5DU1A

Crystal structure of dendroaspis polylepis mambalgin-1 wild-type in p21 space group.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Mambalgin-1
total genus 12
structure length 57
sequence length 57
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5du1A00
2H62C 2L03A 4FAOE 4OM5A 4FAOC 2BHIA 2H8UA 1HAJA 1JGKA 1CRFA 1KU6B 4OM4A 1NEAA 3BT1U 1TXBA 1ZADA 1UG4A 2QC1A 2CRSA 1ES7B 3LAQU 1ERAA 1CXNA 1IDGA 2OFSA 1CCQA 4IYEA 4AEAA 1TXAA 3KFDE 2K3GA 2QJAC 1IDLA 3NDSA 2QJ9C 5IMYC 4EY8B 2MUOA 2PJYC 1IK8A 2NBTA 1RL5A 2LCRA 1CHVS 2HLRA 4QTIU 2CRTA 1M9ZA 1IJCA 5DU1A 1HOYA 3VTSA 2VLWA 2HLQA 1JBDA 1QKDA 1MR6A 2QJBC 3QB4B 1IQ9A 1S4YA 1BTEA 3BT2U 1BXPA 2FD6U 1NTXA 3U74U 4HQPF 4BIKB 1B41B 1REWC 2GOOC 1KL8A 1V6PA 1PLOA 2PJYB 1CDQA 1LSIA 1KXIA 1CDRA 2MUPA 1COEA 5DZ5A 2MJ0A 2L5SA 1ONJA 2MJ4A 4DO8A 1KS6A 1FSCA 1H0JA 1W6BA 2MHYA 2ABXA 1ABTA 1FASA 1TFSA 2X8BB 3HH7A 1LJZA 1TGXA 1XT3A 1IKCA 3ERAA 1G6MA 4UY2C 2MJYA 3FEVA 2ERAA 1CDSA 1NYSA 2N99A 2GOOB 1KTZB 1LX5B 2MFAA 5DO6A 1CVOA 1QKEA 1KBTA 1VB0A 2J8BA 2CTXA 2JQPA 1I02A 1NTNA 1NORA 3NH7A 1JE9A 1FRAA 4XJJA 2H64B 3PLCA 1HC9B 1FSSB 1FFJA 2I9BE 2UWRA 1FF4A 1HAAA 2JVEA 2LA1A 3EVSC 4LFTA 5IMTD 1KBAA 2CCXA 2BTXA 1F94A 1F8UB 2UX2A 1KC4A 1MAHF 1HC9A 1IDIA 6EBXA 3NEQA 1ERGA 1KFHA 1YWHA 1CODA 1CB9A 1CTXA 2H7ZA 4RUDA 1LXGA 1RGJA 1NXBA 4ZQYA 2H5FA 4BDTB 1NYUA 2H62D 1L4WA 1DRSA 2H7ZB 3U73U 1CREA 1CDTA 1QM7A 1LXHA 2H64C 3KFDI 4P7UA 5EBXA 1IDHA 1CXOA 3EBXA 2CDXA 1KBSA
chains in the Genus database with same CATH superfamily
2H62C 2L03A 4FAOE 4OM5A 4FAOC 2BHIA 2H8UA 1HAJA 1JGKA 1CRFA 1KU6B 4OM4A 1NEAA 3BT1U 1TXBA 1ZADA 1UG4A 2QC1A 2CRSA 1ES7B 3LAQU 1ERAA 1CXNA 1IDGA 2OFSA 1CCQA 4IYEA 4AEAA 1TXAA 3KFDE 2K3GA 2QJAC 1IDLA 3NDSA 2QJ9C 5IMYC 4EY8B 2MUOA 2PJYC 1IK8A 2NBTA 1RL5A 2LCRA 1CHVS 2HLRA 4QTIU 2CRTA 1M9ZA 1IJCA 5DU1A 1HOYA 3VTSA 2VLWA 2HLQA 1JBDA 1QKDA 1MR6A 2QJBC 3QB4B 1IQ9A 1S4YA 1BTEA 3BT2U 1BXPA 2FD6U 1NTXA 3U74U 4HQPF 4BIKB 1B41B 1REWC 2GOOC 4KSNA 1KL8A 1V6PA 1PLOA 2PJYB 1CDQA 1LSIA 1KXIA 1CDRA 2MUPA 1COEA 5DZ5A 2MJ0A 2L5SA 1ONJA 2MJ4A 4DO8A 1KS6A 1FSCA 1H0JA 1W6BA 2MHYA 2ABXA 1ABTA 1FASA 1TFSA 2X8BB 3HH7A 1LJZA 1TGXA 1XT3A 1IKCA 3ERAA 1G6MA 4UY2C 2MJYA 3FEVA 2ERAA 1CDSA 1NYSA 2N99A 2GOOB 1KTZB 1LX5B 2MFAA 5DO6A 1CVOA 1QKEA 1KBTA 1VB0A 2J8BA 2CTXA 2JQPA 1I02A 1NTNA 1NORA 3NH7A 1JE9A 1FRAA 4XJJA 2H64B 3PLCA 1HC9B 1FSSB 1FFJA 2I9BE 2UWRA 1FF4A 1HAAA 2JVEA 2LA1A 3EVSC 4LFTA 5IMTD 1KBAA 2CCXA 2BTXA 1F94A 1F8UB 2UX2A 1KC4A 1MAHF 1HC9A 1IDIA 6EBXA 3NEQA 1ERGA 1KFHA 1YWHA 1CODA 1CB9A 1CTXA 2H7ZA 4RUDA 1LXGA 1RGJA 1NXBA 4ZQYA 2H5FA 4BDTB 1NYUA 2H62D 1L4WA 1DRSA 2H7ZB 3U73U 1CREA 1CDTA 1QM7A 1LXHA 2H64C 3KFDI 4P7UA 5EBXA 1IDHA 1CXOA 3EBXA 2CDXA 1KBSA
chains in the Genus database with same CATH topology
2H62C 2L03A 4FAOE 4OM5A 4FAOC 2BHIA 2H8UA 1HAJA 1JGKA 1CRFA 1KU6B 4OM4A 1NEAA 3BT1U 1TXBA 1ZADA 1UG4A 2QC1A 2CRSA 1ES7B 3LAQU 1ERAA 1CXNA 1IDGA 2OFSA 1CCQA 4IYEA 4AEAA 1TXAA 3KFDE 2K3GA 2QJAC 1IDLA 3NDSA 2QJ9C 5IMYC 4EY8B 2MUOA 2PJYC 1IK8A 2NBTA 1RL5A 2LCRA 1CHVS 2HLRA 4QTIU 2CRTA 1M9ZA 1IJCA 5DU1A 1HOYA 3VTSA 2VLWA 2HLQA 1JBDA 1QKDA 1MR6A 2QJBC 3QB4B 1IQ9A 1S4YA 1BTEA 3BT2U 1BXPA 2FD6U 1NTXA 3U74U 4HQPF 4BIKB 1B41B 1REWC 2GOOC 4KSNA 1KL8A 1V6PA 1PLOA 2PJYB 1CDQA 1LSIA 1KXIA 1CDRA 2MUPA 1COEA 5DZ5A 2MJ0A 2L5SA 1ONJA 2MJ4A 4DO8A 1KS6A 1FSCA 1H0JA 1W6BA 2MHYA 2ABXA 1ABTA 1FASA 1TFSA 2X8BB 3HH7A 1LJZA 1TGXA 1XT3A 1IKCA 3ERAA 1G6MA 4UY2C 2MJYA 3FEVA 2ERAA 1CDSA 1NYSA 2N99A 2GOOB 1KTZB 1LX5B 2MFAA 5DO6A 1CVOA 1QKEA 1KBTA 1VB0A 2J8BA 2CTXA 2JQPA 1I02A 1NTNA 1NORA 3NH7A 1JE9A 1FRAA 4XJJA 2H64B 3PLCA 1HC9B 1FSSB 1FFJA 2I9BE 2UWRA 1FF4A 1HAAA 2JVEA 2LA1A 3EVSC 4LFTA 5IMTD 1KBAA 2CCXA 2BTXA 1F94A 1F8UB 2UX2A 1KC4A 1MAHF 1HC9A 1IDIA 6EBXA 3NEQA 1ERGA 1KFHA 1YWHA 1CODA 1CB9A 1CTXA 2H7ZA 4RUDA 1LXGA 1RGJA 1NXBA 4ZQYA 2H5FA 4BDTB 1NYUA 2H62D 1L4WA 1DRSA 2H7ZB 3U73U 1CREA 1CDTA 1QM7A 1LXHA 2H64C 3KFDI 4P7UA 5EBXA 1IDHA 1CXOA 3EBXA 2CDXA 1KBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H62 C;  2L03 A;  4FAO E;  4OM5 A;  4FAO C;  2BHI A;  2H8U A;  1HAJ A;  1JGK A;  1CRF A;  1KU6 B;  4OM4 A;  1NEA A;  3BT1 U;  1TXB A;  1ZAD A;  1UG4 A;  2QC1 A;  2CRS A;  1ES7 B;  3LAQ U;  1ERA A;  1CXN A;  1IDG A;  2OFS A;  1CCQ A;  4IYE A;  4AEA A;  1TXA A;  3KFD E;  2K3G A;  2QJA C;  1IDL A;  3NDS A;  2QJ9 C;  5IMY C;  4EY8 B;  2MUO A;  2PJY C;  1IK8 A;  2NBT A;  1RL5 A;  2LCR A;  1CHV S;  2HLR A;  4QTI U;  2CRT A;  1M9Z A;  1IJC A;  5DU1 A;  1HOY A;  3VTS A;  2VLW A;  2HLQ A;  1JBD A;  1QKD A;  1MR6 A;  2QJB C;  3QB4 B;  1IQ9 A;  1S4Y A;  1BTE A;  3BT2 U;  1BXP A;  2FD6 U;  1NTX A;  3U74 U;  4HQP F;  4BIK B;  1B41 B;  1REW C;  2GOO C;  1KL8 A;  1V6P A;  1PLO A;  2PJY B;  1CDQ A;  1LSI A;  1KXI A;  1CDR A;  2MUP A;  1COE A;  5DZ5 A;  2MJ0 A;  2L5S A;  1ONJ A;  2MJ4 A;  4DO8 A;  1KS6 A;  1FSC A;  1H0J A;  1W6B A;  2MHY A;  2ABX A;  1ABT A;  1FAS A;  1TFS A;  2X8B B;  3HH7 A;  1LJZ A;  1TGX A;  1XT3 A;  1IKC A;  3ERA A;  1G6M A;  4UY2 C;  2MJY A;  3FEV A;  2ERA A;  1CDS A;  1NYS A;  2N99 A;  2GOO B;  1KTZ B;  1LX5 B;  2MFA A;  5DO6 A;  1CVO A;  1QKE A;  1KBT A;  1VB0 A;  2J8B A;  2CTX A;  2JQP A;  1I02 A;  1NTN A;  1NOR A;  3NH7 A;  1JE9 A;  1FRA A;  4XJJ A;  2H64 B;  3PLC A;  1HC9 B;  1FSS B;  1FFJ A;  2I9B E;  2UWR A;  1FF4 A;  1HAA A;  2JVE A;  2LA1 A;  3EVS C;  4LFT A;  5IMT D;  1KBA A;  2CCX A;  2BTX A;  1F94 A;  1F8U B;  2UX2 A;  1KC4 A;  1MAH F;  1HC9 A;  1IDI A;  6EBX A;  3NEQ A;  1ERG A;  1KFH A;  1YWH A;  1COD A;  1CB9 A;  1CTX A;  2H7Z A;  4RUD A;  1LXG A;  1RGJ A;  1NXB A;  4ZQY A;  2H5F A;  4BDT B;  1NYU A;  2H62 D;  1L4W A;  1DRS A;  2H7Z B;  3U73 U;  1CRE A;  1CDT A;  1QM7 A;  1LXH A;  2H64 C;  3KFD I;  4P7U A;  5EBX A;  1IDH A;  1CXO A;  3EBX A;  2CDX A;  1KBS A; 
#chains in the Genus database with same CATH topology
 2H62 C;  2L03 A;  4FAO E;  4OM5 A;  4FAO C;  2BHI A;  2H8U A;  1HAJ A;  1JGK A;  1CRF A;  1KU6 B;  4OM4 A;  1NEA A;  3BT1 U;  1TXB A;  1ZAD A;  1UG4 A;  2QC1 A;  2CRS A;  1ES7 B;  3LAQ U;  1ERA A;  1CXN A;  1IDG A;  2OFS A;  1CCQ A;  4IYE A;  4AEA A;  1TXA A;  3KFD E;  2K3G A;  2QJA C;  1IDL A;  3NDS A;  2QJ9 C;  5IMY C;  4EY8 B;  2MUO A;  2PJY C;  1IK8 A;  2NBT A;  1RL5 A;  2LCR A;  1CHV S;  2HLR A;  4QTI U;  2CRT A;  1M9Z A;  1IJC A;  5DU1 A;  1HOY A;  3VTS A;  2VLW A;  2HLQ A;  1JBD A;  1QKD A;  1MR6 A;  2QJB C;  3QB4 B;  1IQ9 A;  1S4Y A;  1BTE A;  3BT2 U;  1BXP A;  2FD6 U;  1NTX A;  3U74 U;  4HQP F;  4BIK B;  1B41 B;  1REW C;  2GOO C;  4KSN A;  1KL8 A;  1V6P A;  1PLO A;  2PJY B;  1CDQ A;  1LSI A;  1KXI A;  1CDR A;  2MUP A;  1COE A;  5DZ5 A;  2MJ0 A;  2L5S A;  1ONJ A;  2MJ4 A;  4DO8 A;  1KS6 A;  1FSC A;  1H0J A;  1W6B A;  2MHY A;  2ABX A;  1ABT A;  1FAS A;  1TFS A;  2X8B B;  3HH7 A;  1LJZ A;  1TGX A;  1XT3 A;  1IKC A;  3ERA A;  1G6M A;  4UY2 C;  2MJY A;  3FEV A;  2ERA A;  1CDS A;  1NYS A;  2N99 A;  2GOO B;  1KTZ B;  1LX5 B;  2MFA A;  5DO6 A;  1CVO A;  1QKE A;  1KBT A;  1VB0 A;  2J8B A;  2CTX A;  2JQP A;  1I02 A;  1NTN A;  1NOR A;  3NH7 A;  1JE9 A;  1FRA A;  4XJJ A;  2H64 B;  3PLC A;  1HC9 B;  1FSS B;  1FFJ A;  2I9B E;  2UWR A;  1FF4 A;  1HAA A;  2JVE A;  2LA1 A;  3EVS C;  4LFT A;  5IMT D;  1KBA A;  2CCX A;  2BTX A;  1F94 A;  1F8U B;  2UX2 A;  1KC4 A;  1MAH F;  1HC9 A;  1IDI A;  6EBX A;  3NEQ A;  1ERG A;  1KFH A;  1YWH A;  1COD A;  1CB9 A;  1CTX A;  2H7Z A;  4RUD A;  1LXG A;  1RGJ A;  1NXB A;  4ZQY A;  2H5F A;  4BDT B;  1NYU A;  2H62 D;  1L4W A;  1DRS A;  2H7Z B;  3U73 U;  1CRE A;  1CDT A;  1QM7 A;  1LXH A;  2H64 C;  3KFD I;  4P7U A;  5EBX A;  1IDH A;  1CXO A;  3EBX A;  2CDX A;  1KBS A; 
#chains in the Genus database with same CATH homology
 2H62 C;  2L03 A;  4FAO E;  4OM5 A;  4FAO C;  2BHI A;  2H8U A;  1HAJ A;  1JGK A;  1CRF A;  1KU6 B;  4OM4 A;  1NEA A;  3BT1 U;  1TXB A;  1ZAD A;  1UG4 A;  2QC1 A;  2CRS A;  1ES7 B;  3LAQ U;  1ERA A;  1CXN A;  1IDG A;  2OFS A;  1CCQ A;  4IYE A;  4AEA A;  1TXA A;  3KFD E;  2K3G A;  2QJA C;  1IDL A;  3NDS A;  2QJ9 C;  5IMY C;  4EY8 B;  2MUO A;  2PJY C;  1IK8 A;  2NBT A;  1RL5 A;  2LCR A;  1CHV S;  2HLR A;  4QTI U;  2CRT A;  1M9Z A;  1IJC A;  5DU1 A;  1HOY A;  3VTS A;  2VLW A;  2HLQ A;  1JBD A;  1QKD A;  1MR6 A;  2QJB C;  3QB4 B;  1IQ9 A;  1S4Y A;  1BTE A;  3BT2 U;  1BXP A;  2FD6 U;  1NTX A;  3U74 U;  4HQP F;  4BIK B;  1B41 B;  1REW C;  2GOO C;  4KSN A;  1KL8 A;  1V6P A;  1PLO A;  2PJY B;  1CDQ A;  1LSI A;  1KXI A;  1CDR A;  2MUP A;  1COE A;  5DZ5 A;  2MJ0 A;  2L5S A;  1ONJ A;  2MJ4 A;  4DO8 A;  1KS6 A;  1FSC A;  1H0J A;  1W6B A;  2MHY A;  2ABX A;  1ABT A;  1FAS A;  1TFS A;  2X8B B;  3HH7 A;  1LJZ A;  1TGX A;  1XT3 A;  1IKC A;  3ERA A;  1G6M A;  4UY2 C;  2MJY A;  3FEV A;  2ERA A;  1CDS A;  1NYS A;  2N99 A;  2GOO B;  1KTZ B;  1LX5 B;  2MFA A;  5DO6 A;  1CVO A;  1QKE A;  1KBT A;  1VB0 A;  2J8B A;  2CTX A;  2JQP A;  1I02 A;  1NTN A;  1NOR A;  3NH7 A;  1JE9 A;  1FRA A;  4XJJ A;  2H64 B;  3PLC A;  1HC9 B;  1FSS B;  1FFJ A;  2I9B E;  2UWR A;  1FF4 A;  1HAA A;  2JVE A;  2LA1 A;  3EVS C;  4LFT A;  5IMT D;  1KBA A;  2CCX A;  2BTX A;  1F94 A;  1F8U B;  2UX2 A;  1KC4 A;  1MAH F;  1HC9 A;  1IDI A;  6EBX A;  3NEQ A;  1ERG A;  1KFH A;  1YWH A;  1COD A;  1CB9 A;  1CTX A;  2H7Z A;  4RUD A;  1LXG A;  1RGJ A;  1NXB A;  4ZQY A;  2H5F A;  4BDT B;  1NYU A;  2H62 D;  1L4W A;  1DRS A;  2H7Z B;  3U73 U;  1CRE A;  1CDT A;  1QM7 A;  1LXH A;  2H64 C;  3KFD I;  4P7U A;  5EBX A;  1IDH A;  1CXO A;  3EBX A;  2CDX A;  1KBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...