELEE 1GBFA 4YLQH 1FY5A 3EA8A 3RXUA 4FVDA 2C4FH 1VCQA 3H7TA 2PTNA 4INHA 2XC0A 1IQMA 4NSYA 1RTKA 3PM3A 3U69H 3AW1A 4ABBA 1DWDH 2GCTB 1DUAA 1Y5AT 5DK1A 3ZV9A 2BDYA 3PMAB 2SFAA 2XC4A 1LHDH 4RSPA 4BTTB 2SNVA 1AUJA 2W26A 2RCEA 3OY5U 3RC5A 3SQEE 1OP0A 4FU8A 1EXFA 4PROA 2EC9H 1WQSA 4MLFB 4ISOA 2JH6D 2ODPA 3GY6A 4JMYA 5FXLA 3OU0A 2QIQA 1NY22 1SGCA 3GY4A 3C27B 2GTBA 2O9QA 1O2RA 3TK6A 1OSSA 1Y5BT 2A7JA 2J38A 1Y3VA 2KAIB 1BIOA 1C5YB 1TFXA 1L0ZA 1L1GA 1L4DA 3LC5A 3UR6A 2NU4E 1HPGA 1C1PA 3LDXH 1VCWA 2D1JA 4E7RG 1MBQA 3LGIA 4K1EA 1Y3UA 1OOKB 2QCYA 3MNXA 2FOBA 3A83A 1Z6JH 4D76A 1KLTA 1SHYA 1RJXB 3RXPA 1JWTA 5FPYA 1GCTB 1TABE 4X6PA 2PR3A 1ELBA 1LVOA 2A0QB 1HIAA 5FCKA 2XBVA 4MPXA 4TPYA 2H1UA 2ZU3A 2GMTB 2ZI2H 3A88A 3UFAA 1DX5M 1P2JA 3I77A 1ZHMA 1MAXA 3ZV8A 4XBCA 3SNEA 2VU8E 5DO4H 2P95A 1ZRBA 3TGKE 1G30B 2BQWB 3DHKH 2XCNA 2PV9B 2VH6A 2BDIA 4IMZA 3ZYDA 3K9XB 1O2XA 1EB1H 2K1QA 2D2DA 2GDDA 1XVMA 1G3CA 4CR9A 3GCNA 4B2AA 4NWKA 2ZU1A 2ZHDA 1RFNA 4OS6A 2AS9A 1O5EH 4X8VH 3EYDA 3SGQE 2NU2E 2H5CA 2TIOA 4AYYB 1MD8A 4Q7YA 4FUFA 4X1NU 1KLJH 1HAOH 4AZ2B 4IN1A 4H42U 5A8XA 5FX6A 4B74A 2RDLA 1ZTJA 2UUJB 1J16A 4Y10E 2F9UA 5EG4A 3SQHE 3ZZ8A 4A92A 4E7NA 1CE5A 1AFQB 5CHAB 5E2OA 2FOEA 1FZZA 2C8ZB 5H4IB 1AB9B 2ODYB 2FOHA 1PPZA 1MTNB 2B9LA 1MKXH 2Z94A 4DIHH 2J2UA 3VB3A 1O2LA 3ODFA 4FXGH 1GJ7B 2WPIS 3BG4C 2FMJA 1U6QA 3KQCA 4JZIA 1C5MD 1ETSH 4BXSA 4K69A 1OYQA 4O9VA 1BITA 1V2UT 1PPHE 2AMDA 2I6QA 2A1DB 4YOJA 2BOHB 1LPGB 1PYTD 2GKVE 1NRNH 1CQQA 2ZDAH 5F8TA 2CF9H 6GCHG 6GCHF 2H9EH 1A7SA 3MNBA 1UK3A 4HZHA 3F9HA 5LPRA 1E38B 3W95A 1HIAB 2WUCA 1TNIA 5ABWA 1GI1A 2C90B 3LH3A 1BOQA 1KXCA 2H9HA 1ZSKA 3D49H 2JKHA 1F0TA 2ZWLH 2CHAC 2I6SA 2QXIA 2W7SA 1S5SA 1ANEA 2H2ZA 1V3XA 5PTPA 4FUGA 4CRBA 2SNWA 2VIWA 1Z6EA 1HDTH 3SI3H 4MNYA 1D3TB 1GBJA 4I8LA 1O2MA 4I33A 5GJ4B 5DG6A 4WJG2 1SMFE 2GZ8A 5SGAE 3DD2H 5F6MA 1JIMA 5EQSA 3SV2H 4A1VA 1P12E 1E35B 4SGBE 4YZUA 4ABGA 1XM1A 3ZZAA 1NS3A 3L6PA 1GWAA 3SNCA 1O3CA 5C5OA 5EU8A 5K0HA 1MUEB 4CR5A 1ELAA 1BBRE 2ZDMA 3AVZA 4JK5A 3VXFH 2YOLA 1ZGIA 3BSQA 1GL0E 2BDGA 3KHVA 4Y7AA 1NT1A 4WY3A 1UTJA 1AWFH 2XWAA 2P59A 4ZAEA 2ZGJA 1T8OA 2ZDNA 2F3CE 1GVLA 1PPBH 3TVJB 1TNJA 3DFLA 1IQLA 2PHBA 1D6WA 3DT0H 3MH6A 2STBE 3QUMP 1C5UA 3RMMH 4YT6H 1KSNA 1MQ6A 2PSXA 1TX7A 1YLDA 1GDQA 1WOFA 3MNSA 4WMFA 3P8FA 3UNSA 4AG1A 3RXFA 4ZMAH 4B2BA 3U8RH 4Z6AH 2J34A 1YGCH 2ZFRH 3LGWA 1GCDA 1P2IA 2H6MA 2PSYA 1O31A 3CP7A 4X8SH 1UTPA 4JYTA 3GY2A 5K7RA 2FX4A 2V6NA 1QR3E 1HYLA 4X1RU 3CENA 1SBWA 5DP5A 1PQ8A 2IOTA 3STJA 2P16A 3AW0A 2GZ9A 1QA0A 3RXIA 3P70B 1THRH 1GBAA 1O3MA 2RA3A 3BEFB 4KTCA 5T3HA 4LXBH 5A0BA 4JK6A 2ZA5A 2Q6DA 2F9BH 1HXEH 3QGJA 2W7UA 3DFJA 4YOGA 2FO9A 2QA9E 3A86A 1VZQH 4DG4A 2G00A 1Z8RA 1C5LH 1S6FA 2XBXA 1UVOA 2CMYA 4ZKSU 1P2MA 2OBQA 3T5FH 1GBHA 1BJUA 1QL9A 3WY8A 2BTCE 3QLPH 1CGHA 2AMQA 4IMQA 4VGCB 1BRCE 1ETRH 1Y5UT 2BD5A 4ESTE 3UNRA 3DA9B 1C2GA 3IG6B 5AHGH 1YPEH 1C5NH 1VITH 2BXTH 1QL7A 2BVSH 1A4WH 3A7ZA 2FI5E 1O5AB 5C2ZA 3A87A 4OGYA 1SGRE 4B73A 3T27A 1CA0C 4GCHG 4DIIH 1ZSJA 1O33A 1QJ6B 4GCHF 3PLBA 2A4GA 2Q6FA 1RTLA 1P2KA 2V0BA 3BTQE 2CF8H 1N8OB 1O39A 3GICB 3SV7A 1C4Y2 4XE4A 3TGIE 1EKBB 1HFDA 1T4VH 3SOSA 1MTSA 1LHFH 1AVWA 1C2IA 4DVAU 1LMWB 4FVBA 4AB9A 2P8OB 3R0FA 1XMNB 3RC6A 1FY8E 1O3GA 1QTFA 4ZKRU 2HWLB 3RU4E 1RIWB 2ZHFH 2XBYA 1O30A 4UFDH 3TNSA 4GAWA 1GJBB 4Y76A 3TITA 1G36A 3L3TA 4UFFH 2ZU5A 1TRYA 1OP2A 3U1IB 1T7CA 5F8XA 2OC7A 3E3TA 2ZGHA 2VB0A 1ZJKA 1AMHA 1NFUA 4ZUHA 2C3SA 4GLYA 4ABDA 1MCTA 3PO1C 9ESTA 5LGOA 2GZ7A 2PKAA 1HAHH 1V2VT 3S7HB 1P3EA 1GBKA 2QYIA 5EGMA 1AY6H 2Z9JA 4ABFA 1LVBA 2Z9IA 3RXDA 2O8TA 4IS5A 1TMTH 3V7TA 2SGQE 3P8NA 3PWBA 1SGTA 1SOZA 4Y8XA 2BD9A 2XW9A 2O8MA 2FOFA 5FBEA 3MTYA 1OKXA 1V2PT 1HAZB 3M3TA 2RG3A 3EA9A 1VITG 3LOXA 4HTCH 3IITA 1K1PA 1VITF 4NWLA 1NESE 1UMAH 2R2MB 1O2HA 3NK8A 5EOKA 3RXSA 1O3BA 2VIDA 3OTJE 1DS2E 2OC1A 1Y8TA 4FU9A 3S69A 1S83A 5BRRE 2FS9A 1ESBA 3LC3A 1K21H 2ZQ1A 2ANYA 3GY8A 3MOCA 1XKAC 1O3DA 1PPFE 1C1RA 1MMJN 2ZTXA 2J95A 5AVDA 1ANDA 1D4PB 1GMHG 4MNXA 3UTUH 4HFPB 4A1TA 2BX4A 1GCTC 1GMHF 1PJPA 1PQ5A 2BX3A 3A80A 1QURH 2PFEA 3GDVA 2FX6A 2ZG0H 4LK4A 1CGIE 3OYPA 1O5GH 1A0HB 1AIXH 4NIWA 1TQ0B 2A32A 1C2DA 9LPRA 1TPPA 1TX6A 3HK6B 3TJNA 1FLEE 1HB0B 1WU1A 3RMLH 3SORA 2VNTA 1TPAE 1ORFA 3ESTA 3SJOA 1Z8IB 3TK9A 1DWBH 4FUBA 4TY6A 1A3EH 1RXPA 2VIQA 1AZZA 1UVTH 3Q00A 1DXPA 5FAHA 3SZNA 1AE5A 3PROA 1EZXC 5JBCS 2HPPH 5IYTA 3UUZA 2BOKA 3SI4H 1C2FA 2SGEE 1GMDG 3M3VA 2Z9LA 1Z8GA 1GI2A 2D26C 1QBOA 3LT3A 1GMDF 1G2LA 2OTVA 1V2QT 5I25A 2EI7A 4IC5A 4ZH8A 1A0JA 4D9QA 1Y3WA 2PKAB 4A7IB 1KDQA 1S0RA 1E36B 1EUFA 1AWHB 1O3OA 2Y82A 1CT0E 4DGJA 1BTZA 1ABIH 2ZEBA 1AKSA 1AQ7A 1C2HA 1GDNA 6CHAC 2G81E 1ZR0A 5B6OA 1ETTH 3GCHB 3ZZ6A 2BHGA 3ATIA 5JBAS 4I8GA 1F5RA 1DWEH 1AVGH 1EOJA 4CHAC 1ZMJA 1AB9C 1HUTH 2FODA 3G01A 3ZVFA 1V2OT 3SW2B 4DJZB 3MFJA 1LHCH 2ZKSA 2VGCC 1L1NA 5DP3A 1EJAA 4X0WU 3MU1A 4KTUA 5LPFA 4ZKOU 3M36A 3F9FA 4AYVB 3FP8E 3A84A 1UCYH 1BQYA 1FPHH 1HJ8A 1S0QA 3RM2H 1INCA 1GBCA 2XNIA 3LH1A 2P3FH 1C5OH 4MG3A 3SU4A 2UWPA 3MU8A 3KQDA 4B2CA 3SUFA 2AERH 1GHWH 1W0YH 1QCPA 2OC0A 1XUJA 4QT8C 2LNCA 1C2EA 1F0RA 1G37A 4MTBA 3KIDU 3GDUA 3HPTB 4ZHMU 1O2UA 2ZDKA 3PO1B 4BNRA 4MVNA 3BTTE 1O2KA 1D6RA 2B0FA 1BBRK 1L2EA 4I8KA 2ASUB 1Z1IA 2J92A 5A8YA 4K8YA 1FI8A 1IQGA 3LIWA 1TRMA 7LPRA 2HALA 3TH2H 3TH4H 5FPSA 1N6YA 2GVFA 2VVUA 2AGGX 3BEUA 1IQEA 4TWWA 1HAGE 1YPMH 2BQ7B 3E6PH 1O5FH 2C8YB 5JYIA 3LONA 2WYGA 4M7GA 1SGFG 1ZTKA 3P17H 1PYTC 1SGQE 3GCTG 3LGUA 3ITIA 1BTUA 3SJ8A 2GV7A 3GCTF 2UWLA 2TBSA 1Z8JB 4LOYH 5CE1A 2ZIQH 2WPLS 1UVPA 1YLCA 1HJAC 1GI8B 1WBGB 3RU4D 2BDCA 3M37A 1IQIA 2HNTF 3S9BA 1N1LA 1YF4A 1P2OA 2W3KA 1UTQA 2O8UA 3UOUA 3MH4A 1AGJA 4B75A 2R0LA 1EZSC 4Y7BA 1AKSB 1NFYA 3PMHB 1SGNE 1GL1A 5GCHG 2A5IA 2Z7FE 1TA2A 2QF0A 4XBDA 1IAUA 3SU0A 1T32A 2B7DH 4ISLA 5E8EH 5GCHF 1HAYB 3F1SB 3BN9A 4A6LA 4E06H 3BV9B 1RD3B 1SGIB 3PTNA 3VXEH 2QAAA 3KQBA 2GT7A 2A4QA 1PQAA 2R3UA 3VGCB 1KXFA 1SLXB 1P9UA 1ZJDA 3QZQA 3VFEA 2TGDA 1SGFA 1ZTLA 3F9GA 1JBUH 1V2KT 1SL3A 1SGPE 4IGDA 3S9CA 2FYQA 2WINI 3SV8A 1MZAA 1ZPBA 3UQOA 4TYDA 5L30H 1GI9B 2ZHWH 1WTGH 5EW2H 3GYMA 1ZPCA 2F83A 1EZUC 1LVYA 4NA7A 2ILNA 4Y6DA 1HGTH 4CRAA 1C5QA 2NWNA 3B23B 1H9LB 3RMOH 1XKBC 2RA0A 1MZDA 4U30A 1A0LA 4OGXA 2A7CA 5C1XA 3UWIA 2ALVA 2VWMA 1QNJA 3LGTA 3OX7U 2Y7ZA 5DP9A 3M35A 1K1NA 3RDZA 4VGCC 1A2CH 1CU1A 4DOQA 4NFFA 2TGPZ 1DFPA 6CHAB 1SLUB 1BA8B 1DT2A 2A4RA 4D7FA 2OINA 1GVZA 1SI5H 1ZMNA 4MPWA 4CBOA 3RXBA 5EW1H 3BTME 1BCUH 2PW8H 3UOPA 4CHAB 2F9VA 3ZVGA 1G9IE 3L33A 5GDSH 1ELGA 4JZEH 4JYUH 2ZPSA 1N8OC 1ZRKA 1VGCC 3SN8A 3T2NA 1J9CH 2OD3B 4BAKB 2VGCB 1NRRH 1QGFA 1F5KU 1TGSZ 2P8OC 1O2GH 2TGAA 2PTCE 1EASA 1TRNA 2VINA 1P10A 1SPJA 2AIPA 3SU1A 1O3NA 1RIWC 2EI8A 4NCYA 4YESB 2VIVA 3ZVDA 2A2QH 3RXEA 2FI3E 1DICA 1XX9A 1NU7B 1P9SA 1JRTA 1UVUH 1W3CA 2BVXH 2HGTH 2BY8X 4I31A 5A09A 1KTSB 1Y59T 2QF3A 4NA8A 3V13A 2W3IA 3P8OA 5E0GA 3T62A 3VB6A 1XXDA 3RXOA 2A5AA 1QA7A 1V2TT 1MD7A 4INLA 3LJJA 4JYVH 1PPEE 3LJOA 1C4V2 1IQJA 3A8BA 5A2MH 1BJVA 2CN0H 3GYLB 2BD3A 1GVKB 1TWXB 1SVPA 2OQ5A 4Q7ZA 5GIBA 3KF2A 3QO6A 1ZHPA 1CBWB 3BTEE 1ELFA 4AGJA 4MPVA 1FDPA 3E90B 1O2YA 1YPGH 2AFQB 1S6HA 1C5ZB 1ELVA 1GJAB 1K22H 1V2MT 3BTKE 2ZQ2A 2WUBA 2ZCKP 3FP6E 5T6GA 1XUKA 1J15A 2A2XH 4GVUA 4ABEA 1TX8A 4UONA 4OS7A 3MMGA 4IN2A 1DOJA 2ANKH 3S0NA 3NPSA 3TJVA 5JB8S 1CHOG 1H4WA 1HJAB 1DM4B 1CHOF 2ZC9H 4IBLH 1BMMH 1ARBA 3RU4T 1GGDB 1GHZA 3ZZDA 3A7TA 3SNDA 1BDAA 1BRUP 1TBQH 2P94A 2GCHG 1V2LT 1FN6A 1G32B 1KY9A 2GCHF 4YM9A 3HATH 3ATLA 2CXVA 1CA8B 5C1YA 2BDBA 2AMPA 1BTYA 5A8ZA 1GI0A 1MQ5A 2ZTYA 3M61U 4O97A 1Z71A 2ZFPH 3M7QA 2WV4A 1UCYK 1YPLH 5DPAA 3U8TH 1O35A 2GV6A 2QXJA 2ZFQH 4XFQA 2CJIA 1TMBH 2FESH 4Z0KA 4AFSA 1CVWH 1D3PB 4UFGH 2BY5X 5A0CA 3ZZ4A 1BBRH 4KTSA 4KELA 1H8DH 4X2VA 4BAOB 3U98H 2VIPA 1O34A 2G4UA 1P8VC 5TJXA 2ZNKH 1GBTA 2EI6A 4ZKNU 3D65E 5TCAA 1FUJA 1KXEA 4BXWA 2OP9A 1S84A 1ZLRA 3HKIB 2FEQH 3VPKA 1T8LA 1THPB 3V0XA 4LZ1H 1YC0A 4F49A 4AN7A 1IQKA 1YP9A 4YTAA 3RMNH 1O3PB 1YPHC 1EATA 1V2RT 3NCLA 3PMJA 4J1YA 1FPCH 2R2WU 5EXMA 4CBNA 3GCHC 4CRDA 2BY7X 1V2WT 4ZXYH 1SB1H 1DXWA 1O2QA 1TALA 2BXUH 1EAWA 3SJKA 2FM2A 1C2JA 2WPKS 1GI7B 1GI3A 1VGCB 1O3IA 1C9PA 3NUMA 1S85A 1GJ6A 2ANMH 1EPTA 1GJ5H 1LHGH 2Y5FA 2UUKB 4ZHAA 1DE7H 5DKMA 1NN6A 4OS4A 1W7GH 2QN5T 1WSSH 1HBTH 1C2MA 1GJ8B 2AGIX 2XRCA 1EP5A 4X8UH 1DSUA 3KGPA 1O32A 1C1VH 2PLXA 2THFB 2FOGA 4WVPE 1SC8U 5F8ZA 3A7WA 1HAPH 1Q3XA 2QXHA 3M5OA 2ZCLP 4F4OC 1K28D 3D23A 4MNWA 5FCRA 5J4QA 3H5CB 2DE9A 2OXSA 1YM0A 4ASHA 1Z7KA 2AGEX 1DLKB 2ZFSA 1HCGA 3KN2A 4AFZA 2Z3CA 4X8TH 2C8XB 2J4IA 4Y0ZE 2Z9KA 5FPTA 5AFYH 1UHBA 3W94A 3CS7A 1C1UH 2PGQB 1XVOA 1C5RA 1WTHD 4ZHLU 4GUXA 4TPIZ 1MU8B 4ISNA 5EQQA 3EDXB 1TIOA 1O38A 3SGBE 3HK3B 3Q76A 1ZHRA 1EAIA 4NG9H 3EAJA 1P0SH 4Y8YA 4DURA 3BTGE 3MU0A 2UUFB 2NU0E 3FZZA 1J17T 1SGYE 4X2YA 4BTUB 1LKAA 1C5PA 3EE0B 3TLOA 1P01A 4RKOB 1RGQA 2BMGB 2WPHS 4CH8B 1H9IE 1T31A 1O2IA 1P3CA 3MU4A 1W13U 5DGJA 1PPGE 4D8NA 1TNKA 2XCFA 3TU7H 1VJ9U 3ATKA 1ACBE 1RS0A 1ZSLA 4A5TS 1EX3A 1F0SA 2EEKA 3TH3H 3VGCC 1OWHA 4NGAH 2F91A 3FP7E 3SJ9A 3M5LA 1TGNA 2GD4B 1D3DB 2C93B 1FQ3A 4R8TB 1EPTB 3MO3A 3HGPA 1ZZZA 5T6FA 1FAKH 1LDTT 1X7AC 3O8BA 2Z6BD 3OSYA 1BMAA 1TBZH 1VCPA 3UREA 2OBOA 3RXVA 2QXGA 1GJCB 4NZLA 4ISHH 5T6DA 1HV7A 3SU5A 3JZ1B 1C5WB 1K1IA 2PKSB 3VB5A 1BZXE 4X1SU 3RM0H 2CGAA 2ZFFH 1JIRA 7GCHG 2BDAA 1E37B 4UE7H 1C1SA 7GCHF 4O03A 3PTBA 2JH0D 1UTLM 3RC4A 2BY6X 1NC6A 1F2SE 3KNXA 3UPEA 1A61H 5CMXH 1LQEA 4KP0A 1YBWA 4X2XA 3BG8A 4Q2KA 1QJ7B 3KEEA 3MNCA 3ODDA 1O3AA 3A8AA 1O2TA 1DDJA 2OQUA 1HAXB 5AF9H 1UO6A 4AFUA 1JOUB 1DANH 2D8WA 2ZECA 4NZQA 1O3HA 1SFQB 1C5XB 3TK5A 3TGJE 2ULLA 3A7VA 3PV4A 1MAYA 2KAIA 4UFEH 4CH2B 2BDHA 1TGTA 2Q1JA 4Q80A 3ZVBA 1TPSA 1NFXA 3RXLA 3FAOA 1TNLA 5HMAA 1GJ9B 1SOTA 3MH7A 3SUEA 1A5HA 3UR9A 1MH0A 1O2NA 1GHBG 4WWYA 4YLUA 5C5NA 1GHBF 5JDUB 3BIVH 3T28A 4WMDA 1DVAH 3ZVAA 3SV9A 3GY3A 3FZDA 1DSTA 4CRFA 1KXDA 2FWWA 3S9AA 5FBIA 3STIA 1C5SA 3RXRA 4WH8A 2STAE 1C2LA 2G8TA 2ZU2A 2BZ6H 1EJNA 1E34B 4NFEA 4CRCA 2R0KA 4GHQA 3NWUA 2GT8A 1QFKH 2BLQA 2BD7A 4AOQA 3UY9A 3QZRA 3PMBB 2G52A 2ZF0H 1GHVH 1XUHA 2Z9GA 5L6NH 3K2UA 1GJDB 4AGKA 1SLWB 1TOMH 3M7UA 2NU1E 1EAUA 1NU9A 3LU9B 1O3LA 1LCYA 1BHXF 4AX9H 1O5CB 3N7OA 2SGAA 1EAXA 1P04A 1T8NA 1CBWC 3I29A 1YKTA 2HNTC 2R3YA 3ZZCA 4K3JA 1SSXA 1TONA 2P93A 3TPIZ 1WCZA 2PUXB 1LO6A 1W14U 1A1RA 1UTOA 2GP9B 1TGBA 1TQ7B 1SGEE 3DUXH 3Q77A 3QTVH 4X1QU 1BT7A 5BPEA 1UK4A 2WYJA 4H6SB 5HYOA 1VR1H 1QRXA 2QV1A 1O2ZA 4ABJA 2OCVB 4WF8A 1KDQB 3SV6A 2A7HA 4U01A 3RXQA 1FY3A 4YO9A 1GGDC 3T29A 3TJOA 1A3BH 6LPRA 1LVMA 1ANCA 1G3BA 2Y5GA 5EPYA 1PFXC 1BMLA 1QJ1B 4TWYA 7KMEH 1YYY1 3NZIA 3URDA 1TOCB 1MCVA 2FXRA 3MYWA 1AVXA 4MDSA 1DLEA 1NTPA 4DT7B 1GBDA 4ZXXH 1GBBA 1W12U 1HJ9A 3LGYA 1CGJE 1QQUA 1QIXB 1FJSA 3I78A 1O3KA 4BAQB 4DCDA 1B0FA 4U32A 5A0AE 2FP7B 1C4U2 4GPGA 1ESTA 4NIVA 3B9FH 3GOVB 1FNIA 1FONA 1GHYH 2M5TA 3U1JB 2Y81A 1P57B 1GG6B 3QX5H 3VB4A 1P09A 1S81A 1C5TA 1YPJH 2FOCA 1V2JT 1D9IA 1GI6A
chains in the Genus database with same CATH superfamily
2BD2A 3SUGA 1KXBA 2Q6GA 3A85A 4SGAE 1BTHH 1K1OA 4I7YH 5FX5A 3U9AH 2IPHA 3UWJH 4D9RA 1WV7H 2YMSC 1NROH 1V2ST 2A5KA 5HXFA 3KCGH 3EA7A 1KIGH 1QB9A 2HRVA 4ACBA 5EXLA 1K9OE 4ABIA 1D3QB 5DP4A 1VJAU 3F9EA 1FAXA 4AB8A 1C1WH 4X1PU 1OPHB 1NO9H 1F7ZA 3EQ0H 2PGBB 3SZEA 1JRSA 4FUDA 1G3EA 1OWIA 1TYNA 2FIRH 2VJ1A 3BEIB 2ZTZA 1FY4A 1GHXH 1H8IH 2A4OA 4ABHA 1J8AA 2ZPRA 1Q2WA 3RP2A 2Y7XA 2ZU4A 3QGNB 2FOAA 2BZAA 3MWIU 1O5BB 1MKWK 3TJUA 1XUFA 2A31A 2ZDLA 3PRDA 2JETB 1DPOA 1NBMD 1AE8H 4RN6A 1SR5C 2WV5A 3R3GB 2BLWA 3ZZBA 2FYRA 4BANB 8KME2 4HG6A 4O3TA 3CS0A 1VKYA 3P6ZB 1O2JA 4HI3A 3PB1E 3SNAA 3MQKC 1AN1E 2BM2A 1FMGA 1XUGA 3RLWH 4INKA 2DUCA 2V3HH 5EQRA 1EZQA 1DY8A 1BHXB 1NZQH 1QQ4A 4K60A 3MI4A 3O8RA 1MTWA 3ATMA 1WQVH 2VVVA 1CT2E 5HM2A 8GCHG 4YOIA 1HLTH 2ZDVH 2ANWA 3A82A 8GCHF 2G51A 1LPZB 4NA9H 4AG2A 1TLDA 1CHGA 2KX4A 1G3DA 2JJ1D 1ID5H 2ZGBH 2QGRA 1C1MA 1EQ9A 5DP6A 3HKJB 1BUIA 4FUEA 1ESAA 3M7TA 2C8WB 6ESTA 4F55A 1BMFD 5E2PA 2VWOA 2ALPA 2ZZUH 1FIWA 2BB4A 1MTUA 1BMNH 2AIQA 1BRBE 1P06A 1SG8B 3AAVA 5C3NA 1H9HE 2ZGXH 3RXJA 1W10U 2R9PA 3BTFE 3ZVEA 1DUEA 3MHWU 3BTHE 3RXAA 2FZZA 1O2PA 2OLGA 4JZ1A 2QF5A 1GMCG 3SHCH 1PQ7A 3GCOA 4Y0YE 1FIZA 1YPHE 1NM6A 2GJGA 1GMCF 5C94A 2JJ2D 1T8MA 1UTKA 1JXPA 3U8OH 1NRSH 2YNBA 5AFZH 3O8CA 1XUIA 1O2SA 3P92A 3SU3A 1OHHD 3RXGA 2G5VA 4DW2U 5JBTA 2BY9X 4H4FA 3FVFB 3TNTA 4NIXA 3TIUA 1TAWA 5JPMH 1F0UA 1K1LA 1T4UH 2Z3DA 4O3UA 3MO6A 2ZFTA 3E0PB 1SQAA 1YCPH 2ZO3H 5KEDA 4Q63A 3VEQB 1WAYB 1OWEA 5E0JA 3SGAE 1HAVA 1IHTH 5GWZA 3Q3XA 4UD9H 3P95A 1V2NT 4WMEA 1BTWA 2UUYA 2OC8A 1TGCA 1AUTC 4TT3D 8ESTE 3UB0A 1C1QA 1HXFH 1UK2A 4XSKU 2XNDD 1WYKA 3A81A 1W0JD 2FI4E 3NKKA 5HM9A 3S7KB 3LKWA 4FUHA 1EPTC 2TPIZ 4Y71A 2BQ6B 2H5DA 1A5GH 3A8DA 1SQOA 2F9OA 1NRPH 1P2QA 3RXCA 1HNEE 2FPZA 1H1BA 1AU8A 4UDWH 2ZPQA 2SGFE 2PKSC 1IHSH 1O3FA 4AORA 1GI4A 2CV3A 2FLRH 1OXGA 3DCLA 3RXKA 1S82A 4CREA 5FHTA 1Q31A 3BF6H 1W0ZU 4WXVA 4I8JA 1BRAA 1QRWA 1SGDE 3IWMA 4YT7H 2BVRH 4CRGA 3K65B 2BD8A 2OUAA 1F5LA 2WHXA 1LPKB 2J98A 1ZPZA 3ZZ9A 1C1TA 2VH0A 2EA3A 5EPNA 1OWDA 3P8GA 1BB0B 2ODQA 1OP8A 5GPIB 1FN8A 2BLVA 1UTNA 5DP8A 1O2WA 2BYAX 3RXMA 4KKDA 2WPJS 3ZZ3A 3ATWA 1SHHB 1E1QD 2G55A 3RXTA 3RLYH 1THSH 4FUIA 1F92A 4OS5A 2ESTE 2ZGCA 1O36A 2G4TA 1N6XA 3DSGA 1L1JA 2ZHQH 1AFEH 1IQHA 3KQEA 4X6OA 1LTOA 2FTMA 4RKJB 1GBEA 1O37A 2GX4A 3SNBA 1BTXA 5TCCA 1C1OA 1E79D 3UQVA 1QB1A 1O3EA 3ZYEA 4I8HA 3M5NA 5L2ZH 1A5IA 2J94A 4E05H 5LPEA 1EOLA 1LKBA 3D62A 1QBVH 4IC6A 3PLPA 1KXAA 1QB6A 4JZDH 4BTIB 2V7QD 4WH6A 1AO5A 1E0FD 2SGDE 4K5ZA 1C9TA 2QC2A 1EP6A 4WXIA 1TNGA 2XXLA 4JCNA 1C5VA 2V3OH 1RRKA 1GBLA 3BG4B 3T26A 1HAVB 1IOEA 2UWOA 2FOMB 1FX0B 3BTDE 1TE0A 2FTLE 4J2YB 3EE7A 4U2WA 2XYAA 1YPKH 2BD4A 1TBRH 3BTWE 5I46H 2B5TB 1ANBA 4FUJA 1K1MA 2VWNA 1O2VA 4Y11E 1ELDE 1ZYOA 3FANA 7ESTE 1M9UA 1NFWA 1Y3YA 4BAMB 2BLOA 1NRQH 1JMOH 4BAHB 3SUDA 5C67A 1W8BH 1B7XB 3H7OA 1OWJA 1YCPM 3K6YA 5IDKA 1W11U 3URCA 3VB7A 1GBIA 3A7YA 2FLBH 2LPRA 5C20A 2CHAB 3V12A 1SLVB 4AFQA 3A8CA 4HGCA 5FL7D 1K2I1 5ETXA 4FUCA 3LGVA 5GXPA 2FS8A 1MKWH 4K1SA 1W7XH 3M5MA 1O3JA 1ELTA 3EGKH 2GDEH 2XTTB 2G5NA 3E1XB 4JZFH 4I32A 1FY1A 2Y5HA 3O8DA 2GCTC 3ZZ5A 1J14A 2VVCA 2FDAA 2J98B 3PRBA 4B71A 1WXRA 3PWCA 2AH4X 4Q7XA 1EJMA 2HOBA 1QY6A 4ACAA 3UIRA 1BTPA 2HPQH 4X2WA 1C1NA 1Z1JA 3B8JA 1IQNA 3QN7A 4Y8ZA 1ARCA 2NU3E 3V3MA 4RT1A 1EB2A 1LHEH 1ZOMA 1LQDB 3FFGA 2IJOB 3UNQA 8LPRA 5L2YH 4NSVA 4D7GA 4XDEA 1OYTH 3E91A 3GDSA 2VWLA 1CT4E 4FU7A 1WUNH 2Z3EA 5HGGA 3SJIA 1C2KA 4MPUA 3MO9A 1UJ1A 3RUOA 1DITH 2Y6TA 2AHME 4B76A 3JZ2B 3RXHA 1IQFA 1AD8H 4A1XA 4ZROA 1GI5A 2J9NA 5ESBA 1MKXK 3HGNA 2V35A 1AI8H 1AZ8A 2SGPE 2IN2A 3NXPA 5ESTE 5JBBS 1MBMA 5EODA 4X6MA 2A45B 1GG6C 1TA6A 2JH5D 2GMTC 1UVSH 1A46H 1G2MA 4X6NA 1L4ZA 4XBBA 1QRZA 3ENSB 4GSOA 4Y79A 2O8WA 3KL6A 3QK1A 5KECA 2HNTE 1P2NA 1P02A 1TNHA 5C1UA 2H9TH 2VIOA 3PYHA 3Q3KA 3E16B 1MU6B 5LH8A 3F68H 4OS2A 2PWXA 2XWBI 1TB6H 3A89A 1B0EA 1HAIH 3E8LA 4K8BA 4THNH 1QBNA 2JDID 1XXFA 3Q3YA 2WPMS 2HVXA 4XOJA 3A7XA 3QTOH 1GDUA 2XC5A 1TPOA 3T25A 3GISB 3E0NB 2F9PA 3BIUH 1UCYE 1UHBB 3LPRA 1DWCH 5GNDA 3GY5A 4DY7B 2JETC 1P05A 2AEIH 1P03A 1O2OA 1NPMA 5DJ7A 2ZP0H 2YNAA 4MQAA 4IW4E 5J4SA 4LZ4B 3MH5A 4ISIH 2TRMA 3SBKA 2DE8A 2HLCA 3C1KA 1AHTH 1ABJH 3OY6U 1AFQC 3SO3A 1YCPK 5CHAC 5HIZA 1OS8A 3SHAH 1CA0B 3QWCH 1B5GH 1GPZA 1KLIH 2F9NA 2TGTA 3GY7A 4K2YA 3K6ZA 5F03A 1MTNC 1QHRB 2O8LA 1CSOE 2P3UB 3SU2A 1V6DA 3WWFA 5JB9S 1GJ4H 1PPCE 1Y3XA 2ZHEH 3F6UH 5DP7A 1W2KH 1K0HA 4UEHH 2XBWA 3ZVCA 4OS1A 3QDZB 4ABAA 4KGAA 1ELCA 2AYWA 1KYNA 5EXNA 4R0IA 1TMUH 1P11E 1OWKA 3PLKA 3SU6A 4B1TA 3AAUA 4BOHA 1QL8A 3F2FA 2GGVB 4NIYA 5E0HA 1SFIA 3MU5A 1RTFB 3VG8A 1GHAG 1OX1A 4GHTA 1O0DH 1GHAF 1HRTH 1ZGVA 1MTVA 3AASA 1KTTB 2QY0B 2PUQH 3M3SA 4MNVA 2KZ4A 3ELAH 4K1TA 2Y80A 2W5EA 4Z1MD 1UTMA 1K1JA 1CO7E 1GBMA 3ZZ7A 1DY9A 1SQTA 2P3TB 1FXYA 2B8OH 1FV9A 2ZCHP 4TY7A 1O5DH 1ZMLA 3FO8D 4H6TA 3F0OA 5G4BA 1ELEE 1GBFA 4YLQH 1FY5A 3EA8A 3RXUA 4FVDA 2C4FH 1VCQA 3H7TA 2PTNA 4INHA 2XC0A 3FKSD 1IQMA 4NSYA 1RTKA 3PM3A 3U69H 3AW1A 4ABBA 1DWDH 2GCTB 1DUAA 1Y5AT 5DK1A 3ZV9A 2BDYA 3PMAB 2SFAA 2XC4A 1LHDH 4RSPA 4BTTB 2SNVA 1AUJA 2W26A 2RCEA 3OY5U 3RC5A 3SQEE 1OP0A 4FOUC 4FU8A 1EXFA 4PROA 3FN8A 2EC9H 1WQSA 4MLFB 4ISOA 2JH6D 2ODPA 3GY6A 4JMYA 5FXLA 3OU0A 2QIQA 1NY22 1SGCA 3GY4A 3C27B 3KYFA 2GTBA 5CHBA 2O9QA 1O2RA 3TK6A 1OSSA 1Y5BT 2A7JA 2J38A 1Y3VA 4M9FA 2KAIB 1BIOA 1C5YB 1TFXA 1L0ZA 1L1GA 1L4DA 3LC5A 3UR6A 2NU4E 1HPGA 1C1PA 3LDXH 1VCWA 2D1JA 4E7RG 1MBQA 3LGIA 4K1EA 1Y3UA 1OOKB 2QCYA 3MNXA 2FOBA 3A83A 1Z6JH 4D76A 1KLTA 1SHYA 1RJXB 3RXPA 1JWTA 5FPYA 1GCTB 1TABE 4X6PA 2PR3A 1ELBA 1KMHB 1LVOA 2A0QB 1HIAA 5FCKA 2XBVA 4MPXA 4TPYA 2H1UA 2ZU3A 2GMTB 2ZI2H 3A88A 3UFAA 1DX5M 1P2JA 3I77A 1ZHMA 1MAXA 3ZV8A 4XBCA 3SNEA 2VU8E 4P02A 5DO4H 5KGOA 2P95A 1ZRBA 3TGKE 1G30B 2BQWB 3DHKH 2XCNA 2PV9B 2VH6A 2BDIA 4IMZA 3ZYDA 3K9XB 1O2XA 1EB1H 2K1QA 5HKKD 2D2DA 2GDDA 1XVMA 1G3CA 4CR9A 3GCNA 4B2AA 4NWKA 2ZU1A 2ZHDA 1RFNA 4OS6A 2AS9A 1O5EH 4X8VH 3EYDA 3SGQE 2NU2E 2H5CA 2TIOA 4AYYB 1MD8A 4Q7YA 4FUFA 3CNRA 4X1NU 1KLJH 1HAOH 4AZ2B 4IN1A 4H42U 5A8XA 5FX6A 4B74A 2RDLA 1ZTJA 2UUJB 1J16A 4Y10E 2F9UA 5EG4A 3SQHE 3ZZ8A 3ZIAD 4A92A 4E7NA 3N99A 1CE5A 4ZCNA 1AFQB 5CHAB 4RT0A 5E2OA 2FOEA 1FZZA 2C8ZB 2QF4A 5H4IB 1AB9B 2ODYB 2FOHA 1PPZA 1MTNB 2B9LA 1MKXH 2Z94A 4DIHH 2J2UA 2RFKC 3VB3A 1O2LA 3ODFA 4FXGH 1GJ7B 2WPIS 3BG4C 2FMJA 1U6QA 3KQCA 4JZIA 1C5MD 1ETSH 4BXSA 4K69A 1OYQA 4O9VA 1BITA 1V2UT 1PPHE 2AMDA 2I6QA 3F2HA 2A1DB 4YOJA 2BOHB 1LPGB 1PYTD 2GKVE 1NRNH 1CQQA 2ZDAH 5F8TA 2CF9H 6GCHG 6GCHF 2H9EH 1A7SA 3MNBA 1UK3A 4HZHA 3F9HA 5LPRA 1E38B 3W95A 1HIAB 2WUCA 1TNIA 5ABWA 1GI1A 2C90B 3LH3A 1BOQA 1KXCA 4XRNA 2H9HA 1ZSKA 3D49H 2JKHA 1F0TA 2ZWLH 2CHAC 2I6SA 2QXIA 2W7SA 1S5SA 1ANEA 2H2ZA 1V3XA 5PTPA 4FUGA 4CRBA 2SNWA 2VIWA 1Z6EA 1HDTH 3SI3H 4MNYA 1D3TB 1GBJA 4I8LA 1O2MA 4I33A 5GJ4B 5DG6A 4WJG2 1SMFE 2GZ8A 5SGAE 3DD2H 5F6MA 1JIMA 5EQSA 3SV2H 4A1VA 1P12E 1E35B 3FOAA 4SGBE 3KQ5A 4YZUA 4ABGA 2J5UA 1XM1A 3ZZAA 1NS3A 3L6PA 1GWAA 3SNCA 1O3CA 5C5OA 5EU8A 5K0HA 1MUEB 4CR5A 1ELAA 1BBRE 2ZDMA 3AVZA 4JK5A 3VXFH 2YOLA 1ZGIA 3BSQA 1GL0E 2BDGA 3KHVA 4Y7AA 1NT1A 4WY3A 1UTJA 2YMSD 1AWFH 2XWAA 2P59A 4ZAEA 2ZGJA 1T8OA 2ZDNA 2F3CE 4FETA 1GVLA 1PPBH 2HLDD 3TVJB 1TNJA 3DFLA 1IQLA 2PHBA 1D6WA 4P00A 3DT0H 3MH6A 2STBE 3QUMP 1C5UA 3RMMH 4YT6H 1KSNA 1MQ6A 2PSXA 1TX7A 1YLDA 1GDQA 1WOFA 3MNSA 4WMFA 3P8FA 3UNSA 4AG1A 3RXFA 4ZMAH 4B2BA 2OK5A 3U8RH 4Z6AH 2J34A 1YGCH 2ZFRH 5C17A 3LGWA 1GCDA 1P2IA 4RI0A 2H6MA 2PSYA 1O31A 3CP7A 5HIYA 4X8SH 1UTPA 4JYTA 3GY2A 1W0KD 5K7RA 2FX4A 2V6NA 1QR3E 1HYLA 4X1RU 3CENA 1SBWA 5DP5A 1PQ8A 2IOTA 3STJA 2P16A 3AW0A 2GZ9A 1QA0A 4XD7D 3P70B 3RXIA 1THRH 1GBAA 1O3MA 2RA3A 3BEFB 4KTCA 5T3HA 4LXBH 5A0BA 4JK6A 2ZA5A 3DSOA 2Q6DA 2F9BH 1HXEH 3QGJA 2W7UA 3DFJA 4YOGA 2FO9A 2QA9E 3A86A 1VZQH 4DG4A 2G00A 1Z8RA 1C5LH 1S6FA 2XBXA 1UVOA 2CMYA 4ZKSU 1P2MA 2OBQA 3T5FH 1GBHA 1BJUA 1QL9A 3WY8A 2BTCE 3QLPH 1CGHA 2AMQA 4IMQA 4VGCB 1BRCE 1ETRH 1Y5UT 2BD5A 4ESTE 3UNRA 3DA9B 1C2GA 3IG6B 5AHGH 1YPEH 1C5NH 1VITH 2BXTH 1QL7A 2BVSH 1A4WH 3A7ZA 2FI5E 1O5AB 5C2ZA 3A87A 4OGYA 1SGRE 4B73A 3T27A 1CA0C 4GCHG 4DIIH 1ZSJA 1O33A 1QJ6B 4GCHF 3PLBA 2A4GA 2Q6FA 1RTLA 1P2KA 2V0BA 3BTQE 2CF8H 1N8OB 1O39A 3GICB 3SV7A 1C4Y2 3NRLA 4XE4A 3TGIE 1EKBB 1HFDA 1T4VH 3SOSA 1MTSA 1LHFH 1AVWA 1C2IA 4TSFD 4DVAU 1LMWB 4FVBA 4AB9A 2P8OB 3R0FA 1XMNB 3RC6A 1FY8E 1O3GA 1QTFA 4ZKRU 2HWLB 3RU4E 1RIWB 2ZHFH 2XBYA 1O30A 4UFDH 3TNSA 4GAWA 1GJBB 4Y76A 4F48B 3TITA 1G36A 3L3TA 4UFFH 2ZU5A 5EJLA 1TRYA 1OP2A 3U1IB 1T7CA 5F8XA 2OC7A 3E3TA 3F3BA 2ZGHA 2VB0A 1ZJKA 1AMHA 1NFUA 2KR7A 2C3SA 4ZUHA 4GLYA 4ABDA 1MCTA 3PO1C 9ESTA 5LGOA 2GZ7A 2PKAA 1HAHH 1V2VT 3S7HB 1P3EA 1GBKA 2QYIA 5EGMA 1AY6H 2Z9JA 4ABFA 1LVBA 5CDFE 2Z9IA 3RXDA 2O8TA 3H09A 4IS5A 1TMTH 3V7TA 2SGQE 3P8NA 3PWBA 1SGTA 1SOZA 2W6JD 4Y8XA 2BD9A 2XW9A 2O8MA 1YLNA 2FOFA 2VBCA 5FBEA 3MTYA 1OKXA 1V2PT 4DT4A 1HAZB 3M3TA 2RG3A 3EA9A 1VITG 3LOXA 4HTCH 3IITA 1K1PA 1VITF 4NWLA 1NESE 1UMAH 2R2MB 1O2HA 3NK8A 5EOKA 3RXSA 1O3BA 2VIDA 1COWD 2WSSD 3OTJE 1DS2E 2OC1A 1Y8TA 4FU9A 3S69A 1S83A 5BRRE 2FS9A 1ESBA 2HVYB 3LC3A 3SYJA 1K21H 2ZQ1A 2ANYA 3GY8A 3MOCA 1XKAC 1O3DA 1PPFE 1C1RA 1MMJN 2ZTXA 2J95A 5AVDA 1ANDA 1D4PB 1GMHG 4MNXA 3UTUH 4HFPB 4A1TA 2BX4A 1GCTC 1GMHF 1PJPA 1PQ5A 2BX3A 3A80A 1QURH 2PFEA 3GDVA 2FX6A 2ZG0H 1SKYE 4LK4A 1CGIE 3OYPA 1O5GH 1A0HB 1AIXH 4NIWA 1TQ0B 2A32A 1C2DA 9LPRA 1TPPA 1TX6A 3HK6B 3TJNA 1FLEE 1HB0B 1WU1A 3RMLH 3SORA 2VNTA 1TPAE 3PV5A 1ORFA 3ESTA 3SJOA 1Z8IB 3TK9A 1DWBH 4FUBA 4TY6A 1A3EH 1RXPA 2VIQA 1AZZA 1UVTH 3Q00A 1DXPA 5FAHA 3SZNA 1AE5A 3PROA 1EZXC 5JBCS 2HPPH 5IYTA 3UUZA 2BOKA 3SI4H 1C2FA 2SGEE 1GMDG 3M3VA 2Z9LA 1Z8GA 1GI2A 1SQRA 2D26C 1QBOA 3LT3A 1GMDF 4B6FA 1G2LA 2OTVA 1V2QT 5I25A 2EI7A 4IC5A 4ZH8A 1A0JA 4D9QA 1Y3WA 2PKAB 4A7IB 1KDQA 1S0RA 1E36B 1EUFA 1AWHB 1O3OA 2Y82A 1CT0E 4DGJA 1BTZA 1ABIH 2ZEBA 1AKSA 1AQ7A 1C2HA 1GDNA 6CHAC 2G81E 1ZR0A 5B6OA 1ETTH 3GCHB 3ZZ6A 2BHGA 3ATIA 5JBAS 4I8GA 5F53A 1F5RA 1DWEH 1AVGH 1EOJA 4CHAC 1ZMJA 2KFWA 3OEED 1AB9C 1HUTH 2L74A 2CK3D 2KCPA 2FODA 3G01A 3ZVFA 1V2OT 3SW2B 4DJZB 3MFJA 1LHCH 2ZKSA 2VGCC 1L1NA 5DP3A 1EJAA 4X0WU 3MU1A 4KTUA 5LPFA 4ZKOU 3M36A 3F9FA 4AYVB 3FP8E 3A84A 2K8IA 1UCYH 1BQYA 1FPHH 1HJ8A 3OFND 1S0QA 3RM2H 1INCA 1GBCA 2XNIA 3LH1A 2P3FH 1C5OH 4MG3A 3SU4A 2UWPA 5DSFA 3MU8A 3KQDA 4B2CA 3SUFA 2AERH 1GHWH 1W0YH 1QCPA 2OC0A 1XUJA 4QT8C 2LNCA 1C2EA 1F0RA 1G37A 4MTBA 3KIDU 3GDUA 3HPTB 4ZHMU 1O2UA 2ZDKA 3PO1B 4BNRA 4MVNA 3BTTE 1O2KA 1D6RA 2B0FA 1BBRK 1L2EA 4I8KA 2ASUB 1Z1IA 2J92A 5A8YA 4K8YA 1FI8A 1IQGA 3LIWA 2RDEA 1TRMA 7LPRA 2HALA 3TH2H 5B6LA 3TH4H 5FPSA 1N6YA 2GVFA 2VVUA 2AGGX 3BEUA 1IQEA 4TWWA 1HAGE 1YPMH 2BQ7B 3E6PH 1O5FH 2C8YB 5JYIA 3F2GA 2WYGA 3LONA 4M7GA 1SGFG 1ZTKA 3P17H 1PYTC 1SGQE 3GCTG 3LGUA 1H8HD 3ITIA 1BTUA 2V3MA 3DSPA 3SJ8A 2GV7A 3GCTF 2UWLA 2TBSA 1Z8JB 4LOYH 5CE1A 2ZIQH 2WPLS 1UVPA 1YLCA 1HJAC 1GI8B 1WBGB 3RU4D 2BDCA 3M37A 1IQIA 2HNTF 3S9BA 1N1LA 1YF4A 1P2OA 3U28C 2W3KA 1UTQA 2O8UA 3UOUA 3MH4A 1AGJA 4B75A 2R0LA 1EZSC 4Y7BA 1AKSB 2L6OA 1NFYA 3PMHB 5EJ1A 1SGNE 1GL1A 5GCHG 2A5IA 2Z7FE 1TA2A 2QF0A 4XBDA 1IAUA 3SU0A 1T32A 2B7DH 4ISLA 5E8EH 5GCHF 1HAYB 3F1SB 3BN9A 4A6LA 4E06H 3BV9B 1RD3B 1SGIB 3PTNA 3VXEH 2QAAA 3KQBA 2GT7A 2A4QA 1PQAA 2R3UA 3VGCB 1KXFA 1SLXB 1P9UA 1ZJDA 3QZQA 3VFEA 2TGDA 1SGFA 1ZTLA 3F9GA 1JBUH 1V2KT 1SL3A 1SGPE 4IGDA 3S9CA 2FYQA 2WINI 3SV8A 1MZAA 1ZPBA 3UQOA 4TYDA 5L30H 1GI9B 2ZHWH 1WTGH 5EW2H 4Q4LA 3GYMA 1ZPCA 2F83A 1EZUC 2WV9A 1LVYA 4NA7A 2ILNA 4Y6DA 1HGTH 4CRAA 2J97A 1C5QA 2NWNA 3B23B 1H9LB 3RMOH 1XKBC 2RA0A 1MZDA 4U30A 1A0LA 4OGXA 2KCYA 2A7CA 5C1XA 3UWIA 2ALVA 2VWMA 1QNJA 3LGTA 3OX7U 2Y7ZA 5DP9A 3M35A 2M2AA 1K1NA 3RDZA 4VGCC 1A2CH 1CU1A 4DOQA 2PP6A 4NFFA 2IJD1 2TGPZ 1DFPA 6CHAB 1SLUB 1BA8B 1DT2A 2A4RA 4D7FA 2OINA 1GVZA 1SI5H 1ZMNA 4MPWA 4CBOA 3RXBA 5EW1H 3BTME 1BCUH 2PW8H 3UOPA 4CHAB 2F9VA 3ZVGA 1G9IE 3L33A 5GDSH 1ELGA 4JZEH 4JYUH 2ZPSA 2EQNA 1N8OC 1ZRKA 1VGCC 3SN8A 3T2NA 1J9CH 2OD3B 4BAKB 2VGCB 1NRRH 1QGFA 1F5KU 1TGSZ 2P8OC 1O2GH 2TGAA 2PTCE 1EASA 1TRNA 2W6ID 2VINA 1P10A 1SPJA 2AIPA 3SU1A 1O3NA 5DN6D 1RIWC 2EI8A 4NCYA 4YESB 5T1VA 2VIVA 3ZVDA 2A2QH 3RXEA 2FI3E 1DICA 1XX9A 1NU7B 1P9SA 1JRTA 1UVUH 1W3CA 2BVXH 2HGTH 2BY8X 4I31A 5A09A 1KTSB 1Y59T 2QF3A 4NA8A 3V13A 2W3IA 3P8OA 5E0GA 3T62A 3VB6A 1XXDA 3RXOA 2A5AA 1QA7A 1V2TT 1MD7A 4INLA 3LJJA 4JYVH 1PPEE 3LJOA 4I86A 1C4V2 1IQJA 3A8BA 5A2MH 1BJVA 2CN0H 3GYLB 2BD3A 1GVKB 1TWXB 1SVPA 2OQ5A 4Q7ZA 5GIBA 3KF2A 3QO6A 1ZHPA 1CBWB 3BTEE 1ELFA 4AGJA 4MPVA 1FDPA 3E90B 1MABB 1O2YA 1YPGH 2AFQB 1S6HA 1C5ZB 1ELVA 1GJAB 1K22H 1V2MT 3BTKE 2ZQ2A 2WUBA 2ZCKP 2KM0A 3FP6E 5T6GA 1XUKA 1J15A 2A2XH 4GVUA 4ABEA 1TX8A 4UONA 4OS7A 3MMGA 4IN2A 1DOJA 2ANKH 3S0NA 3NPSA 3TJVA 5JB8S 1CHOG 1H4WA 1HJAB 1DM4B 1CHOF 2ZC9H 4IBLH 1BMMH 1ARBA 4AC9A 3RU4T 1GGDB 3GS9A 1GHZA 3ZZDA 3A7TA 3SNDA 1BDAA 1BRUP 1TBQH 2P94A 2GCHG 1V2LT 1FN6A 1G32B 1KY9A 2GCHF 4YM9A 3HATH 3ATLA 2CXVA 1CA8B 5C1YA 2BDBA 2AMPA 1BTYA 5A8ZA 1GI0A 1MQ5A 2ZTYA 3M61U 4O97A 1Z71A 2ZFPH 3M7QA 2WV4A 1UCYK 1YPLH 5DPAA 3U8TH 2F4LA 1O35A 2GV6A 2QXJA 2ZFQH 2JIZD 2KCAA 2KCOA 4XFQA 2CJIA 1TMBH 2FESH 4Z0KA 4AFSA 1CVWH 1D3PB 4UFGH 2BY5X 5A0CA 3ZZ4A 1BBRH 4KTSA 4KELA 1H8DH 4X2VA 4BAOB 5C0TA 3U98H 2VIPA 1O34A 2G4UA 1P8VC 3OE7D 5TJXA 2ZNKH 1GBTA 2EI6A 4ZKNU 3D65E 5TCAA 2YMSB 4OM9A 1FUJA 2K0QA 1KXEA 4BXWA 2OP9A 1S84A 1ZLRA 3HKIB 2FEQH 3VPKA 1T8LA 1THPB 3V0XA 4LZ1H 1YC0A 2IPQX 4F49A 4AN7A 1IQKA 5EJZA 1YP9A 4YTAA 3RMNH 1O3PB 1YPHC 1EATA 1V2RT 3NCLA 3PMJA 1EFRD 4J1YA 1FPCH 2R2WU 5EXMA 4CBNA 3GCHC 4CRDA 2BY7X 1V2WT 4ZXYH 1SB1H 1DXWA 1O2QA 1TALA 2BXUH 1EAWA 3SJKA 2FM2A 1C2JA 2WPKS 1GI7B 1GI3A 1VGCB 1O3IA 1C9PA 3NUMA 1S85A 1GJ6A 2ANMH 1EPTA 1GJ5H 1LHGH 2Y5FA 2UUKB 4ZHAA 1DE7H 5DKMA 1NN6A 4OS4A 1W7GH 2QN5T 1WSSH 1HBTH 1C2MA 1GJ8B 2AGIX 3OTPA 2XRCA 1EP5A 4X8UH 1DSUA 3KGPA 1O32A 1C1VH 2PLXA 2THFB 2FOGA 4WVPE 1SC8U 5F8ZA 3A7WA 1HAPH 1Q3XA 2F43B 2QXHA 3M5OA 2ZCLP 4F4OC 1K28D 3D23A 4MNWA 5FCRA 5J4QA 3H5CB 2DE9A 2OXSA 1YM0A 4ASHA 1Z7KA 2AGEX 1DLKB 2ZFSA 1HCGA 3KN2A 4AFZA 2Z3CA 4X8TH 2C8XB 2J4IA 4Y0ZE 2Z9KA 5IK2D 5FPTA 5AFYH 1UHBA 3W94A 3CS7A 1C1UH 2PGQB 1XVOA 1C5RA 1WTHD 4ZHLU 4GUXA 4TPIZ 1MU8B 4ISNA 5EQQA 3EDXB 1TIOA 1O38A 3SGBE 3HK3B 3Q76A 1ZHRA 1EAIA 2WZQA 3EAJA 4NG9H 1P0SH 4Y8YA 4DURA 3BTGE 3MU0A 2UUFB 2NU0E 3FZZA 1J17T 1SGYE 4X2YA 4BTUB 1LKAA 1C5PA 1QZ8A 3EE0B 3TLOA 1P01A 4RKOB 1RGQA 2BMGB 2WPHS 4CH8B 1H9IE 1T31A 1O2IA 1P3CA 3MU4A 1YY3A 1W13U 5DGJA 1PPGE 4D8NA 1TNKA 3KYGA 2XCFA 3TU7H 1VJ9U 2XOKD 3ATKA 1ACBE 1RS0A 1ZSLA 4A5TS 1EX3A 1F0SA 2EEKA 3TH3H 3VGCC 1NBME 1OWHA 4NGAH 2F91A 3FP7E 3SJ9A 3M5LA 1TGNA 2GD4B 1D3DB 2C93B 4B6EA 1FQ3A 4R8TB 1EPTB 3MO3A 3HGPA 1ZZZA 5T6FA 1FAKH 1LDTT 1X7AC 3O8BA 2Z6BD 3OSYA 1BMAA 1TBZH 1VCPA 3UREA 2OBOA 3RXVA 2QXGA 3OEHD 1GJCB 4NZLA 4ISHH 5T6DA 1HV7A 3SU5A 3JZ1B 1C5WB 3F0PA 1K1IA 2PKSB 3VB5A 1BZXE 4X1SU 3RM0H 2CGAA 2ZFFH 5EIYA 1JIRA 7GCHG 2BDAA 1E37B 4UE7H 1C1SA 7GCHF 4O03A 1E1RD 3PTBA 2JH0D 1UTLM 3RC4A 3N7DA 2QE7D 2BY6X 1NC6A 1F2SE 3KNXA 3UPEA 1A61H 5CMXH 1LQEA 4KP0A 1YBWA 4X2XA 3BG8A 4Q2KA 1QJ7B 2EY4C 3KEEA 3MNCA 3ODDA 1O3AA 3A8AA 1O2TA 1DDJA 2OQUA 1HAXB 5AF9H 1UO6A 4AFUA 1JOUB 1DANH 2D8WA 2ZECA 4NZQA 1O3HA 1SFQB 1C5XB 3TK5A 3TGJE 2ULLA 2WPDD 3A7VA 3PV4A 1MAYA 2KAIA 4UFEH 4CH2B 2BDHA 1TGTA 2Q1JA 4Q80A 3ZVBA 1TPSA 1NFXA 3RXLA 3FAOA 1TNLA 5HMAA 1GJ9B 1SOTA 3MH7A 3SUEA 1A5HA 3UR9A 1MH0A 1O2NA 1GHBG 4WWYA 4YLUA 5C5NA 1GHBF 5JDUB 3BIVH 3T28A 4WMDA 1DVAH 3ZVAA 3SV9A 3GY3A 3FZDA 1DSTA 4CRFA 1KXDA 2FWWA 3S9AA 5FBIA 3STIA 1C5SA 3RXRA 4WH8A 2STAE 1C2LA 2G8TA 2ZU2A 2BZ6H 1EJNA 1E34B 4NFEA 4CRCA 2R0KA 3AK5A 4GHQA 3NWUA 2GT8A 1QFKH 2BLQA 2BD7A 4AOQA 3UY9A 3QZRA 3PMBB 2G52A 2ZF0H 1GHVH 1XUHA 2Z9GA 5L6NH 3K2UA 1GJDB 4AGKA 1SLWB 1TOMH 2LP6A 3M7UA 2NU1E 1EAUA 1NU9A 1S6LA 3LU9B 1O3LA 1LCYA 3UAIC 1BHXF 4AX9H 1WDIA 4YXWD 1O5CB 3N7OA 2SGAA 1EAXA 1P04A 1T8NA 1CBWC 3I29A 1YWUA 1YKTA 2HNTC 2R3YA 3ZZCA 4K3JA 1SSXA 1TONA 2P93A 3TPIZ 3W1EA 1WCZA 2PUXB 1LO6A 1W14U 1A1RA 1UTOA 2GP9B 1TGBA 1TQ7B 1SGEE 5C0UA 3DUXH 3Q77A 3QTVH 4X1QU 3N7EA 1BT7A 1H8ED 5BPEA 1UK4A 2WYJA 4H6SB 5HYOA 1VR1H 1QRXA 2QV1A 1O2ZA 4ABJA 2OCVB 4WF8A 1KDQB 3SV6A 2A7HA 4U01A 3RXQA 1FY3A 4YO9A 1GGDC 3T29A 3TJOA 3WW7A 1A3BH 6LPRA 1LVMA 1ANCA 1G3BA 1UW7A 2Y5GA 5EPYA 1PFXC 3WWBA 1BMLA 1QJ1B 4TWYA 7KMEH 1YYY1 3NZIA 3OAAD 3URDA 1TOCB 1MCVA 2FXRA 3MYWA 1AVXA 4MDSA 1DLEA 1NTPA 4DT7B 1GBDA 4ZXXH 1GBBA 1W12U 1HJ9A 3LGYA 1CGJE 1QQUA 1QIXB 4ASUD 1FJSA 3I78A 1O3KA 4BAQB 4DCDA 1B0FA 3PV2A 2LELA 4U32A 5A0AE 2FP7B 1C4U2 4GPGA 1ESTA 4NIVA 3B9FH 3GOVB 1FNIA 1FONA 1GHYH 2M5TA 3U1JB 2Y81A 1P57B 1GG6B 3QX5H 3VB4A 1P09A 1S81A 1C5TA 1YPJH 2FOCA 1V2JT 1D9IA 1GI6A
chains in the Genus database with same CATH topology
2BD2A 3SUGA 1KXBA 2Q6GA 3A85A 4SGAE 1BTHH 1K1OA 4I7YH 5FX5A 3U9AH 2IPHA 3UWJH 4D9RA 1WV7H 1NROH 1V2ST 2A5KA 5HXFA 3KCGH 3EA7A 1KIGH 1QB9A 2HRVA 5EXLA 1K9OE 4ABIA 1D3QB 5DP4A 1VJAU 3F9EA 1FAXA 4AB8A 1C1WH 4X1PU 1OPHB 1NO9H 1F7ZA 3EQ0H 2PGBB 1JRSA 4FUDA 1G3EA 1OWIA 1TYNA 2FIRH 2VJ1A 3BEIB 2ZTZA 1FY4A 1GHXH 1H8IH 2A4OA 4ABHA 1J8AA 2ZPRA 1Q2WA 3RP2A 2Y7XA 2ZU4A 3QGNB 2FOAA 2BZAA 3MWIU 1O5BB 1MKWK 3TJUA 1XUFA 2A31A 2ZDLA 2JETB 1DPOA 1AE8H 4RN6A 1SR5C 2WV5A 3R3GB 2BLWA 3ZZBA 2FYRA 4BANB 8KME2 4O3TA 3CS0A 3P6ZB 1O2JA 4HI3A 3PB1E 3SNAA 1AN1E 2BM2A 1FMGA 1XUGA 3RLWH 4INKA 2DUCA 2V3HH 5EQRA 1EZQA 1DY8A 1BHXB 1NZQH 1QQ4A 4K60A 3MI4A 3O8RA 1MTWA 3ATMA 1WQVH 2VVVA 1CT2E 5HM2A 8GCHG 4YOIA 1HLTH 2ZDVH 2ANWA 3A82A 8GCHF 2G51A 1LPZB 4NA9H 4AG2A 1TLDA 1CHGA 1G3DA 1ID5H 2ZGBH 2QGRA 1C1MA 1EQ9A 5DP6A 3HKJB 1BUIA 4FUEA 1ESAA 3M7TA 2C8WB 6ESTA 5E2PA 2VWOA 2ALPA 2ZZUH 1FIWA 2BB4A 1MTUA 1BMNH 2AIQA 1BRBE 1P06A 1SG8B 3AAVA 5C3NA 1H9HE 2ZGXH 3RXJA 1W10U 2R9PA 3BTFE 3ZVEA 1DUEA 3MHWU 3BTHE 3RXAA 2FZZA 1O2PA 2OLGA 4JZ1A 1GMCG 3SHCH 1PQ7A 3GCOA 4Y0YE 1FIZA 1YPHE 1NM6A 1GMCF 1T8MA 1UTKA 1JXPA 3U8OH 1NRSH 2YNBA 5AFZH 3O8CA 1XUIA 1O2SA 3P92A 3SU3A 3RXGA 4DW2U 2G5VA 5JBTA 2BY9X 4H4FA 3FVFB 3TNTA 4NIXA 3TIUA 1TAWA 5JPMH 1F0UA 1K1LA 1T4UH 2Z3DA 4O3UA 3MO6A 2ZFTA 3E0PB 1SQAA 1YCPH 2ZO3H 3VEQB 1WAYB 1OWEA 5E0JA 3SGAE 1HAVA 1IHTH 5GWZA 3Q3XA 4UD9H 3P95A 1V2NT 4WMEA 1BTWA 2UUYA 2OC8A 1TGCA 1AUTC 8ESTE 1C1QA 1HXFH 1UK2A 4XSKU 1WYKA 3A81A 2FI4E 3NKKA 5HM9A 3S7KB 3LKWA 4FUHA 1EPTC 2TPIZ 4Y71A 2BQ6B 2H5DA 1A5GH 3A8DA 1SQOA 2F9OA 1NRPH 1P2QA 3RXCA 1HNEE 2FPZA 1H1BA 1AU8A 4UDWH 2ZPQA 2SGFE 2PKSC 1IHSH 1O3FA 4AORA 1GI4A 2CV3A 2FLRH 1OXGA 3RXKA 1S82A 4CREA 5FHTA 1Q31A 3BF6H 1W0ZU 4WXVA 4I8JA 1BRAA 1QRWA 1SGDE 3IWMA 4YT7H 2BVRH 4CRGA 3K65B 2BD8A 2OUAA 1F5LA 1LPKB 1ZPZA 3ZZ9A 1C1TA 2VH0A 2EA3A 5EPNA 1OWDA 3P8GA 1BB0B 2ODQA 1OP8A 5GPIB 1FN8A 2BLVA 1UTNA 5DP8A 1O2WA 2BYAX 3RXMA 4KKDA 2WPJS 3ZZ3A 3ATWA 1SHHB 2G55A 3RXTA 3RLYH 1THSH 4FUIA 1F92A 4OS5A 2ESTE 2ZGCA 1O36A 2G4TA 1N6XA 1L1JA 2ZHQH 1AFEH 1IQHA 3KQEA 4X6OA 1LTOA 2FTMA 4RKJB 1GBEA 1O37A 2GX4A 3SNBA 1BTXA 5TCCA 1C1OA 3UQVA 1QB1A 1O3EA 3ZYEA 4I8HA 3M5NA 5L2ZH 1A5IA 2J94A 4E05H 5LPEA 1EOLA 1LKBA 3D62A 1QBVH 4IC6A 3PLPA 1KXAA 1QB6A 4JZDH 4BTIB 4WH6A 1AO5A 1E0FD 2SGDE 4K5ZA 1C9TA 2QC2A 1EP6A 4WXIA 1TNGA 2XXLA 4JCNA 1C5VA 2V3OH 1RRKA 1GBLA 3BG4B 3T26A 1HAVB 1IOEA 2UWOA 2FOMB 3BTDE 1TE0A 2FTLE 4J2YB 4U2WA 2XYAA 1YPKH 2BD4A 1TBRH 3BTWE 5I46H 2B5TB 1ANBA 4FUJA 1K1MA 2VWNA 1O2VA 4Y11E 1ELDE 1ZYOA 3FANA 7ESTE 1M9UA 1NFWA 1Y3YA 4BAMB 2BLOA 1NRQH 1JMOH 4BAHB 3SUDA 5C67A 1W8BH 1B7XB 3H7OA 1OWJA 1YCPM 3K6YA 5IDKA 1W11U 3URCA 3VB7A 1GBIA 3A7YA 2FLBH 2LPRA 5C20A 2CHAB 3V12A 1SLVB 4AFQA 3A8CA 4HGCA 1K2I1 5ETXA 4FUCA 3LGVA 5GXPA 2FS8A 1MKWH 4K1SA 1W7XH 3M5MA 1O3JA 1ELTA 3EGKH 2GDEH 2XTTB 2G5NA 3E1XB 4JZFH 4I32A 1FY1A 2Y5HA 3O8DA 2GCTC 3ZZ5A 1J14A 2VVCA 2FDAA 4B71A 3PWCA 2AH4X 4Q7XA 1EJMA 2HOBA 1QY6A 3UIRA 1BTPA 2HPQH 4X2WA 1C1NA 1Z1JA 3B8JA 1IQNA 3QN7A 4Y8ZA 1ARCA 2NU3E 3V3MA 1EB2A 1LHEH 1ZOMA 1LQDB 3FFGA 2IJOB 3UNQA 8LPRA 5L2YH 4NSVA 4D7GA 4XDEA 1OYTH 3E91A 3GDSA 2VWLA 1CT4E 4FU7A 1WUNH 2Z3EA 5HGGA 3SJIA 1C2KA 4MPUA 3MO9A 1UJ1A 3RUOA 1DITH 2Y6TA 4B76A 3JZ2B 3RXHA 1IQFA 1AD8H 4A1XA 4ZROA 1GI5A 2J9NA 5ESBA 1MKXK 3HGNA 2V35A 1AI8H 1AZ8A 2SGPE 2IN2A 3NXPA 5ESTE 5JBBS 1MBMA 5EODA 4X6MA 2A45B 1GG6C 1TA6A 2JH5D 2GMTC 1UVSH 1A46H 1G2MA 4X6NA 1L4ZA 4XBBA 1QRZA 3ENSB 4GSOA 4Y79A 2O8WA 3KL6A 3QK1A 2HNTE 1P2NA 1P02A 1TNHA 5C1UA 2H9TH 2VIOA 3PYHA 3Q3KA 3E16B 1MU6B 5LH8A 3F68H 4OS2A 2PWXA 2XWBI 1TB6H 3A89A 1B0EA 1HAIH 3E8LA 4K8BA 4THNH 1QBNA 1XXFA 3Q3YA 2WPMS 2HVXA 4XOJA 3A7XA 3QTOH 1GDUA 2XC5A 1TPOA 3T25A 3GISB 3E0NB 2F9PA 3BIUH 1UCYE 1UHBB 3LPRA 1DWCH 3GY5A 4DY7B 2JETC 1P05A 2AEIH 1P03A 1O2OA 1NPMA 5DJ7A 2ZP0H 2YNAA 4MQAA 4IW4E 5J4SA 4LZ4B 3MH5A 4ISIH 2TRMA 3SBKA 2DE8A 2HLCA 3C1KA 1AHTH 1ABJH 3OY6U 1AFQC 3SO3A 1YCPK 5CHAC 1OS8A 3SHAH 1CA0B 3QWCH 1B5GH 1GPZA 1KLIH 2F9NA 2TGTA 3GY7A 4K2YA 3K6ZA 5F03A 1MTNC 1QHRB 2O8LA 1CSOE 2P3UB 3SU2A 1V6DA 5JB9S 1GJ4H 1PPCE 1Y3XA 2ZHEH 3F6UH 5DP7A 1W2KH 4UEHH 2XBWA 3ZVCA 4OS1A 3QDZB 4ABAA 4KGAA 1ELCA 2AYWA 1KYNA 5EXNA 4R0IA 1TMUH 1P11E 1OWKA 3PLKA 3SU6A 4B1TA 3AAUA 4BOHA 1QL8A 2GGVB 4NIYA 5E0HA 1SFIA 3MU5A 1RTFB 1GHAG 1OX1A 4GHTA 1O0DH 1GHAF 1HRTH 1ZGVA 1MTVA 3AASA 1KTTB 2QY0B 2PUQH 3M3SA 4MNVA 3ELAH 4K1TA 2Y80A 2W5EA 1UTMA 1K1JA 1CO7E 1GBMA 3ZZ7A 1DY9A 1SQTA 2P3TB 1FXYA 2B8OH 1FV9A 2ZCHP 4TY7A 1O5DH 1ZMLA 4H6TA 5G4BA 1ELEE 1GBFA 4YLQH 1FY5A 3EA8A 3RXUA 4FVDA 2C4FH 1VCQA 3H7TA 2PTNA 4INHA 2XC0A 1IQMA 4NSYA 1RTKA 3PM3A 3U69H 3AW1A 4ABBA 1DWDH 2GCTB 1DUAA 1Y5AT 5DK1A 3ZV9A 2BDYA 3PMAB 2SFAA 2XC4A 1LHDH 4RSPA 4BTTB 2SNVA 1AUJA 2W26A 2RCEA 3OY5U 3RC5A 3SQEE 1OP0A 4FU8A 1EXFA 4PROA 2EC9H 1WQSA 4MLFB 4ISOA 2JH6D 2ODPA 3GY6A 4JMYA 5FXLA 3OU0A 2QIQA 1NY22 1SGCA 3GY4A 3C27B 2GTBA 2O9QA 1O2RA 3TK6A 1OSSA 1Y5BT 2A7JA 2J38A 1Y3VA 2KAIB 1BIOA 1C5YB 1TFXA 1L0ZA 1L1GA 1L4DA 3LC5A 3UR6A 2NU4E 1HPGA 1C1PA 3LDXH 1VCWA 2D1JA 4E7RG 1MBQA 3LGIA 4K1EA 1Y3UA 1OOKB 2QCYA 3MNXA 2FOBA 3A83A 1Z6JH 4D76A 1KLTA 1SHYA 1RJXB 3RXPA 1JWTA 5FPYA 1GCTB 1TABE 4X6PA 2PR3A 1ELBA 1LVOA 2A0QB 1HIAA 5FCKA 2XBVA 4MPXA 4TPYA 2H1UA 2ZU3A 2GMTB 2ZI2H 3A88A 3UFAA 1DX5M 1P2JA 3I77A 1ZHMA 1MAXA 3ZV8A 4XBCA 3SNEA 2VU8E 5DO4H 2P95A 1ZRBA 3TGKE 1G30B 2BQWB 3DHKH 2XCNA 2PV9B 2VH6A 2BDIA 4IMZA 3ZYDA 3K9XB 1O2XA 1EB1H 2K1QA 2D2DA 2GDDA 1XVMA 1G3CA 4CR9A 3GCNA 4B2AA 4NWKA 2ZU1A 2ZHDA 1RFNA 4OS6A 2AS9A 1O5EH 4X8VH 3EYDA 3SGQE 2NU2E 2H5CA 2TIOA 4AYYB 1MD8A 4Q7YA 4FUFA 4X1NU 1KLJH 1HAOH 4AZ2B 4IN1A 4H42U 5A8XA 5FX6A 4B74A 2RDLA 1ZTJA 2UUJB 1J16A 4Y10E 2F9UA 5EG4A 3SQHE 3ZZ8A 4A92A 4E7NA 1CE5A 1AFQB 5CHAB 5E2OA 2FOEA 1FZZA 2C8ZB 5H4IB 1AB9B 2ODYB 2FOHA 1PPZA 1MTNB 2B9LA 1MKXH 2Z94A 4DIHH 2J2UA 3VB3A 1O2LA 3ODFA 4FXGH 1GJ7B 2WPIS 3BG4C 2FMJA 1U6QA 3KQCA 4JZIA 1C5MD 1ETSH 4BXSA 4K69A 1OYQA 4O9VA 1BITA 1V2UT 1PPHE 2AMDA 2I6QA 2A1DB 4YOJA 2BOHB 1LPGB 1PYTD 2GKVE 1NRNH 1CQQA 2ZDAH 5F8TA 2CF9H 6GCHG 6GCHF 2H9EH 1A7SA 3MNBA 1UK3A 4HZHA 3F9HA 5LPRA 1E38B 3W95A 1HIAB 2WUCA 1TNIA 5ABWA 1GI1A 2C90B 3LH3A 1BOQA 1KXCA 2H9HA 1ZSKA 3D49H 2JKHA 1F0TA 2ZWLH 2CHAC 2I6SA 2QXIA 2W7SA 1S5SA 1ANEA 2H2ZA 1V3XA 5PTPA 4FUGA 4CRBA 2SNWA 2VIWA 1Z6EA 1HDTH 3SI3H 4MNYA 1D3TB 1GBJA 4I8LA 1O2MA 4I33A 5GJ4B 5DG6A 4WJG2 1SMFE 2GZ8A 5SGAE 3DD2H 5F6MA 1JIMA 5EQSA 3SV2H 4A1VA 1P12E 1E35B 4SGBE 4YZUA 4ABGA 1XM1A 3ZZAA 1NS3A 3L6PA 1GWAA 3SNCA 1O3CA 5C5OA 5EU8A 5K0HA 1MUEB 4CR5A 1ELAA 1BBRE 2ZDMA 3AVZA 4JK5A 3VXFH 2YOLA 1ZGIA 3BSQA 1GL0E 2BDGA 3KHVA 4Y7AA 1NT1A 4WY3A 1UTJA 1AWFH 2XWAA 2P59A 4ZAEA 2ZGJA 1T8OA 2ZDNA 2F3CE 1GVLA 1PPBH 3TVJB 1TNJA 3DFLA 1IQLA 2PHBA 1D6WA 3DT0H 3MH6A 2STBE 3QUMP 1C5UA 3RMMH 4YT6H 1KSNA 1MQ6A 2PSXA 1TX7A 1YLDA 1GDQA 1WOFA 3MNSA 4WMFA 3P8FA 3UNSA 4AG1A 3RXFA 4ZMAH 4B2BA 3U8RH 4Z6AH 2J34A 1YGCH 2ZFRH 3LGWA 1GCDA 1P2IA 2H6MA 2PSYA 1O31A 3CP7A 4X8SH 1UTPA 4JYTA 3GY2A 5K7RA 2FX4A 2V6NA 1QR3E 1HYLA 4X1RU 3CENA 1SBWA 5DP5A 1PQ8A 2IOTA 3STJA 2P16A 3AW0A 2GZ9A 1QA0A 3RXIA 3P70B 1THRH 1GBAA 1O3MA 2RA3A 3BEFB 4KTCA 5T3HA 4LXBH 5A0BA 4JK6A 2ZA5A 2Q6DA 2F9BH 1HXEH 3QGJA 2W7UA 3DFJA 4YOGA 2FO9A 2QA9E 3A86A 1VZQH 4DG4A 2G00A 1Z8RA 1C5LH 1S6FA 2XBXA 1UVOA 2CMYA 4ZKSU 1P2MA 2OBQA 3T5FH 1GBHA 1BJUA 1QL9A 3WY8A 2BTCE 3QLPH 1CGHA 2AMQA 4IMQA 4VGCB 1BRCE 1ETRH 1Y5UT 2BD5A 4ESTE 3UNRA 3DA9B 1C2GA 3IG6B 5AHGH 1YPEH 1C5NH 1VITH 2BXTH 1QL7A 2BVSH 1A4WH 3A7ZA 2FI5E 1O5AB 5C2ZA 3A87A 4OGYA 1SGRE 4B73A 3T27A 1CA0C 4GCHG 4DIIH 1ZSJA 1O33A 1QJ6B 4GCHF 3PLBA 2A4GA 2Q6FA 1RTLA 1P2KA 2V0BA 3BTQE 2CF8H 1N8OB 1O39A 3GICB 3SV7A 1C4Y2 4XE4A 3TGIE 1EKBB 1HFDA 1T4VH 3SOSA 1MTSA 1LHFH 1AVWA 1C2IA 4DVAU 1LMWB 4FVBA 4AB9A 2P8OB 3R0FA 1XMNB 3RC6A 1FY8E 1O3GA 1QTFA 4ZKRU 2HWLB 3RU4E 1RIWB 2ZHFH 2XBYA 1O30A 4UFDH 3TNSA 4GAWA 1GJBB 4Y76A 3TITA 1G36A 3L3TA 4UFFH 2ZU5A