5DO6A

Crystal structure of dendroaspis polylepis venom mambalgin-1 t23a mutant
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
LKCYQHGKVVTCHRDMKFCYHNAGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Mambalgin-1
total genus 13
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5do6A00
1RL5A 1KL8A 2NBTA 1LX5B 1NYSA 1LXGA 1CDRA 1COEA 1QKEA 2UWRA 1BXPA 2HLQA 2LCRA 1L4WA 1LJZA 2VLWA 1KFHA 2MJ0A 1IDGA 1REWC 4LFTA 1G6MA 1CXNA 1CCQA 2N99A 4ZQYA 1NYUA 1KBTA 1XT3A 1KBAA 2QJBC 2H7ZA 1QM7A 1S4YA 3KFDE 2X8BB 2BTXA 3HH7A 1KS6A 2H62C 1TGXA 2H64B 1FSSB 1ZADA 2L5SA 1VB0A 1FRAA 1ES7B 4OM5A 1IKCA 2ERAA 2H62D 1NORA 1PLOA 1KXIA 1F94A 3NH7A 2GOOB 3BT2U 3NEQA 1JGKA 1FFJA 1YWHA 2MJ4A 4OM4A 1LSIA 1NTXA 1KTZB 3NDSA 2H8UA 1KBSA 2UX2A 1IQ9A 3U73U 1W6BA 2GOOC 4UY2C 2H5FA 4BIKB 2MUOA 3BT1U 4AEAA 4IYEA 1CTXA 2CDXA 1BTEA 1HAJA 2BHIA 1NXBA 1NEAA 5DO6A 4DO8A 4FAOC 1B41B 1HC9A 2CRTA 1ERAA 1TXBA 5EBXA 2HLRA 1CDQA 1IDLA 2CRSA 1JE9A 4HQPF 2JVEA 2LA1A 1CB9A 4P7UA 4BDTB 1HC9B 6EBXA 1HOYA 2QJAC 4EY8B 1TXAA 2CTXA 1HAAA 5DZ5A 1CODA 1RGJA 3ERAA 1CRFA 1ONJA 1F8UB 5DU1A 2MJYA 1FASA 2CCXA 3FEVA 2ABXA 1KC4A 1NTNA 1FSCA 3EVSC 1DRSA 1CDTA 2MFAA 1KU6B 2H64C 1CVOA 1MAHF 2MHYA 1LXHA 1CHVS 1UG4A 3U74U 1TFSA 1IK8A 2J8BA 1JBDA 1I02A 2L03A 2PJYC 1IDIA 4RUDA 1CDSA 3LAQU 1H0JA 2K3GA 1FF4A 3EBXA 3KFDI 1IDHA 1V6PA 1ABTA 4QTIU 1ERGA 1MR6A 3VTSA 5IMYC 1CREA 1QKDA 2FD6U 4FAOE 4XJJA 2H7ZB 5IMTD 2I9BE 1IJCA 3PLCA 2PJYB 2OFSA 2QJ9C 1M9ZA 2JQPA 2MUPA 1CXOA 2QC1A 3QB4B
chains in the Genus database with same CATH superfamily
1RL5A 1KL8A 2NBTA 1LX5B 1NYSA 1LXGA 1CDRA 1COEA 1QKEA 2UWRA 1BXPA 2HLQA 2LCRA 1L4WA 1LJZA 2VLWA 1KFHA 2MJ0A 1IDGA 1REWC 4LFTA 1G6MA 1CXNA 1CCQA 2N99A 4ZQYA 1NYUA 1KBTA 1XT3A 1KBAA 2QJBC 2H7ZA 1QM7A 1S4YA 3KFDE 2X8BB 2BTXA 3HH7A 1KS6A 2H62C 1TGXA 2H64B 1FSSB 1ZADA 2L5SA 1VB0A 1FRAA 1ES7B 4OM5A 1IKCA 2ERAA 2H62D 1NORA 1PLOA 1KXIA 1F94A 3NH7A 2GOOB 3BT2U 3NEQA 1JGKA 1FFJA 1YWHA 2MJ4A 4OM4A 1LSIA 1NTXA 1KTZB 3NDSA 2H8UA 1KBSA 2UX2A 1IQ9A 3U73U 1W6BA 2GOOC 4UY2C 2H5FA 4BIKB 2MUOA 3BT1U 4AEAA 4IYEA 1CTXA 2CDXA 1BTEA 1HAJA 2BHIA 1NXBA 1NEAA 5DO6A 4DO8A 4FAOC 1B41B 1HC9A 2CRTA 1ERAA 1TXBA 5EBXA 2HLRA 1CDQA 1IDLA 2CRSA 1JE9A 4HQPF 2JVEA 2LA1A 1CB9A 4P7UA 4BDTB 1HC9B 6EBXA 1HOYA 2QJAC 4EY8B 1TXAA 2CTXA 1HAAA 5DZ5A 1CODA 1RGJA 3ERAA 1CRFA 1ONJA 1F8UB 5DU1A 2MJYA 1FASA 2CCXA 3FEVA 2ABXA 1KC4A 1NTNA 1FSCA 3EVSC 1DRSA 1CDTA 2MFAA 1KU6B 2H64C 1CVOA 1MAHF 2MHYA 1LXHA 1CHVS 1UG4A 3U74U 1TFSA 1IK8A 2J8BA 1JBDA 1I02A 2L03A 2PJYC 1IDIA 4RUDA 1CDSA 3LAQU 1H0JA 4KSNA 2K3GA 1FF4A 3EBXA 3KFDI 1IDHA 1V6PA 1ABTA 4QTIU 1ERGA 1MR6A 3VTSA 5IMYC 1CREA 1QKDA 2FD6U 4FAOE 4XJJA 2H7ZB 5IMTD 2I9BE 1IJCA 3PLCA 2PJYB 2OFSA 2QJ9C 1M9ZA 2JQPA 2MUPA 1CXOA 2QC1A 3QB4B
chains in the Genus database with same CATH topology
1RL5A 1KL8A 2NBTA 1LX5B 1NYSA 1LXGA 1CDRA 1COEA 1QKEA 2UWRA 1BXPA 2HLQA 2LCRA 1L4WA 1LJZA 2VLWA 1KFHA 2MJ0A 1IDGA 1REWC 4LFTA 1G6MA 1CXNA 1CCQA 2N99A 4ZQYA 1NYUA 1KBTA 1XT3A 1KBAA 2QJBC 2H7ZA 1QM7A 1S4YA 3KFDE 2X8BB 2BTXA 3HH7A 1KS6A 2H62C 1TGXA 2H64B 1FSSB 1ZADA 2L5SA 1VB0A 1FRAA 1ES7B 4OM5A 1IKCA 2ERAA 2H62D 1NORA 1PLOA 1KXIA 1F94A 3NH7A 2GOOB 3BT2U 3NEQA 1JGKA 1FFJA 1YWHA 2MJ4A 4OM4A 1LSIA 1NTXA 1KTZB 3NDSA 2H8UA 1KBSA 2UX2A 1IQ9A 3U73U 1W6BA 2GOOC 4UY2C 2H5FA 4BIKB 2MUOA 3BT1U 4AEAA 4IYEA 1CTXA 2CDXA 1BTEA 1HAJA 2BHIA 1NXBA 1NEAA 5DO6A 4DO8A 4FAOC 1B41B 1HC9A 2CRTA 1ERAA 1TXBA 5EBXA 2HLRA 1CDQA 1IDLA 2CRSA 1JE9A 4HQPF 2JVEA 2LA1A 1CB9A 4P7UA 4BDTB 1HC9B 6EBXA 1HOYA 2QJAC 4EY8B 1TXAA 2CTXA 1HAAA 5DZ5A 1CODA 1RGJA 3ERAA 1CRFA 1ONJA 1F8UB 5DU1A 2MJYA 1FASA 2CCXA 3FEVA 2ABXA 1KC4A 1NTNA 1FSCA 3EVSC 1DRSA 1CDTA 2MFAA 1KU6B 2H64C 1CVOA 1MAHF 2MHYA 1LXHA 1CHVS 1UG4A 3U74U 1TFSA 1IK8A 2J8BA 1JBDA 1I02A 2L03A 2PJYC 1IDIA 4RUDA 1CDSA 3LAQU 1H0JA 4KSNA 2K3GA 1FF4A 3EBXA 3KFDI 1IDHA 1V6PA 1ABTA 4QTIU 1ERGA 1MR6A 3VTSA 5IMYC 1CREA 1QKDA 2FD6U 4FAOE 4XJJA 2H7ZB 5IMTD 2I9BE 1IJCA 3PLCA 2PJYB 2OFSA 2QJ9C 1M9ZA 2JQPA 2MUPA 1CXOA 2QC1A 3QB4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL5 A;  1KL8 A;  2NBT A;  1LX5 B;  1NYS A;  1LXG A;  1CDR A;  1COE A;  1QKE A;  2UWR A;  1BXP A;  2HLQ A;  2LCR A;  1L4W A;  1LJZ A;  2VLW A;  1KFH A;  2MJ0 A;  1IDG A;  1REW C;  4LFT A;  1G6M A;  1CXN A;  1CCQ A;  2N99 A;  4ZQY A;  1NYU A;  1KBT A;  1XT3 A;  1KBA A;  2QJB C;  2H7Z A;  1QM7 A;  1S4Y A;  3KFD E;  2X8B B;  2BTX A;  3HH7 A;  1KS6 A;  2H62 C;  1TGX A;  2H64 B;  1FSS B;  1ZAD A;  2L5S A;  1VB0 A;  1FRA A;  1ES7 B;  4OM5 A;  1IKC A;  2ERA A;  2H62 D;  1NOR A;  1PLO A;  1KXI A;  1F94 A;  3NH7 A;  2GOO B;  3BT2 U;  3NEQ A;  1JGK A;  1FFJ A;  1YWH A;  2MJ4 A;  4OM4 A;  1LSI A;  1NTX A;  1KTZ B;  3NDS A;  2H8U A;  1KBS A;  2UX2 A;  1IQ9 A;  3U73 U;  1W6B A;  2GOO C;  4UY2 C;  2H5F A;  4BIK B;  2MUO A;  3BT1 U;  4AEA A;  4IYE A;  1CTX A;  2CDX A;  1BTE A;  1HAJ A;  2BHI A;  1NXB A;  1NEA A;  5DO6 A;  4DO8 A;  4FAO C;  1B41 B;  1HC9 A;  2CRT A;  1ERA A;  1TXB A;  5EBX A;  2HLR A;  1CDQ A;  1IDL A;  2CRS A;  1JE9 A;  4HQP F;  2JVE A;  2LA1 A;  1CB9 A;  4P7U A;  4BDT B;  1HC9 B;  6EBX A;  1HOY A;  2QJA C;  4EY8 B;  1TXA A;  2CTX A;  1HAA A;  5DZ5 A;  1COD A;  1RGJ A;  3ERA A;  1CRF A;  1ONJ A;  1F8U B;  5DU1 A;  2MJY A;  1FAS A;  2CCX A;  3FEV A;  2ABX A;  1KC4 A;  1NTN A;  1FSC A;  3EVS C;  1DRS A;  1CDT A;  2MFA A;  1KU6 B;  2H64 C;  1CVO A;  1MAH F;  2MHY A;  1LXH A;  1CHV S;  1UG4 A;  3U74 U;  1TFS A;  1IK8 A;  2J8B A;  1JBD A;  1I02 A;  2L03 A;  2PJY C;  1IDI A;  4RUD A;  1CDS A;  3LAQ U;  1H0J A;  2K3G A;  1FF4 A;  3EBX A;  3KFD I;  1IDH A;  1V6P A;  1ABT A;  4QTI U;  1ERG A;  1MR6 A;  3VTS A;  5IMY C;  1CRE A;  1QKD A;  2FD6 U;  4FAO E;  4XJJ A;  2H7Z B;  5IMT D;  2I9B E;  1IJC A;  3PLC A;  2PJY B;  2OFS A;  2QJ9 C;  1M9Z A;  2JQP A;  2MUP A;  1CXO A;  2QC1 A;  3QB4 B; 
#chains in the Genus database with same CATH topology
 1RL5 A;  1KL8 A;  2NBT A;  1LX5 B;  1NYS A;  1LXG A;  1CDR A;  1COE A;  1QKE A;  2UWR A;  1BXP A;  2HLQ A;  2LCR A;  1L4W A;  1LJZ A;  2VLW A;  1KFH A;  2MJ0 A;  1IDG A;  1REW C;  4LFT A;  1G6M A;  1CXN A;  1CCQ A;  2N99 A;  4ZQY A;  1NYU A;  1KBT A;  1XT3 A;  1KBA A;  2QJB C;  2H7Z A;  1QM7 A;  1S4Y A;  3KFD E;  2X8B B;  2BTX A;  3HH7 A;  1KS6 A;  2H62 C;  1TGX A;  2H64 B;  1FSS B;  1ZAD A;  2L5S A;  1VB0 A;  1FRA A;  1ES7 B;  4OM5 A;  1IKC A;  2ERA A;  2H62 D;  1NOR A;  1PLO A;  1KXI A;  1F94 A;  3NH7 A;  2GOO B;  3BT2 U;  3NEQ A;  1JGK A;  1FFJ A;  1YWH A;  2MJ4 A;  4OM4 A;  1LSI A;  1NTX A;  1KTZ B;  3NDS A;  2H8U A;  1KBS A;  2UX2 A;  1IQ9 A;  3U73 U;  1W6B A;  2GOO C;  4UY2 C;  2H5F A;  4BIK B;  2MUO A;  3BT1 U;  4AEA A;  4IYE A;  1CTX A;  2CDX A;  1BTE A;  1HAJ A;  2BHI A;  1NXB A;  1NEA A;  5DO6 A;  4DO8 A;  4FAO C;  1B41 B;  1HC9 A;  2CRT A;  1ERA A;  1TXB A;  5EBX A;  2HLR A;  1CDQ A;  1IDL A;  2CRS A;  1JE9 A;  4HQP F;  2JVE A;  2LA1 A;  1CB9 A;  4P7U A;  4BDT B;  1HC9 B;  6EBX A;  1HOY A;  2QJA C;  4EY8 B;  1TXA A;  2CTX A;  1HAA A;  5DZ5 A;  1COD A;  1RGJ A;  3ERA A;  1CRF A;  1ONJ A;  1F8U B;  5DU1 A;  2MJY A;  1FAS A;  2CCX A;  3FEV A;  2ABX A;  1KC4 A;  1NTN A;  1FSC A;  3EVS C;  1DRS A;  1CDT A;  2MFA A;  1KU6 B;  2H64 C;  1CVO A;  1MAH F;  2MHY A;  1LXH A;  1CHV S;  1UG4 A;  3U74 U;  1TFS A;  1IK8 A;  2J8B A;  1JBD A;  1I02 A;  2L03 A;  2PJY C;  1IDI A;  4RUD A;  1CDS A;  3LAQ U;  1H0J A;  4KSN A;  2K3G A;  1FF4 A;  3EBX A;  3KFD I;  1IDH A;  1V6P A;  1ABT A;  4QTI U;  1ERG A;  1MR6 A;  3VTS A;  5IMY C;  1CRE A;  1QKD A;  2FD6 U;  4FAO E;  4XJJ A;  2H7Z B;  5IMT D;  2I9B E;  1IJC A;  3PLC A;  2PJY B;  2OFS A;  2QJ9 C;  1M9Z A;  2JQP A;  2MUP A;  1CXO A;  2QC1 A;  3QB4 B; 
#chains in the Genus database with same CATH homology
 1RL5 A;  1KL8 A;  2NBT A;  1LX5 B;  1NYS A;  1LXG A;  1CDR A;  1COE A;  1QKE A;  2UWR A;  1BXP A;  2HLQ A;  2LCR A;  1L4W A;  1LJZ A;  2VLW A;  1KFH A;  2MJ0 A;  1IDG A;  1REW C;  4LFT A;  1G6M A;  1CXN A;  1CCQ A;  2N99 A;  4ZQY A;  1NYU A;  1KBT A;  1XT3 A;  1KBA A;  2QJB C;  2H7Z A;  1QM7 A;  1S4Y A;  3KFD E;  2X8B B;  2BTX A;  3HH7 A;  1KS6 A;  2H62 C;  1TGX A;  2H64 B;  1FSS B;  1ZAD A;  2L5S A;  1VB0 A;  1FRA A;  1ES7 B;  4OM5 A;  1IKC A;  2ERA A;  2H62 D;  1NOR A;  1PLO A;  1KXI A;  1F94 A;  3NH7 A;  2GOO B;  3BT2 U;  3NEQ A;  1JGK A;  1FFJ A;  1YWH A;  2MJ4 A;  4OM4 A;  1LSI A;  1NTX A;  1KTZ B;  3NDS A;  2H8U A;  1KBS A;  2UX2 A;  1IQ9 A;  3U73 U;  1W6B A;  2GOO C;  4UY2 C;  2H5F A;  4BIK B;  2MUO A;  3BT1 U;  4AEA A;  4IYE A;  1CTX A;  2CDX A;  1BTE A;  1HAJ A;  2BHI A;  1NXB A;  1NEA A;  5DO6 A;  4DO8 A;  4FAO C;  1B41 B;  1HC9 A;  2CRT A;  1ERA A;  1TXB A;  5EBX A;  2HLR A;  1CDQ A;  1IDL A;  2CRS A;  1JE9 A;  4HQP F;  2JVE A;  2LA1 A;  1CB9 A;  4P7U A;  4BDT B;  1HC9 B;  6EBX A;  1HOY A;  2QJA C;  4EY8 B;  1TXA A;  2CTX A;  1HAA A;  5DZ5 A;  1COD A;  1RGJ A;  3ERA A;  1CRF A;  1ONJ A;  1F8U B;  5DU1 A;  2MJY A;  1FAS A;  2CCX A;  3FEV A;  2ABX A;  1KC4 A;  1NTN A;  1FSC A;  3EVS C;  1DRS A;  1CDT A;  2MFA A;  1KU6 B;  2H64 C;  1CVO A;  1MAH F;  2MHY A;  1LXH A;  1CHV S;  1UG4 A;  3U74 U;  1TFS A;  1IK8 A;  2J8B A;  1JBD A;  1I02 A;  2L03 A;  2PJY C;  1IDI A;  4RUD A;  1CDS A;  3LAQ U;  1H0J A;  4KSN A;  2K3G A;  1FF4 A;  3EBX A;  3KFD I;  1IDH A;  1V6P A;  1ABT A;  4QTI U;  1ERG A;  1MR6 A;  3VTS A;  5IMY C;  1CRE A;  1QKD A;  2FD6 U;  4FAO E;  4XJJ A;  2H7Z B;  5IMT D;  2I9B E;  1IJC A;  3PLC A;  2PJY B;  2OFS A;  2QJ9 C;  1M9Z A;  2JQP A;  2MUP A;  1CXO A;  2QC1 A;  3QB4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...