5E3QA

Crystal strcuture of dapd in complex with succinyl-coa from corynebacterium glutamicum
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
286
structure length
278
Chain Sequence
TTASATGIATLTSTGDVLDVWYPEIGSTDQSALTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRPHTINLDGIFGLLNNVVWTNFGPCAVDGFALTRARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGASIMGVISLGKRCLLGANSGCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAGSNGLIFRRDSVSGQVVAVPNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Biochemical Characterization of Tetrahydrodipicolinate N-Succinyltransferase from Corynebacterium glutamicum.
pubmed doi rcsb
molecule keywords 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltrans
molecule tags Transferase
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
total genus 89
structure length 278
sequence length 286
ec nomenclature ec 2.3.1.117: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase.
pdb deposition date 2015-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
A PF14789 THDPS_M Tetrahydrodipicolinate N-succinyltransferase middle
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 5e3qA03
3.30.60.70 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Trimeric LpxA-like enzymes 5e3qA02
3.30.70.2010 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 5e3qA01
2IUAA 2V0JA 4N6AA 4G3PA 3VBJA 3NZ2A 3VBLA 4G3SA 3OTMA 1T3DA 3DJ4A 1KK4A 1QRFA 5E3QA 3EH0A 3V4EA 1KK5A 3DHOA 2VHEA 1KK6A 1Z90A 3FTTA 3R5AA 4ISXA 2WLFA 5DG3A 3TISA 3GVDA 3MQGA 1V3WA 3D98A 2OI7A 3SPTA 2JF2A 3FSBA 3JQYA 3KWEA 3I3XA 4AC3A 4EQYA 1HM8A 1KQAA 4EA8A 3OUPA 4KNRA 2NPOA 1XATA 3FSCA 4M98A 4R36A 2VD4A 1QQ0A 3BFPA 2V0HA 5L6VA 3FS8A 2RIJA 4H7OA 4M2AA 3DK5A 2QIAA 4AA7A 4DCLA 2QIVX 5E3RA 4EABA 1QREA 3BSYA 3BRKX 4HZDA 2IC7A 3FSYA 4HZCA 1SSTA 4E6TA 2TDTA 3VBMA 5F42A 3VBPA 4MZUA 2Q4JA 3ST8A 2OEGA 4N6BA 1HM9A 1OCXA 3R2WA 1S80A 3VNPA 4M2BA 3EEVA 4E79A 4KNXA 2W0VA 4E1KA 3TV0A 2I5KA 1MR9A 4M9CA 1THJA 1YP2A 1HM0A 3FOQA 1FXJA 4HCQA 2GGQA 2OEFA 3Q1XA 1QRLA 3OU9A 4G3QA 1KRRA 5AFUV 3HSQA 4E6UA 1QRGA 3FSXA 1V67A 3EG4A 2AQ9A 3IGJA 1XHDA 2W0WA 5ADXU 2GGOA 2IU8A 3GUEA 3TIOA 3R3RA 4EA9A 3OW5A 2ICXA 3VBIA 2OI6A 3D8VA 4MFGA 5DEPA 4IHHA 4FCEA 3ECTA 4J09A 3HJJA 3R3IA 4HUSA 5U2KA 1TDTA 5E3PA 1SSMA 3SRTA 3T57A 4KPZA 3R5BA 3R1WA 4E75A 2IU9A 1KRVA 2V0KA 3BSWA 5L6SA 3GOSA 4AAWA 3P1BA 2P2OA 3P47A 5DEMA 4G87A 3FWWA 4HURA 4K6RA 1YP4A 2JF3A 3C8VA 2XATA 4IHFA 4J18A 4N27A 1G97A 3R0SA 3KWCA 2QKXA 2V0IA 4MYOA 4IHGA 1SSQA 3KWDA 1YP3A 2V0LA 2OI5A 3IXCA 1KHRA 1J2ZA 2WLDA 3R5CA 3I3AA 4EA7A 2WLCA 1KGTA 2FKOA 1G95A 4M28A 3TDTA 2WLGA 4M99A 4EGGA 2WLEA 5ADXV 4R7PA 1MRLA 2ICYA 3BXYA 3VBNA 3BSSA 3OTZA 3TWDA 3R8YA 3R5DA 4N69A 4KPXA 1KRUA 3VBKA 4R37A 5AFUU 1MR7A 1LXAA 3F1XA 1KGQA 3TK8A 1FWYA 3CJ8A 3MC4A 4KQLA 4EAAA 3MQHA 1QRMA 3PMOA 1HV9A
chains in the Genus database with same CATH superfamily
4WBFA 1PJ6A 4MH8A 2R2RA 2W9BA 4ZPDA 1LWCA 4ZHRA 3Q8QB 1NHKL 1I1GA 3BSOA 2HVEA 1LKZA 3MEDB 2OPQB 4ID5A 2CPEA 3PXGa 1WHYA 3B4DA 1N36J 2IBOA 4M5DA 4E79A 2RS8A 2F4FA 2VODA 4X4SA 2OPQA 2VPXB 4KTQA 1SGPI 1BMQB 4AQYJ 2HHPA 3OHBA 2EPIA 2HZCA 2HRTA 1FD2A 4QCLA 5ADXU 5E3CA 1U7LA 2ZE2A 3FMWA 2ZWPA 3DRSB 4WPAA 2QTWA 2JZMA 4RW8A 3OH0A 1ACMB 1N34J 4CLTA 3IC1A 4LF7F 3CWJA 3DN9A 5IFMA 1SBRA 4CH1A 1VDDA 1L5UA 3G6VA 3DRSA 2SGEI 2CVEA 5ADZA 3QAHA 3KJNB 4OX9F 2V8DA 2E1CA 1KR4A 4KGMA 4F3OA 4NWBA 3R5AA 2P6AC 2EFVA 4L9MA 2WW8A 4P74A 3ULHA 4WWSA 2B9EA 3QT7A 1KS2A 1ZS6A 1CJKA 4U8YA 3SCLE 4AA7A 3NWRA 2YVSA 5KOWA 4YDXA 7FDRA 2G9OA 4F2RA 4FF3A 1K7TA 2IM3A 3MCNA 2ZH8A 3PIOQ 4JV2A 1NNDA 1BLUA 3PCOB 1U2CA 4LQ9A 1IBMJ 2FVRA 3KDOA 2IJFA 2I1RA 1FYBA 1V9OA 2NR0A 1LXNA 3JYTB 3TZYA 5KFWA 3HHLD 4U95A 4KPZA 2BJEA 1RGVA 2GFFA 3W64A 2MZRA 3CC2S 1KLMB 4DV4F 2EFOA 1Y10A 3VVTA 4YB1P 2O66A 4UUWA 3JYTA 3O44A 2VB6A 2ASJA 3HHLB 3QRQA 4A8MP 1LR9A 2FC8A 2L8EA 1PO6A 1KLMA 1R6YA 1V1HA 3ZTSA 4NLRA 3BH7B 4RJVA 1RAOA 1G1XA 2QL9B 2R7TA 3HHLA 4OV1A 3SFUA 5DS7A 3A3NB 3CW2C 4OHXA 4CNZA 4F50A 2CJ9A 3ETMA 3GLJA 2FVQA 4DN0A 1KQSR 1M5VC 1CT2I 4UQTA 3MM9A 1UJ4A 4KC5A 2D41A 3CJQA 4DL6A 3TIOA 1R43A 4YB5A 5A6PA 2LKZA 3PYEA 3MECB 3VAGA 4NI2B 5AE2A 3CDAA 2XLJA 3LWLA 5EN1A 3FWWA 4HURA 1VLYA 4J9PA 4IO9Q 3ZNJ1 4DS5A 4KHPF 2EG2A 1KGTA 1MWZA 4NI2A 1FY7A 1S1UB 2XULA 1M8CA 5AJ3J 1RABB 2ZNZA 1UVKA 5AT1B 1S6UA 4UZBA 3SV3A 2KM8C 1S1UA 2ZVSA 3U1MA 2E5LF 4L3KA 1T03B 4YR3A 4X64J 3ILJA 4L75A 2XC9A 5JJBA 4USWA 3SUCA 3KYLA 1C4CA 4PG7A 2VRWB 2EKNA 2QG9B 1T03A 4DR7J 3GP9A 1UWBB 3BGUA 2CQIA 3O2IA 1Q5YA 2H5IB 1JLCB 4JI8J 3TZZA 1YRUA 1URRA 3N5BA 1NJWA 2FY8A 4DX8H 4AL7A 3BGOP 4FYVB 2R3VA 2E1MC 1UWBA 2CQHA 3J80Y 4QW9A 3B4VC 4PYAA 4GKKF 4ZS6A 2FVSA 2CJYB 4JI3J 4JI6J 3ILLA 2BQUA 2B5JB 4N6AA 3RRKA 3PHTA 3C15B 3V6HA 5D3GB 3HKZD 2PD1A 2IYGA 4JI2F 2H5JB 5FUYA 2EEYA 1WSVA 3NNCA 2HLUA 1SH0A 2GHWA 2A3JA 4ECXA 1S9EB 1TL5A 2B5JA 1H6KX 1UVNA 4H7OA 4Z2XA 3C15A 5D3GA 1PCEA 3TEHB 2AX1A 3BSYA 4NXNF 4UOFA 4K7QA 2V4RA 3OL7A 2J76E 1R89A 2RKIB 2MKHA 3MOZA 2CQ0A 1S9EA 4E1KA 1N0VC 3MD1A 3H90A 4LR9A 3EDQB 2EKYA 3MR5A 3GYGA 2IIHA 3GE9A 1FRIA 4KH0B 3OTEA 3KK1B 2RKIA 5KFEA 3E2EA 3BSWA 1FDDA 3L9ZA 3NGRA 3KUHA 2WCYA 4QJVA 3EYZA 4ZP6A 1GTEA 2QJ3A 2YXLA 1WDTA 3R5CA 1K47A 1NSPA 4EGGA 2C2RA 5GMDA 3KK1A 1H7WA 3D6MB 1TOTA 1SH3A 3T5KA 2IM0A 4B3OB 1OSCA 3ZTQA 2CQPA 4OJ1A 4DR4F 2QA2A 4YS2A 4Q2MA 2J0QD 1X5PA 2N3LA 4KV8B 1CS4B 4L6V3 4A4JA 5IXUA 2HFVA 4EO6A 4DV0F 3FBCA 2DR8A 4ZVUB 3K5LA 1B70B 3OUPA 4D3GA 3ZTOA 4C8NA 2DD8S 3GFZA 2GHVC 2XLIA 2QIVX 2BE9B 3UNGC 1HIYA 4LF6F 4DSKA 2VD3A 4KV8A 1CS4A 1RDRA 2YNHB 4DF4A 1HM9A 1FEEA 1CG2A 2DH7A 1OIAA 4MKVA 2OUGA 3PG9A 4OYMA 3T19A 1CGII 3VAFA 3OH1A 1T0TV 2CQ4A 3MWBA 2Y0MA 3IBFB 2IU8A 2OMLA 3M6XA 4OYXA 3IFEA 2D74B 2YNHA 1R8HA 1FNOA 3OVSA 4JUZA 2OAUA 3OLBA 5KFQA 3CCZA 2N1AB 1XNQJ 2HQCA 4DV7J 1PKUA 3IM8A 4Y34A 5CD4H 2D69A 2P8IA 1QTNB 1VRQC 5T41A 4PRFA 3VBNA 2QMWA 1J27A 1E6VB 2MHNA 1T9TA 4WU3A 1IKXB 4LSLB 1XMOJ 2GJ2A 1LXJA 2FJVA 2QQCA 4O4RA 2YPYA 1HQUA 1RWWB 3S6EA 3CE8A 1B64A 3UCZP 1XATA 4R36A 1DY3A 3HFVA 1WG1A 4HEA9 1R8AA 1E6VA 1MN7A 2UXDF 5B0EA 1IKXA 2D1CA 4LSLA 3R6GB 1F2GA 3PACA 2JRSA 4ZMMA 4DBQA 2JLEA 3LALA 3CJKB 5J2PB 3FSYA 1MJ9A 2VKRA 4KO0A 1IJFB 4C8ZA 4MK7A 4M2BA 4MIWA 1FJGJ 4I6WA 1FXLA 3CUNA 2LU2A 3HT0A 2L7XA 1NO8A 3R1LA 2PE8A 3OU9A 1YDLA 1HBUA 3HP6A 1PJ7A 4DNCA 3CJKA 5J2PA 3ZZUA 2NPIA 2R8JA 2APOA 1U5KA 4LFCF 5B0FA 5DQHA 4RO0A 3N5FA 4QWAA 1N5YB 5DLFA 1S1TB 3OTDA 2J5AA 1SJFA 4U67Q 2QQDA 4FYYB 1U6BA 4WFBQ 4OI3A 4LF5F 4FXDA 3SCKE 4DR1J 2ICYA 1NK7A 4KJIA 3OTZA 1N5YA 2GAGC 3N6LA 2FC9A 1RYRA 4ECWA 1IBKJ 1S1TA 3KNAA 3KHHA 3KFWX 4EFAC 1RWKB 3MQGA 1S97A 2ZH7A 1XWLA 3AXKA 2RVJA 1SJ3P 5THWA 1T9UA 1M5SA 3CC4S 4MFBB 1X4FA 1SH2A 1VBXA 2JEFA 4S0MA 1SQFA 6FDRA 2O01C 2ACYA 1TKDA 2UZ3A 4OYOA 2NXUA 3VGUA 4IQMA 2H1YA 3CJ5A 3BKTA 3M2RB 4WP4A 2NSCA 2PT0A 2LFVA 1WHXA 3C8YA 3MM5B 4B3SF 1FFSB 4Y6IA 2AYBA 3C8VA 3GQAA 3UN2A 2OEMA 1HL6A 5M2RA 2X1BA 2ZKTA 3FCVA 3NGDA 3M2RA 1HR0F 1TKXB 1D9AA 2OELA 3RB6A 3VTIA 3HFKA 4YR2A 3MM5A 4DEZA 2F9JA 4D3HA 2UZAA 2XRCA 1F5CA 2R7WA 2G0IA 4USIA 3ZZOA 2JFDA 2ZH3A 2QE5A 1S4FA 1TL4A 5J1NA 2GZOA 1HWKA 1EETB 1HI8A 1TKXA 1B99A 1CLFA 3AQPA 1N0UA 1IM4A 4M5KA 5KG6A 3HZGA 3I9ZA 1M5OC 5KFCA 2I2YA 1X4DA 2ZBPA 2A6OA 2F5GA 2ZKUA 3QNWB 5KFBA 3VGVA 1UPMB 1DBDA 3T41A 4OYZA 2NS1B 1SKSA 2B56A 3A1YG 4ZJOA 2GGOA 4OZLA 3OFEA 4IO1A 3R3IA 2VG5B 5IC6B 2HYIB 2QLJB 4YR0A 1X0FA 2HFUA 3P1BA 3P47A 5A2QU 4X62F 2Y8YA 1QJHA 3AY0A 2UXCF 1IKVB 1LFPA 2GKVA 3UGLA 4MK8A 4ED8A 2FHMA 4P72A 4X4VA 3MR3A 1U6ZA 2C1EB 3CB4A 2VG5A 1K1QA 2H51B 4IH5A 4PR6A 5EHHA 1NJXA 2QX0A 3AHPA 1HNIB 2JHEA 1RHUB 3OL6A 1S9FA 1IKVA 2QA4G 1RISA 1FDAA 1IXKA 3M6VA 2C3PA 2ENZA 2KT5A 5D8HB 2WBRA 4KE5A 5H9FK 1HM8A 5F0WA 2DHAA 2XS5A 2KFNA 1HNIA 1IR2A 3UWTA 2M8DB 4CLUA 3OPKA 4HZDA 2XYPB 2FY1A 3M4XA 2RDJA 3T1YF 1ZTTA 3TUIC 4DSJA 2CNOB 3A12A 4G3QA 3CULA 4E6UA 2ZOMA 2YNGB 2E7WA 1BMOA 2V0NA 1C2PA 2MKKA 5KFMA 5DDOC 3RYLA 3FKBA 4F3QA 4CLWA 1RAIB 2C2NA 1RT1B 4C3KA 2QA4S 2BJ8A 4AD6A 2YNGA 2WGCA 4P2MA 2WHOA 3THVA 1WI8A 2CWKA 1A7GE 2I8EA 2V63A 1KSPA 3OH3A 2ZWOA 2N17A 2RS2A 1RT1A 3PFOA 1Q7LB 3MTKA 4IQXA 4UZCA 1N36F 3MEEB 5D4LA 2JF2A 2DGUA 4J9OA 1G7CB 2D3O1 3BGRB 3E59A 4AQYF 3D1HA 2V0HA 1RAAB 3CCSS 3OFGA 3LGNA 1I94J 2QV6A 2PEHA 4HACB 2NU0I 3MPYA 2CJKA 5E3RA 3ISNC 5GAHI 1VBYA 5IT9U 1TTHB 3M30B 2IC7A 2GMLA 2Y1JA 3MEEA 1N34F 2XMWA 2A0FB 4Y3CA 3BGRA 1S10A 2KO1A 4CQ1A 2XGPA 5I3PA 3W9HA 3IWNC 4HACA 4ZPVR 4QR0A 4WP9A 2AZ3A 2CPYA 3M30A 4GVLA 2ICXA 4NCBA 4CO3A 2QLXA 3VQSA 1H74A 4F4AA 4B9UA 4V19J 2HW3A 2FD2A 3RB0A 5FLXY 3RBEA 2I0XA 4N27A 1PGZA 1G97A 2BQRA 2CJQA 4N8NA 5KT7A 2CQGA 4TN2A 2COLA 1RAJA 4J9UE 4M5NA 5HLFB 2CG8A 3NS7B 1ICEB 4OYAA 2JNJA 4OLPA 3OL0A 2NU1I 5B0DA 3LGHA 2SGDI 4X84A 2HRYA 3GSIA 1KHVA 2V69A 3GIKA 1IBMF 3DCAA 2BOPA 1RE1B 4HDHA 4ZCIA 5HLFA 2ZDOA 3R3TA 4ZPBA 2CZ4A 3K57A 2K7KA 3RJMB 1YVFA 5JVGQ 3H0PA 3Q0AA 3ONQA 2WVCA 2HHXA 3RGIA 2Q66A 2DTJA 2HFOA 5B09A 1VHFA 4K4VA 3I0SB 2X3GA 5J8FA 2OI6A 2DY9A 4WKRA 1YBUA 3DDIA 3W8GA 2ENNA 3JS9A 4DSEA 4RW7B 3GG0A 2LQ9A 3HLUA 4RUHA 3ENVA 3GR0A 2JEJA 4F02A 2EFGA 1R0CB 1U26A 3I0SA 4R7PA 3VE5A 2I5JB 1YBAA 3VAJA 4ETZA 1T11A 2IVMA 2KXNB 1WUUA 4RW7A 3V81B 5F9NA 1B0PA 1QAIA 4X4UA 1HFEL 2RF2B 2ZJQQ 2ACMA 3QSYB 1KQFB 5BXIA 3T3FA 3V6DB 2I5JA 1C0UB 2VPWB 2NZCA 3V81A 1EJ7L 4TNOA 4B3RJ 3UNYA 2PQ8A 1YIJS 4CT8A 3CXLA 3NS5A 4PG6A 2RF2A 4F67A 3MPUB 3JTPA 1UCNA 2D3UA 5HJYA 3V6DA 1KVIA 1C0UA 2AQ4A 2ZUAA 4XPEA 4F3MA 4O0IA 3N0VA 2A10A 3EG4A 3IR5B 4P2FA 2MB0B 2C2KB 2CQ2A 2DK2A 4G1IA 4H54A 3CCQS 1T95A 1H3DA 4LF4J 2G1HA 3NY0A 3BPDA 5AJ3F 4AUKA 2OZUA 2P2OA 1DS2I 1TL3B 3OR1B 4IHFA 1JMTA 1OSDA 3EJMA 3UR3C 4M28A 2WLEA 1OPIA 4DG1B 3QJJA 3B82A 1TKTB 2PO4A 5KG5A 2BUSA 1SGRI 2LEOA 1TL3A 3OR1A 4X64F 2BRKA 2QGFB 1IKYB 2W9CB 3B78A 1UVMA 3A3OB 1X8DA 3FEXB 1CQMA 2ZUGA 2C3MA 2K9HA 4DR7F 1GXUA 2UV8G 4ZP8A 2ZITA 1P9GA 3NNAA 3RAMA 4TVAB 4M95A 1T02A 4JI8F 5DDQC 4N8OA 1YGYA 2G1DA 2BKNA 1S6OA 3FC3A 2IY5B 3C6UB 3GQCA 2W4DA 4RBUA 4LRCA 1XERA 1SL2A 4JI3F 2DNKA 4JI6F 3FBEA 3KLFB 3K5NA 3EZUA 5L39A 1D9DA 2BKOA 3C6UA 5KG3A 3QIDA 3GCWP 3DRPB 5K9FA 1VIXA 2AW0A 3DXSX 4EZ6A 5IQ6A 2IRYA 3LOUA 1TBNA 3AAWB 3TZXA 3KLFA 4UF4A 2PMZD 1ZA1B 1HV9A 4NYZA 4DV3J 3D67A 3DI6B 3V4EA 2NU4I 1Y5IB 4ZN3A 2HVHA 3ET6B 5DG7A 1WC5A 3DRPA 1VQ6S 3ZZPA 5KG1A 2ZM6J 5IZHA 5F41A 1C1CB 4JI1J 4A8FA 3G86A 3JQKA 3CGIA 4J9MA 4DR6J 4LBHA 2F7VA 3DI6A 1Q5VA 2DVIA 5ITHA 1YZ7A 2ORVA 3NGSA 3OT9A 1C1CA 1FRHA 4DPYA 3IG1B 1IJEB 3ITHB 2Y9HA 3HZEA 2QLWA 4TLRA 1KONA 4NZ0A 2NUUG 4ALZA 1V3ZA 4F04B 2WB1D 3OW5A 1UA0A 1TVRB 4GC7A 4RKUC 1RWVB 2BM1A 5F8NA 3T57A 1N52B 3EUNA 5LXYA 1BE4A 4K4UA 2XNQA 3IG1A 4JYAJ 2DIPA 2PGCA 3ITHA 4ZOSA 1VQKS 5HMZA 2IRUA 4LBPA 3D0IE 4HHUA 1P9YA 2X3TA 3QGIA 3KWDA 2XNRA 4KKOB 1TVRA 1ZBTA 3TARA 2PI4A 1S0MA 3BM7A 1K9MT 2DEJA 3MZIA 1KBRA 4KGKA 1LOUA 2WONB 3MEKA 3UGIA 1LW0B 5HAOA 5AXLA 4KKOA 2XMAA 4EQYA 2C2EA 4CI0B 1TQLA 3MMBB 1BGXT 4DZ6A 1DQ9A 2RIJA 4QYRA 2NCKL 2R7XA 2IHR1 3J81j 2Z4PA 2GIRA 2K1RB 1N8RT 3QRRA 3N01A 1K0VA 4YN3B 3TX0A 5A0YA 2XO7A 1XNQF 4DV7F 2MQNA 2HURA 1ZH5A 2OPPB 1H7XA 4DZDA 4QW8A 1N5VA 5J1EB 2E9TA 4Y00A 4KQZA 2K1RA 5CYMB 1L3VA 1RT5B 3D1OA 5IWAJ 3TWZA 4P7VA 5ETNA 1RKIA 1U1PA 1XMOF 3C14B 2RMLA 4RNHA 4WTYA 3IN5A 1X74A 3E51A 1U1QA 2JH3A 2X52A 2OPPA 1KHRA 3AD9C 2HWHA 4OZ1A 5J1EA 1RXOB 4JB8B 5CYMA 1MSWD 3HSDA 1RT5A 4O3NA 3UDVA 3PMOA 4UW2A 3Q8YA 3C14A 1Q8BA 3H4DA 3PRDA 4O3SA 1S7IA 1CBKA 1N5SA 1UFWA 2BJDA 1FJGF 2FZKB 1HHTP 1YTPA 5HMYA 2BJ3A 3J7ZT 4M98A 1GXTA 2LECA 1Y3KA 3GB0A 1FRLA 2K7JA 2HIYA 4DQSA 1NJYA 2YWGA 3TRGA 1SIZA 2DNLA 1ZM9A 1VC0A 3EWGA 3TV0A 1UZDA 2V67A 2DGWA 4AL5A 5AFUV 2LU1A 4DX6A 4ED5A 2LQJA 2GNKA 1U47A 3QO9B 5HMXA 4DR1F 1HD1A 1VRTB 2IRXA 2XMJA 1SC6A 2CPHA 1TUGB 4O4GA 4AXIA 1DFDA 1R8CA 5DJBA 1IBKF 4Q8EA 3RG6A 2IC3B 5I3UB 1RYSA 3QO9A 2V2QA 1U48A 4ERDA 2DHXA 4ZVFA 1VRTA 4ZVTB 2GJIA 2PMWA 3NAIA 4WK3A 3CJ0A 4IH7A 2V2VA 3VBKA 3OH2A 2LQ8A 3SFGA 2XY5A 4W98A 4O23A 1ULMA 1HQ2A 2IC3A 2NXEA 3EH0A 4FNHA 4K2JA 5I3UA 1TAUA 4H4KA 2CVIA 3DLBA 2KDOA 3RRGA 1QM9A 3Q8VA 1S0OA 4Z7YA 3MPDA 4B9LA 2NU2I 1Y0HA 4JBCA 3PR5B 3NRBA 4MTPA 2GO8A 1VJWA 4C9DA 2C3UA 4ES2A 2B0GA 2W2OP 2K2PA 1M0SA 3PJWA 4C8YA 3HJFA 1KEKA 1NM2A 3QT5A 5D4PA 4ZPAA 4U7UK 2G4BA 1VISA 2UUCJ 1N13A 1GXLA 3Q22A 3WDOA 1KRVA 1VQOS 4P6QA 4U7UD 2BJ7A 2DCUB 2ROWA 1TR0A 3TAPA 2W24A 4OHYA 4KR0B 5EWGA 4I7FB 2MHEA 8AT1B 1T8EA 3F1XA 2OLWA 3Q8UA 4HT5A 1K1SA 2J0XA 1W25A 4I0WA 5DQIA 1L0SA 3HVRA 4CP5A 4J9NA 3EXCX 2KU7A 1PG5B 3WX8A 3OTCA 2Y1IA 4I7FA 3NOCA 2YUUA 3ELHA 1RT7B 3J81Y 3G8SA 1LK7A 4RBTA 1M8BA 2UVOA 1EAYC 1TFYA 1HBOB 4EMDA 1FTCA 2HGMA 3KHGA 4I67A 3AB2B 1NRKA 3OW2R 2Q4JA 3K17A 1REGX 3DLGB 1IW4A 1RK8A 3KLHB 1RT7A 3CCTA 1TKZB 4DV5J 2DIVA 1RWNB 1HBOA 2R2TA 3ZZRA 3J80U 4CLSA 1GMUA 3W8PA 4RPFA 5D6GA 2QLFB 3AJDA 3DLGA 3KLHA 3HVTB 4OI4A 4KYZA 3CCWA 2ZC4A 1TKZA 1OQ3A 2DR6A 3UN5A 1T7PA 1UVFA 4CM0A 2QPOA 2HK2A 4FNIA 5BYQA 1QVFR 2FKOA 5L9NA 1WHWA 4RNOA 1WC1A 4J9SA 1FARA 2KH9A 3R8YA 3I5BA 3HVTA 1MNEA 5LMNJ 3OLAA 2B8QA 4C6AA 2LLZA 2DR9A 2V4QA 4UXHA 2MY7A 3OFFA 2RDIA 2DGQA 3CCLS 4ECUA 3CF5Q 3AD8C 4M63A 3L7PA 2N4CA 1PBAA 4FYWB 5L6VA 3H59A 4C8MA 2J7KA 2ZJPQ 4ER8A 3UDEA 1RTIB 4Q45A 1SQEA 1Q95G 4IUFA 1C0TB 1RAFB 1I6JA 4DX7A 4BS2A 5ETRA 3VWSA 3TVKA 2PC6A 1Q53A 5C7PA 2JVOA 1UAWA 3KWMA 1N48A 1B0TA 3MMJA 3G6XA 2FJEB 3ADAC 2E9RX 4LRFA 1RTIA 3MPWA 3PW0A 3K5MA 1C0TA 4IFYB 1Y9OA 3GYNA 2PI5A 2KRRA 2VHGA 2UUWA 4ZCLA 1FAQA 3A8EA 1KDNA 4HI1A 2NXNA 4RUAA 3ZTPA 4NYOA 4IFYA 4LBIA 2U2FA 1JXVA 1VMBA 2W1BA 4RNFA 1XQIA 2RQ4A 1D3WA 2MXYA 3ZFVA 3TK8A 3KMSA 1I94F 1Z4UA 2M2BA 1FJCA 2CUYA 1DTQB 1RACB 3H4BA 2ZBIA 3DHXA 4Y2KA 1WEYA 2FDNA 2HFZA 3HT3A 3FFIB 4DR3J 2J9DE 1FCAA 4NX9A 4OYIA 3C19A 4YEAA 2VG7B 1DTQA 4CLZA 1HI0P 4PXCA 1AZSB 2VQFJ 2NQPA 1KWMA 3BS9A 4C98A 3FFIA 5L8RC 3CT9A 1EB0A 3N79A 1Z2ZA 3P45B 4DLEA 1THJA 3HSZA 3NCPA 1YU6C 1HW8A 4X66J 3DKDA 2VG7A 2W0WA 3I4HX 4KPYA 1AZSA 1GMVA 1UWAA 4P2XA 3T9ZA 2M88A 1FD8A 2M5YA 1VRUB 3NBPB 1U0HB 4KGXB 3TVYA 1F2HA 1KLNA 4IDKB 4H4OB 1SSQA 3GYXB 1QTMA 1G6BA 4IYQA 2RHQB 2PIIA 1VRUA 3NBPA 3HM9A 1X0PA 1U0HA 3B6BA 3HPOA 1S0VA 2DCLA 5KFFA 2P5VA 1NMEB 4ZITA 1RTZA 1HWUA 2O1PA 2RNEA 4PAAA 4IDKA 1TUSA 1RBAA 4H4OA 4IRDA 2W7PA 5B0AA 2MQQA 1BXNA 1FERA 4OZ2A 2Q6BA 3FCHA 2DXEA 1O5JA 2MLYA 3W62A 3BF4A 5KT4A 3HD1A 2R8HA 2IVFB 2AJ1A 1M1HA 1DARA 1JWWA 4XO0A 3M9NB 2BJ9A 3D1QA 2FQQB 4QIVA 2WB4A 4USKA 5K8PA 3VNPA 1B7FA 2E66A 3VDPA 4YOEA 2B4PA 3MD3A 1XK8A 2G2OA 4N5SA 2AYEA 3FSXA 3IGJA 4LRDA 4DCPB 4A8WA 4MKYA 2IA6A 4FCEA 4IG0B 1S48A 4YP3A 1H0ZA 4DQIA 3AT1B 3R5BA 3R1WA 3US5A 3JAMY 1N33J 4ED0A 4AAWA 3BBCA 4QZVB 2V8GA 3VGTA 3IO1A 3M8SA 2QKXA 2EFPA 4L73A 1Y00A 4NLPA 5A6WA 2VASA 1KHWA 5C25B 4IG0A 4QWEA 4TU7A 1XJWB 2BZ2A 2Q79A 4K4ZA 5J2NB 3ISZA 2RC4A 3VAHA 4NPOA 2CWHA 1RWOB 3ZO7A 4B3RF 4FKYA 3H8YA 2B9XA 4B9VA 4DR5J 4ES3A 2OPSB 3IXQA 2E7XA 3MPVA 3M8YA 4ZK7M 5C25A 3GV7B 4ZLLA 4AXJA 4DV6J 3RB4A 1S0NA 2DISA 3EX7B 2GS8A 2QN6B 1R0BG 4P10A 1UP1A 2ZH4A 3UN3A 1JLGB 4TKTA 2OO4A 4LF4F 4ED3A 1ULNA 4M5LA 2OPSA 2V8HA 1Y5LB 2FGOA 3MM6B 3DLLQ 4C8LA 2OP5A 3RBDA 2XZTB 1VHIA 4WXOA 4ECRA 2AEMA 3JSBA 2V1CA 1UJ5A 3PVXA 1JLGA 4OFZA 2GVIA 1P9QC 3MM6A 3QT6A 2RSQA 5KFPA 5IT0A 2GVZB 4TU9A 2CPZA 4UXIA 2M3DA 2LCWA 4ZPWR 3QLHB 1MWQA 2EI5A 3OTBA 2OH2A 4ZKAA 3DJ4A 1S20A 3MCOA 4DQQA 3NCRA 4WJBA 1NKBA 5DG3A 1W4RA 4DSFA 4F4KA 3QLHA 2FJDB 2YWKA 1PSDA 3BGFA 2DGVA 1IWGA 4DCOB 1F3VA 2XI2A 2WCXA 2KTQA 4V19X 2KVIA 3VALA 3I6PA 3I5AA 4BBYA 4PXEA 1PPFI 1J5OA 3KY9A 1AB8A 3GMGA 5A8WB 3Q1XA 2F8EX 4HTJA 3KUEA 3CIMA 3J7AN 4J90A 4DV2J 4XIUA 4BLGA 3AA9A 3IP0A 2DGXA 3BQ0A 1RU1A 4DLGA 3PEJA 1KKHA 4DV3F 4Q0BB 5L6SA 2KXHA 4Q2LA 2LDYA 5A8WA 1KN6A 5DEMA 3W9JA 4A47A 2AD9A 1RA6A 4ICLA 2ZM6F 3BB5A 3DLJA 4JI1F 4K59A 2HZAA 2MQLA 1GX6A 4ATNA 5FD1A 1WC6A 2Y3YA 5IS2A 5LMUJ 4DR6F 2DRBA 3SZ2A 4Q0BA 4B3TJ 2G0JA 3V4IB 2WSFC 2KYXA 2OPRB 7WGAA 2Q43A 2DPIA 3MM7B 2K8GA 1W3SA 1XTZA 5BJRA 4RUBA 1H72C 3V4IA 5C5JA 1YSJA 4RL1A 4RX6A 2OPRA 1S76D 5KFRA 4JYAF 3RU0A 3AA8A 1MU2B 3PTWA 1LFWA 2LDIA 3MM7A 4NMXA 1OWXA 3HSQA 3BKFA 1T94A 1KOOA 4ZA1A 3WQPA 5HMWA 1MROB 1DURA 5DEPA 3BBBA 1XR5A 3VDUA 5E3PA 3BBFA 4C8OA 1MU2A 4FVMA 1IKWB 3GIJA 4NLOA 2XATA 1TBOA 2XYHB 1MROA 2UUBJ 3KJFB 4CTAB 2RRAA 5FUXA 2YBVA 1WOSA 2L9WA 5KFVA 4RZRA 3HVAA 2J9EA 3Q2SC 5C42A 2L41A 1IKWA 2CPIA 1QRFA 2Z2LA 2RILA 4M5HA 5K5MA 3K5OA 5KFGA 4CTAA 2FJAB 5H9EJ 3W66A 1GFWB 2JC0A 1EKSA 4A8XA 1BWEA 4EO8A 3MR7A 4WFZA 1NDPA 3GU0A 4Y65A 3NWGA 3VBPA 4YB6A 5IWAF 1JNZB 5FLXU 2P6SA 1T9WA 2ODDA 3OJUA 4R8UB 1JJ4A 1K0TA 3DGPB 1NH8A 2OEFA 3N9UC 1JNRB 2YWEA 1V67A 3BSNA 4DPTA 1J5EJ 1PJ5A 5F8GA 1S7HA 3HJVA 1NJIT 1F5BA 2AJQA 3DGPA 4J18A 5GAGI 1HBMB 2XZDB 2B51A 3N4WA 3BXYA 1FFWB 2ERWA 3TX8A 3CJ8A 1F0XA 1JXEA 1YJ7A 4LVNP 2OJ3A 3NNHA 2FLOA 3P96A 1PILA 1PCAA 1TZ0A 1HBMA 2ZHOA 4ZIWA 4I69A 3T1AA 2Z56B 1CE3A 3A8JA 3HULA 1T9XA 2ZBCA 1EP4B 3BSCA 2JWNA 3DM2B 1HYSB 1A0OB 1X5TA 3WX4A 1WELA 2WVEA 1SC3B 4Y0FA 2R8GA 1UJ6A 1WACA 2N3OA 4EEYA 2DHGA 4KB7A 2I5KA 1UEUA 3R1HA 1EP4A 3P8BB 3DM2A 1HYSA 4TQSA 1UHAA 2CPDA 5EDWA 3BQ2A 2UVUA 2W9BB 1FE4A 5JXSA 2Y0BB 3LO3A 2DH8A 4WFYA 2Q1LA 2UP1A 3TR5A 1NK0A 4EZ9A 1NDCA 4PPDA 1FVSA 3FQKA 1A6LA 3IBCB 4OLOA 3CC7S 4M5IA 3KK3B 4M5DB 4ZVOB 4F0HA 4N69A 3K8VA 2YNIB 3HX9A 1TK0A 1HNWJ 5C2GA 4JCVE 4NCGB 4CDIA 4B08A 4C97A 2BX6A 3LUYA 4PUOB 2ZE2B 2H5EA 3LW5C 1WSRA 1M1KT 3KK3A 1NUEA 3TA2A 4RW8B 1IWAA 3UEJA 2VIHA 2WSEC 3I96A 4IKAA 4UXJA 5L1LA 2YNIA 4NCGA 1AA1B 5H1SV 1T3OA 2UUCF 3GQ8A 4PUOA 4BWJA 1URNA 3SSSA 3OQ2A 4NLWA 3OVBA 3GONA 1L3TA 1NSAA 3LAKA 1MR9A 2UVRA 1QAYA 3MMCA 5GAHU 3CEDA 4WF9Q 2ZOGA 2IAJB 5F8LA 4X4OA 2KVQE 2YH0A 3K5PA 3IR6B 5K8NA 2IU9A 3D3CJ 1TURA 1CJKB 2VPYB 1Q81T 3CDEA 1BUXA 1RT2B 2Q6CA 3K7RA 4EBCA 4KGZB 1KVKA 5F8HA 4ED6A 2IAJA 4UT4A 4QR1A 4RW6B 1RA7A 2EWHA 2W4CA 2J0WA 1UZHA 4HDGA 4QPTA 3QWPA 5MLCV 1CT0I 2XBPA 3BV8A 4F0KA 1PAUB 4X4NA 1RT2A 2QMXA 1HWLA 4RW6A 2YX4A 4LMZA 5IV3A 1JLBB 3O3LA 4DV5F 1WJ9A 4NYPA 4UOCA 1D9FA 5HVFA 3OTOJ 3D6FB 2G13A 2XCPA 5H9FJ 4DHVA 1WF2A 2BABA 2BQ3A 1I3OB 3A8IA 1JLBA 4CNYA 4KNXA 4DUZJ 3SGQI 2ZZTA 2IBKA 2DNOA 3PFEA 2ADCA 2ILYA 3IAS9 4JP8A 2IA0A 1M90T 3SXLA 2MTLA 3QIPB 1KQGB 3GFYA 2YPZA 4ZVQB 3UO0A 3RR7A 1S6QB 4E8UA 5LMNF 3PX0A 2WZ1A 1NEEA 5ETMA 5DRKA 4B9TA 3KWCA 2R7QA 2XSJB 4ILRA 3QIPA 2GMJA 1W2IA 3TOAA 3EZ5A 2XWXA 1QSYA 4RU9A 1S6QA 1UEKA 3MM9B 3LP0A 2HG4A 2QA1A 2V0JA 4DUYJ 2FVPA 2KFZA 2N71A 3LH2S 3ZZ0A 3TJ9A 4RUCA 4PXDA 2XSJA 4LSZB 4X4QA 1L3KA 1NPPA 4M5GA 1O0PA 4KY3A 4PPZA 3M8ZA 3PX6A 3KHLA 2M9KA 3VQTA 1SJQA 2GV1A 2R8KA 4P52A 2DGOA 3NG8A 3AQOA 3UPFA 2WSCC 1FNXH 3EVWA 4NZ7A 3H5UA 4G6VB 3S7RA 1H0HB 2SGPI 4FN5A 4CIOA 3M8QB 1PJUA 1MLAA 3FUYA 1RI7A 1XA6A 4DL2A 1RAGB 2OI2A 2R2SA 2CNLB 3TO6A 2OEKA 1Q4RA 3MMAB 4W92B 2PFDA 1YJNS 2ZJRQ 3M8QA 4JI7J 1PIEA 3R7SB 1WGTA 2C42A 1BQXA 1JLFB 4DPXA 1HW9A 1WF0A 4DR3F 2MKSA 1TMMA 4CO0A 3VHQA 1B0VA 3NGKA 4OVOA 1CPZA 3MMAA 4WK1A 3LAMA 4FF4A 4C2MA 1U4BA 4F26A 1VQ8S 3OGZA 2VQFF 3FTTA 2VDHA 1JLFA 4PQAA 3IRWP 3MUMP 3PJ9A 4MPIA 2K3KA 3TZWA 3FSBA 2ZBQA 3GJRB 1VBZA 4I2QA 4X66F 2F1FA 3X1LB 3GWCA 2V2ZA 1SSTA 2FHJD 3ST8A 2JLGA 3ENAA 3SEKC 4QPXA 1JLQB 2VFUA 4JV5J 1PYTA 1S5ZA 1XMBA 2FB0A 2J7WA 2XCAA 3G82B 3THTA 4AE5A 1JLQA 2KL8A 1JLAB 4B9MA 2KM8B 4J37A 3M32B 1FXDA 2FHJA 1N88A 1YRXA 2D7SA 3ILIA 3G82A 5LJ3Y 1S72S 1TIHA 3BDEA 3QT8A 1JLAA 1Z90A 2OFGX 1AUSL 3I9V9 1SKUB 2ASYA 1HMVB 3M32A 2Y1RI 2XLKA 2HBZB 5GAEU 4IR9A 2HS0A 4LRBA 3V4MA 3NGTA 3DK5A 2QIAA 1F3FA 2VJUA 3RAXA 4SGBI 1ZAVA 3RBXA 1HMVA 4WYLA 3O8WA 2N4DA 2RD5C 4R0JA 1VC6A 4UOGA 1FXRA 1EKRA 3A13A 1SKRA 2DPJA 1RSCA 5JVHQ 1N33F 4X4TA 1F60B 4XAKA 1NXUA 2DH9A 1TP7A 3FOQA 2XMVA 1RUSA 1GX5A 4KIAA 1S6PB 5HATA 3J7YI 3UVJB 2J6TA 5DO2A 1OJ4A 1K7VA 3DMJB 1NXIA 2QT7A 3WC0A 3KXDA 3Q24A 2PSZA 3S8SA 1DLOB 4DR5F 1SUQB 4YMEA 4URSA 4PG5A 1S6PA 2J6UA 1RADB 5F9LA 2WLDA 1J2ZA 1ZA2B 5KT2A 4JI5J 4NLXA 3UVJA 2WLGA 1EWWA 4DV6F 4OJHA 3LWMA 1APSA 2KMPA 4ZP9A 3DMJA 1ZZNA 1BC6A 5G0RA 1ULKA 3R7NB 4BC9A 3VBLA 3E2IA 3CDUA 1DLOA 3K89A 1SUQA 1MJAA 1OS5A 3BR8A 4NLUA 4XTTA 4MIBA 3RB3A 3V5RA 1V3SA 4USUA 4C48A 4PXBA 4LFAJ 4DFKA 3IM9A 9WGAA 2YH1A 2MKJA 2DITA 2FLNA 1PC4A 3W3SA 1T3NA 3JXOA 2ASLA 5F8JA 2VOPA 1YP2A 5LOQA 1TMJA 2DXFA 3EE3A 2BJ1A 4B3MJ 1X4CA 4GRSA 1WTFA 1HQUB 2AGQA 2BM0A 2Y1LB 2N7YA 3E3XA 1YX2A 2MSSA 2KCXA 3EGVA 4MMOA 2J0SD 5CZXA 2QIFA 3LPYA 3QFHA 3PW7A 4WIIA 4MYOA 4KO0B 1WTJA 1NHVA 3I4PA 3UD5A 2YKOA 4WKYA 1D1UA 3KUGA 3TWDA 3J81U 1HPTA 2A20A 2W7AA 1HBUB 2ZHAA 3F44A 4J9KA 3DFEA 5C2CA 4PZVA 4I2PB 2FZCB 2LA4A 3UDCA 4DL3A 4C0OC 2KB2A 2HLTA 1MMNA 3CPWR 2VONA 4E1RA 2IVYA 1DHMA 3H5XA 3T6BA 3KKFA 5G4DA 1X9WA 1NZAA 1QD1A 2ZNYA 1WHVA 4DV2F 1SC1B 3GQ9A 3GOXA 2DYAA 3SCJE 3MURP 4EAAA 4I2PA 3I32A 2DNPA 3HF5A 1C4AA 3PDNA 1D8ZA 1HM0A 3L7OA 2B9YA 4ZPTR 5B0CA 3K59A 3OR2A 2HKEA 1LQ9A 3FK4A 3DOMB 4CM2A 5LMUF 1KP6A 2MY8A 4I6YA 2ORWA 3H5YA 4B3TF 3HCXA 2HAFA 4MK9A 5KFYA 1D09B 1FA0A 3W9IA 5KFJA 1KRPA 1S79A 4CYUB 1Q82T 4PWWA 1DZ5A 3PYDA 1G95A 1VYAA 3WIUA 3DOMA 1FRJA 1KTQA 4Y2MA 2AT1B 2RT3A 2VA3A 4K4WA 2YWWA 1EHWA 2R9LA 1RTDA 3AJ1A 1T3DA 3RR8A 4F2SA 4CYUA 4OL8A 4JI0J 1ITPA 4OI0A 3SPTA 3TA1A 4CO5A 3R5GA 3HH2C 4LF8J 1KQAA 3UQSA 2MKYA 1IY5A 5L9XA 2ZHBA 3TJQA 5HP1B 4OX6A 3R5JB 4K5RA 4E6TA 3BO3A 5BYRA 1Q8IA 2DNGA 5FIIA 2WOMB 1FWPA 3HD2A 4U96A 2B4VA 2GA7A 2YWHA 5E33A 5DZ7A 3CJSA 2UUBF 3MUTP 4DV1J 3OL8A 5HP1A 1MMLA 1KC8T 5D0RA 3IS9B 3AOAA 4O3QA 2ZH9A 2ASDA 2ZH1A 4P71A 4ANCA 1UFKA 2J9RA 2WOMA 1FX2A 4RNNA 4KT0C 1YJWS 3A3PB 4OI6A 2YWFA 4DI6A 1WWHA 3TOBA 2R7OA 3OD2A 3CJ3A 3IS9A 2R8IA 3HK2A 3R97A 1TL1A 4G1PA 5AE1A 5HVGA 4G3SA 3M8RA 5LJ5Y 5L1JA 1YJ9S 1H73A 4WE1A 4U7CA 1IM6A 2X1GA 1JB0C 1F1BB 4HH0A 2XYGB 1Y8FA 2N82B 1Y7PA 2HHUA 3H5SA 4U8VA 3PYGA 2GQ2A 3QRPA 3JSRA 2OD6A 1NDLA 3RAQA 1J5EF 1RLCL 2VFVA 6FD1A 5DAEA 5RUBA 5AXKA 4TU8A 1JXLA 4MZUA 2ARPF 2AF6A 2VFRA 3HXMA 1X60A 2UXBJ 3QJLA 4Z7CA 2BOAA 1NPRA 2LXIA 2QYGA 3KG0A 4B17A 4NRUA 2J9DA 1R27B 1X4HA 5SZTA 3CCRS 2QFIA 2MGZB 2ABYA 3KNGA 1U8WA 2ZD1B 2KG0A 1ZM4A 2H9ZA 1VQ4S 4E75A 1AFIA 3OXLA 2DB1A 1REVB 1IQZA 1YJVA 2MKIA 2HQGA 1KVJA 1BQMB 2YNFA 5EWFA 4M1KA 4L3NA 2MGZA 3W60A 3WIVA 1PC5A 2VJVA 2ZD1A 1MRLA 3W2WB 4PG8A 2MKCA 1REVA 3AOCA 2E5JA 3R9LA 4NXMJ 1BQMA 1Y5NB 3P4UB 2OIHA 2C28A 4N41A 3TJAA 3W2WA 4F36A 2W2PP 4PABA 5ETSA 3TYTA 1VFJA 1TV6B 1HARA 4WYWA 3T5HA 1UL3A 3FS8A 5E2QA 3H98A 1RHKB 2R7UA 2B0UC 1SJRA 4OZ3A 2JEIA 5F42A 5LSOA 2LEAA 2PA3A 3GJTB 1OQ6A 3MGJA 2X51A 2HHHJ 3JAMU 4OIXA 3UW1A 1TV6A 4MT1A 1I5OB 2DO4A 3FEZA 3PO5A 3TANA 4LQ3A 2HHSA 3DC2A 3CVKA 1JJHA 2ATCB 2HBRB 3JTOA 1FKPB 2IDEA 1LWFB 3RTVA 4NLDA 1HNWF 1HNZJ 1QLNA 4K6RA 1YP3A 2FVCA 1FKPA 1LWFA 4HH1A 3QSIA 3SQOP 2ZOFA 3B54A 4NLGA 1RU2A 1UVGA 1HWIA 5E3QA 3KLGB 2J7UA 3G2XA 2OEJA 2E5HA 2RHSB 4M8LA 4YHHJ 4BWMA 1WC0A 4F4ZA 4DR2J 3AFGA 3H2UB 2W01A 3KLGA 3Q86A 2NPFA 1NHUA 4NE9C 5KFXA 4WIQA 1UKUA 5HO4A 1X4AA 3BREA 2CWXA 3DDNA 4QYZJ 4BDPA 2HBYB 4K2XA 2V9WA 4M9CA 4EBEA 4ZVEA 3AH6A 2C3YA 2E44A 2J8SA 4HT7A 1EQ0A 4NL5A 3D0HE 3FJ2A 2W2NP 4IHHA 4MYTA 2KZMA 1VOMA 3H42A 3BZQA 3ISND 3D3BJ 5GMEA 1NB2A 3MEDA 1YRTA 1TU0B 1U1OA 2X1AA 2UUAJ 5ETKA 4F25A 3Q8SB 3CD6S 4O3PA 4B6DA 4FVCA 1N6QB 1FRXA 4X65J 3TI0A 1UW4A 3NOGA 1Y4ZB 2DRAA 3OTOF 3EZOA 1TUWA 3UCUP 3NZ2A 4RW9B 2PDAA 1FF2A 1NK4A 4DQRA 2MPUA 2C2OB 3X3UA 4G3IA 2RE1A 1N6QA 3UD4P 4DUZF 5A8KB 2B6AB 2RQMA 3BH6B 5KG2A 4O3RA 3HHLC 4RW9A 2EFNA 1TBQR 3I82A 1N56A 4NA3A 4GI3C 1FWLA 2L08A 2E7VA 1M5HA 1OYEA 3CCJS 5A8KA 2B6AA 3FEYB 2GGQA 5HANA 2CQDA 2GX8A 4CLYA 3SSQA 3I0RB 1FHTA 3PW2A 1U49A 1ZAWA 4ZDNA 3CJ2A 4DOZA 4FF2A 2HNDB 5E0OA 2GW8A 2MQ8A 3A4TA 4J9VA 5ETOA 1DQAA 3GILA 3BEGB 2V8VA 3MFIA 4OYPA 4CH0S 1MW7A 3CJRA 4ES1A 4DUYF 3UE2A 4C7QA 2FNFX 3I0RA 2MDAA 2HHVA 3HHEA 2H65B 2HNDA 1AT1B 3TAQA 1UUCA 4PWDB 1V5IB 1ZZFA 1YWXA 1VDHA 4R5PB 4C8KA 2J9CA 3VAIA 2XM3A 1WDDA 1XBWA 1R31A 3KLIB 1V3RA 4ISXA 2CAJA 3EVOA 4A24A 2ZFHA 3CMES 4PWDA 4TY8B 3FBBA 4OHVA 3IA0A 4TQRA 2UU9J 2U1AA 2RUSA 2AMCB 5HQMA 2GCFA 4R5PA 1X4SA 2D3ZA 1HPZB 4HI2A 4MKBA 3D9BA 3KLIA 3KG4A 3CD5A 4TXSA 4TY8A 1ZPVA 2NLWA 3OHAA 1GQEA 1QAJA 4C0BA 4JI7F 1YHQS 1ZETA 1L3SA 4YB7A 2BW7A 4ANDA 1QRGA 3D6TB 2MQMA 1HPZA 5KTQA 2VKZG 1FJ7A 3R3RA 1CSJA 3DOKB 4O44B 5KOXA 3O6QA 3LQVA 2FUG9 1VK8A 2RQCA 2IYIA 4A8KA 4DPOA 5LSLA 4Y28C 4N47A 3M9OB 4E0DA 2MZJA 2LA6A 4IG3B 3DOKA 4O44A 2LXUA 1XN9A 3QGHA 4M99A 4J91A 4LRAA 3EPGA 1HD0A 4WFAQ 4IFVB 2MZSA 2IUAA 3UD3P 4WP8A 1TFWA 2VBXA 2W2MP 2LVWA 1WOPA 2WVFA 5AXNA 1CHOI 3CJTA 4L74A 4IG3A 1FRMA 3MECA 5J8CA 2BV3A 2K06A 4B9SA 4IFVA 3W1YC 4JV5F 2RRNA 2LEPA 1VQLS 5GVQA 1OMTA 1WNEA 1S49A 2VFTA 3QZ7A 1RHQB 1QAXA 2NYHA 2DNYA 2DT9A 4OI2A 4IRKA 4LSNB 2XMUA 2V8PA 2DO0A 3F56A 3MTJA 3BJYA 3TUJC 4ECVA 1MWYA 4DU7A 9RUBA 3C3LA 3NMRA 1FRKA 5CCMA 1OMUA 3IGVA 3N6NA 4LJMA 4CRJA 2WVJA 5GAEI 4RR5A 4F0MA 4LSNA 3DOLB 4ELTA 5F3TA 5IQQA 4QWCA 3C46A 2QSFA 4GO7X 3R0SA 1BY9A 2HNZB 1N32J 1OY9A 2Z2ZA 2ZDPA 2J6SA 2YKMB 1Y1BA 2IDLA 5EUHA 3SEOA 5JUMA 5ETTA 3TUZC 3OFHA 3CIZA 3DOLA 2B9WA 4P2SA 2VQEJ 2CADA 1DRZA 4EWTA 4X2BA 5KFHA 4ZVRB 3M9MB 2A2CA 2EC0A 3S1TA 2MZ1A 1F9FA 2HNZA 2J8AA 1V6HA 2BUNA 1AW0A 2YKMA 2GIQA 2QL7B 2H54B 3K58A 1JLCA 1K73T 1Z2FA 3LPEA 2KJWA 4RWWA 4CLPA 2YKNB 2EBEA 2VDIA 3W2VB 3NXZA 4XDDA 4ZJQA 2BXJA 2W8LA 3EVMA 1I51B 1VQSA 1CJTB 2EC2A 4WFNQ 5DG8A 4ED1A 5LT5A 5D4OA 5HQLA 4G1QB 5HN0A 2YKNA 1WD6A 5MAOA 1MG7A 3W2VA 4JI5F 3TVZA 2CJAA 1M1GA 3S01A 3RW6A 3GSDA 1CJTA 2KMOA 4FYXB 4OMFG 4YUDA 2VG6B 5L1IA 4DL7A 5AE3A 3MXHP 4G1QA 4C3LA 2BVZA 2R2UA 2E5GA 2C2DA 1RCXB 3DRXA 1AXQA 2E5IA 3U7JA 4CT9A 4KFBB 3OH4A 4LFAF 1L3UA 5CXTA 3B4MA 3R5DA 2GGPB 1YI2S 3PRVA 2VG6A 3DGVA 5A0YB 2Z0GA 1KOHA 4ECTA 4PEOA 1OO0B 3T6JA 2CJXB 2CPXA 4K4SA 4IOCQ 3FZ2A 2JXDA 5LSRA 4KFBA 2WVBA 5BYSA 3EGWB 1Y11A 1SVDA 2GGPA 2OD4A 2XGQA 4B3MF 1KQKA 4DCLA 2YTCA 4DXLA 3CMAS 2FGCA 3LTOA 4WU2A 3F0NA 2HFSA 3D7SB 4HZCA 4KHRA 2D9PA 2RH3A 3G87A 1IBLJ 4MAKA 2YQ3A 1U0SA 2PEBA 2F40A 4B3OA 5KFIA 4LIRA 3DLEB 1U1LA 4QOTA 1RZMA 1SQGA 8ATCB 4C3MA 3GUEA 3W5YA 1V1IA 2YY3A 1MMDA 4PQUB 2FYXA 1AUDA 2D3OR 3DLEA 4G87A 4OI1A 2N7CA 1GMWD 1QUPA 3PYFA 1RHRB 4OZNA 2L9DA 1RT4B 3FRYA 3L7UA 2AJ0A 2BA9A 1VCTA 3PKMA 3FBFA 2JFKA 4Y2CA 5JHWC 5KG0A 4PQUA 2BR0A 5CH7B 4LF1A 1CJUB 1F6TA 1KK5A 5GAGU 2VHEA 1FKOB 4ENOA 2DHSA 2FJBB 2HK3A 3Q83A 2HQIA 2OSRA 1RT4A 4QQBA 4TY9A 4O4GB 4ZCKA 3JQYA 3FCWA 4DFJA 4EUVA 4EA8A 3FSCA 1QUVA 2M0GB 1NU4A 1ZM2A 2LUYA 3BO2A 1CJUA 2KYZA 3MFHA 5H9EK 3EM1A 1GMWA 5DG9A 1K8AT 1FKOA 3GIMA 3FNNA 4JI4J 4M5JA 1VI7A 2O3DA 3GCXP 4W4MA 2QEXS 2YQ0A 3MAQA 3T1HJ 3K0JA 1YQHA 5DGAA 1CULB 4ZCMA 1PTRA 2IM1A 3DU5A 2VPZB 2PMHA 3GJSB 5GMKa 1SSMA 1X4EA 2WVDA 3P3DA 2DNRA 4KPCA 3FVYA 4RLEA 4WFXA 4AL6A 3QJPA 1IN0A 1CULA 2AYMA 1HWJA 3CCMS 4F4WA 3H20A 3UCGA 1RT3B 4JI0F 3TO9A 5KFDA 4NLTA 4OJGA 2I6WA 2CFXA 4LF8F 1OMSA 2V4JB 4J5OA 4KPXA 1OY6A 1NBEB 2BEFA 2P9EA 3KLEB 2FJWA 3POTB 1YKWA 1S1XB 3VBJA 4FS1A 1S77D 3B8HA 1VQPS 4RBVA 1RT3A 4N7TA 2NREA 1Q7YT 3OVOA 2G2YA 1P8GA 5DDRC 2V4JA 4HL9A 4CO4A 2W8KA 4CH7A 1SGNI 3BSAA 2LQBA 1NAQA 3KLEA 3POTA 5T14A 1S1XA 3GV8B 4DV1F 5DETA 4PWUA 2GHPA 2JJ4D 2DNQA 3MAAB 3I5CA 5EWEA 1PYOB 2XS7A 2MZQA 2ALYB 5J1PA 2XMTA 2MYFA 2DNMA 1N5TA 1KFDA 2HNYB 4E2FB 2OKQA 3UDLA 1RAHB 4HHHA 5U2KA 4XK8C 2AHOB 3QPIA 4LFBJ 4DQPA 5M2UA 3VZHA 3MAAA 2WRMA 3CMQA 3JQJA 2RB7A 3PHEA 1CC8A 3TW0A 3OVAA 5K8MA 1N5QA 1SIWB 1JQGA 4MFBA 1KMAA 4R25A 2AEFA 2HNYA 4WXWA 4M5MA 2WTFA 4N77A 4ILMA 5CHCB 1Z7KB 4OZ0A 4F8RA 2RQKA 1XMQJ 2KN4A 1CQNA 2MQOA 3QBCA 3D2WA 4DUTA 4ZVSB 3D98A 2P6TA 1KD1T 5FUVA 4YFUA 3JB9k 3C16B 3KWEA 2UXBF 4LVOP 3NAHA 3M6WA 3R27A 4BHQA 1SGYI 4DWIA 4C0HA 4EYHB 3UR0A 2ZH6A 3DYAB 5KG4A 2C3OA 1FVQA 1S80A 1CSOI 2P9GA 3C16A 3ZTRA 2B4UA 1H2VZ 1OPZA 3NLCA 2Q3PA 3NKYA 1EIYB 2Z30B 2KHCA 2E1PA 2JC1A 2NZ4A 1ROFA 1RHJB 4RWXA 4DSIA 1DS3I 3DYAA 2AJFE 4KGVB 3RUBL 1TDTA 1EETA 3CNQP 1G3OA 3BN7A 2BMBA 3C2PA 4NXMF 3ZXWA 2V6AA 7AT1B 1YZ6A 3NMAA 1U02A 3KLVA 1XNRJ 1UFLA 5IT4A 2ADBA 1RHMB 3QWUA 3P49B 5D77A 4U9RA 2HQFA 4PYDA 1KGQA 2CRLA 4NLYA 1YBTA 2RJZA 2AIRB 2CA9A 1Z1ZA 3DLKB 3MDFA 3CCUS 2KFYA 4G65A 1KBEA 4FPRA 5IOLA 5I42B 3OXFA 1X31C 2HHHF 2ZH2A 3CD0A 3H7HB 2VOOA 1HHQA 4ZVGA 4I56A 3PRBA 3OL9A 2VD4A 2DXDA 2E29A 2F3JA 3M6UA 3DLKA 2YX7A 2L9NA 3SDEB 1HNZF 1OCXA 5I42A 1UETA 2DB6A 4AT1B 2EBGA 3DXBA 1LR7A 4HCQA 3WHIA 5L46A 2ZC3A 1IVZA 2MZTA 3I56S 1SL0A 1H2TZ 4DDFA 2IPOB 4OX8A 4ZIVA 2BKPA 2FLLA 2E1RA 5KFSA 1VIOA 4NCAA 3Q2TC 3SDEA 1QDUB 1LNQA 3QQCD 5B0BA 5F3ZA 3PV8A 1AYEA 4CO2A 3SSRA 3NGUA 4DL5A 2JYYA 2GKRI 4KBIA 4DX5A 1UEVA 4YHHF 1YITS 2FZGB 3LANA 4OHZA 4DR2F 1X4GA 3CTRA 1W7WA 3G6ES 3SYZA 1EX8A 3EMTA 3PEHA 2XS2A 5IV4A 1XBTA 2YQPA 2AYGA 2NXCA 1M8NA 4QWDA 3CDBA 1S59A 5K20B 1R79A 4Q43A 1M5PC 1Q8LA 2FHOB 1KNZA 3HVWA 2JA1A 2JW6A 5DZ6A 1EARA 3UFCX 3KJQB 3CJ4A 2TDTA 3PM9A 5ETQA 4I64A 3TEGA 3H40A 1LV5A 1F9HA 1GT8A 1U2FA 2E1AA 3IR7B 2UUAF 3DNCA 1U8SA 2C22A 1FNMA 4OHWA 2GIVA 3QZ8A 2JLFA 4X65F 1NB7A 3CSKA 3HJJA 1TL7B 1R6VA 1DAXA 4UUXA 1SGDI 2IJRA 1SGEI 4EGLA 4A8QA 1YP4A 4P75A 1LWXA 1XR7A 2BW2A 3VF0B 3G71S 3WBZA 4A8OA 4A8SA 1KBFA 2JOQA 1TL7A 1XEZA 5E3AA 4ECYA 3GR1A 4F7VA 1JX4A 5L38A 3MC4A 3DU6A 1CGJI 1B7YB 2EVZA 1NK9A 4N56A 2L48A 3GFXA 4IRCA 5KFUA 2OMOA 5GADU 3JSMB 1V3WA 2Y8WA 2O67A 4MJKA 1WKKA 1NK8A 1FO1A 3TQ1A 2B7CB 3R6LB 3WC2A 1N4IA 2DEIA 1OY8A 1QREA 1TGSI 1HKAA 2C2MB 5HJXA 3H25A 2B8TA 3JSMA 5HL7Q 4RW4B 3Q8RB 4J9QA 4AYBD 1VR6A 2YKQA 3FGVA 3UI3A 2QC3A 4Q7AA 1U1NA 2AGPA 2DNNA 2ZZNA 2FLPA 2XTJP 2H3EB 2AQ9A 4ZVHA 2KZZA 2LEBA 4DSLA 1JK9B 4CLLA 2QQ0A 1VQ5S 1T9VA 4OZJA 1R0AB 3G8TA 4RW4A 2NSBA 2IM2A 3MCMA 3O5TB 3W65A 2JF3A 1RWUA 2PA8D 3J7YU 2V50A 3EGZA 3IXCA 4MYUA 2JDJA 3NP5A 1FEHA 2UU9F 2O5DA 1HNVB 1R0AA 1KRUA 3DLHA 3VAMA 2OTLS 3U02A 1AROP 4HR2A 3LGMA 1R0RI 1U09A 2DR7A 3OSPA 2SXLA 4ANEA 2Z2MA 1HNVA 2W2QP 2XZWA 2HZVA 2ATLA 2SGQI 4TYAA 3G4SS 2VBZA 4FYDA 1VQMS 1GTHA 3BPSP 1LWEB 5HBMB 4KSEB 3KK2B 3KG1A 1Q86T 4J9LA 3G6YA 1B3TA 1RJJA 2XHCA 1BD6A 4USTA 2DKVA 1CT4I 2GMHA 1C1BB 2P2CB 2DIUA 4FBUA 1LWEA 3MR6A 5HBMA 3KK2A 1JLEB 4UQGA 3G96A 4ILLA 3CDWA 3ENQA 2XY7A 1YG0A 3CXCR 2F8HA 2ILZA 1C1BA 4PCQA 2QRRA 4ZLJA 2CWFA 2ZEJA 2VA2A 1LR8A 1J5OB 1JLEA 1LXAA 2AJ4A 2QL5B 3IWXA 5ETLA 4LIWA 4QU6A 1ZTWA 4FF1A 3QGPA 1HNXJ 3OJSA 3CCVS 3O1LA 1PAEX 4CZCA 4WCEQ 4UY8T 1MT1A 1SPBP 3MHYA 3TUPA 2F4VJ 4ZVPB 4ICLB 3GIIA 3U1LA 4EABA 3V6JA 3PNIA 1O8BA 3BRKX 1FWKA 2R7SA 2OFHX 2YKPA 4XPCA 2OEGA 3R2WA 1JIHA 4DG1A 1QE1B 1NK6A 2VF3A 1TKTA 4W90B 3RZAA 2HEKA 1RAEB 2HVIA 4FBTA 1N32F 4DU8A 1IKYA 2W9CA 4QWBA 4ELUA 2F8MA 1UVJA 2VQEF 3QTLD 3RW7A 4I4BA 3L09A 4HTIA 5ETPA 1QE1A 3EDRB 6AT1B 1RTHB 2LB7A 5EGYA 3W61A 2D9OA 3TO7A 5ADXV 1U2RA 2J87A 5BR8J 2GQQA 4PG4A 2B7BB 5J2QB 1UA1A 1RTHA 3BO4A 5D0EA 2JVRA 1S1VB 5KT3A 2MJNA 1D8YA 4DJBA 4NLVA 1Q0NA 1ZPWX 4MIAA 2UVVA 3JQMA 3W7BA 2E5RA 2OHDA 2N52A 2YX1A 1FKAF 1SGQI 2P9CA 5KFNA 5HQ8A 1X4BA 4L72B 1AN1I 2HGNA 5J2QA 3BJIA 3LP1B 2QMUB 2CXEA 1WOOA 3OSNA 1FE0A 2W4PA 3H2VE 1S1VA 4HYKA 4ID8A 3HDSA 2CPFA 3C6TB 2NXJA 1S1WB 3D68A 4FS2A 3R2CJ 2HVZA 2L3MA 2YQ1A 2DNZA 5C42B 1FXJA 2VBYA 1WI6A 3TA0A 3LP1A 2X3DA 1YJTA 3ET6A 3VBIA 5FDLB 1DTTB 2FIUA 4QU7A 3BQ1A 2C2ZB 2MLXA 4DPUA 2HWIA 4HLBA 3C6TA 3FC9A 1S1WA 4YY3J 1RB0A 4Q8FA 5DLGA 3THPA 4HVZA 1GH8A 2V0IA 1PTQA 2CDRB 5K14B 3W5ZA 4USJC 5FDLA 1DTTA 3FDSA 2IMOA 3CO0P 4LR7A 1UVLA 1P27B 1GK8A 4DFMA 4KHMA 1R8BA 4WTOB 1SJ4P 4X4PA 2FPHX 2VBWA 1IBLF 5K14A 1NK5A 3ZZTA 4MKAA 3PIPQ 3LA0A 1RFHA 5J2MB 5C24B 1FJEB 3L3CA 2QO3A 3H2LA 4I68A 5KFKA 4XDCA 4GKJJ 1NJZA 4K5SA 2CQ3A 2LQ5A 3QFWA 1UVIA 2KJVA 4NEYA 5J2MA 5C24A 4ZN1A 2HAIA 4PKDB 1RKJA 3FZBA 2XSFA 1U25A 1BWVA 2HHQA 2WONA 1XHDA 1LW0A 2IFXA 1OYDA 3MI7X 4ZLNA 3AXMA 1N4LA 1FI4A 1CC7A 3VV2B 2DBBA 4K50A 1WC3A 2AKWB 3VGSA 3MMBA 4JV1A 3SCIE 1FK9B 1OYVI 3L95X 4WZQA 4OZ5A 2GO9A 1LK5A 5LL6d 4JV0A 2A2DA 2B4OA 1FX4A 3HMJG 1Z2IA 1FTRA 4KQLA 3D0GE 1NKCA 3HO1A 4CCHA 3UGDA 1ZYQA 1FK9A 1O51A 1XC9A 4JI4F 4QIEA 3OUYB 3AB4B 1SV5B 4J7CA 3M7VA 1UPPA 3T1HF 2AX0A 4YQWA 4H4KC 2GIFA 4YDDB 4ED2A 2HHTA 2GQCA 1WG5A 3V2UC 2RDDA 1O6XA 4HHJA 2GC8A 1EQMA 1Q78A 1NH7A 3FQLA 3GJQB 3OUYA 3HKWA 3VBMA 1SV5A 3VCDA 3D4JA 4BCAA 2AV5A 2XHWA 3EEVA 3PZPA 2KMRA 2HQ3A 2G0CA 4LR8A 4WP3A 2BE7D 2VV5A 4EI2A 2HQDA 5CAAA 1ZOTA 3ECTA 5HVHA 4OYWA 2V5HG 3OBIA 2XQCA 4KRWA 3I87A 3FMBA 2V9KA 2Z2YB 3HHKA 3QYYA 3BGLA 4LF9J 1TUVA 1ZM3A 3IWLA 3D5MA 2DNHA 3EPIA 2V53A 4EA7A 1S99A 3TAMB 4IR1A 3BR9A 1SCJB 2AP6A 1P1LA 1FWYA 3MMCB 2I9SA 3MQHA 2CJSC 1FDNA 4K0KJ 3M8WA 2H48B 4V1Ak 5KT6A 2HS4A 2KG1A 5HI7A 2Z8QA 3TAMA 4LF2A 1WKLA 1VQYA 1BUSA 3BYRA 5CYJA 3M2VB 2M5XA 4NASA 1KFSA 2VFSA 2M70A 3DRRB 7FD1A 1HI1A 4LFBF 2A1BA 2KXFA 1VK3A 3IMQJ 4FKDA 1F9EB 3M2UB 3DRYA 1TBRR 3M2VA 3VR1A 3D66A 5M2PA 3TNVA 3DRRA 1WTBA 3MAHA 3SV4A 2XMKA 4P7TA 5HK4A 2M52A 1XMQF 2V0KA 3GOSA 1BQNB 1VC5A 3M2UA 3DDKA 4K4YA 3KHRA 4HKQA 5A76A 3EICA 4I1TA 3ENWA 3BYPA 2XMMA 1MR7A 2BRLA 1BQNA 1U1MA 1KK4A 4LF7J 2POKA 1Y1CA 4QIFA 2CYYA 3R2DJ 3SQGB 2VUGA 1CEZA 5KFAA 4Q5VA 1XX6A 1FDBA 5LXRA 3FSIA 1E6YB 1WGCA 3D6HB 5ETVA 2HS3A 4OX9J 2W7OA 5F8MA 2R42A 1T05B 4FXVA 3IRXB 2CPJA 3SQGA 3PX4A 3LP0B 1EZZB 5D0HA 2XG8A 3SMZA 3SBMA 1XNRF 4BC7A 4Z37A 5E7OB 2QYCA 4QYZK 1E6YA 2B8PA 1IR0A 2ZZMA 1UTAA 3Q89A 4HUSA 2M7SA 4P9SA 1T05A 1FESA 3K2YA 1LW2B 3IRXA 1RWMB 1YK9A 4NZ6A 1XIQA 2CNKB 1SI9A 1J2VA 2VC1A 3TDTA 4N76A 3QAUA 4ZP7A 3J7Z5 1LW2A 3W63A 1R7IA 2HVDA 5DQGA 4O3OA 5F8IA 2JEGA 1VQNS 1RWXB 4DV4J 3OXGA 4TYBA 2F63A 1QSSA 4LREA 4GC6A 2MMYA 4K4XA 2V94A 3GQ7A 2RU3A 1NDKA 3ZNUA 2RRBA 3QMQA 5CABA 3ETOA 2QLBB 2B3TB 3M1VB 2KMQA 2R4FA 2WK4A 3NS6A 3MCSA 2F9DA 1QSLA 3N28A 4FZVA 2MJUA 2PFFB 1VS3A 3BN4A 2AGOA 4KH1B 2W0TA 2Y0SD 1ZAXA 3MUVP 1R8PA 3M1VA 4I2QB 1H2UX 4EBDA 2HWTA 2X1FA 3KOAA 3HHDA 1JKHB 1VQ9S 3T5JA 3NL0A 5CCLA 3PR4A 5L1KA 2GAHC 3ILOA 4JOUA 4R37A 5AFUU 2DY1A 5U47A 2RUGA 3Q8PB 2WW4A 2B43A 2JSXA 5KFZA 5D0GA 5D78A 5E41A 4DL0C 5I4MA 3A8KA 1JKHA 3GVDA 2EK6A 2V68A 3U1NA 4KHPJ 2E73A 4Y2AA 2QZ8A 4F4YA 2BACA 3SI8A 4DCJB 1X9SA 2BBEA 2OVOA 2CNNB 1RWPB 4UOHA 4U6PA 4ECQA 1MN9A 3N6MA 3WZ0A 1SB6A 4F4XA 2Z58B 1S12A 2E9ZA 1UW9A 2HFNA 2W0VA 3TO8A 2RU9A 1WEZA 1WKJA 2E5LJ 1RTJB 1Q79A 2M8HA 1ELOA 2HPUA 2NUHA 1VLOA 4K8RA 5GADI 2UVWA 3U27A 1Q9BA 3SRTA 1Z2LA 1W26A 1GNKA 1R3NA 4USHA 5IM0B 2CZ9A 2AU0A 2CDQA 4B02A 1JJCB 3L4BC 1RTJA 4GMKA 4USMA 4IHGA 1KTVA 4ED4A 2W9AA 3GPAA 1P6TA 4FXWA 3W5XA 5IM0A 1X5SA 1RLDA 2VL1A 3K8WA 2CQBA 5A2QY 4J9RA 3EGNA 4K4TA 3G9CA 3EXYA 5SUHA 2IJNA 4ZPCA 2MSTA 2GJFA 2OI7A 3TQEA 5KG7A 1WORA 4OYBA 4GKKJ 1M5KC 4OJ3A 1WEXA 4FP9A 2QSWA 1T9YA 5T7LB 2Z57B 2AZ1A 4JI2J 2LYVA 1B4SA 5AXMA 1NCLA 5G0RB 1YJRA 4I6AA 3RBZA 1U45A 2GKTI 2VU5A 1QVGR 2V2KA 5FJ4A 3HSGA 1FFGB 5T7LA 1AFJA 1RT6B 4ITSA 4NXNJ 2DRDA 4J09A 2V1CC 3D54A 5F0UA 1SKWA 2V34A 2MLZA 2CWGA 2HGLA 5CA5A 3BKUA 1WG4A 3ZZYA 3J7A1 2R7VA 3KDNA 1V5VA 3P5TL 3T9NA 4ECSA 4DN9A 1NZ8A 4RNMA 4ZJLA 2FHKA 2V0LA 1OVOA 5KFTA 3I31A 2EG1A 4UTGA 2WLCA 1RT6A 3UEYA 2R7RA 3NEKA 5JMNA 3UFFA 4IOBA 3IGNA 2XY6A 2QFJA 4LUBA 3TP2A 4G3PA 3GG1A 1YLXA 2PN6A 4L76A 5LM7E 3CO9A 4DL4A 3NCQA 3PW5A 1VJQA 4FKXA 4USVA 5DM7Q 5EX0A 2A6MA 1Q8KA 3IBWA 1WC4A 4EU0A 4E98A 3F73A 3I3XA 4AC3A 3G8QA 2OD1A 3Q23A 2ERRA 2AJ2A 1TK5A 2XEXA 5D4NA 4DR4J 1VGYA 2HHWA 1NLKL 4DPWA 2A18A 1NSQA 1F5AA 2VC0A 2KRBA 4DF8A 2FTRA 3PJXA 2EW9A 2LXFA 4DV0J 4NEZA 5FUWA 2AEJA 5DDPC 5J2NA 4R0EA 1HDLA 4A46A 1RP5A 3RRHA 3MF5A 1NSKL 5DGBA 4DS4A 4A48A 4NMLA 5IT9Y 3E01B 4IH6A 3C66A 3ZC4A 4LF6J 3GFHA 1Q1KA 3GIRA 3GTYX 1MJBA 2DHHA 5D15A 3HSJA 5CZVA 4QIWD 1HNXF 3QAEA 2QQEA 3D28A 2OI5A 5B7WA 3E01A 5HSPA 2F65A 2NU3I 2EFQA 4E1PA 4FPIA 1SC4B 4TLQA 4EYIB 3VVUA 3KMQA 2ZVIA 2F4VF 1BHNA 1H38A 1U6FA 1S9GB 1HQEB 5E5NA 3OR2B 5CD4A 1A9NB 2CG4A 2BE2B 5HROB 4O0NA 3ZZZA 5B08A 1HBNB 1K44A 2LMIA 3VZIA 4URQU 4M2AA 3P6YC 1S9GA 1HQEA 2GVZA 2KHDA 4H4MB 5CQGA 1HHSA 2K3IA 2BE2A 5HROA 3T5LA 3OV7A 1U1KA 2YKAA 1X9MA 1HBNA 3HFZB 1RTDB 3AODA 1WKXA 2UXDJ 3GV5B 3M8PB 4H4MA 2MQPA 5CYQB 1LEOA 4MFGA 1G2EA 3F41A 5BR8F 5KFOA 3TOQA 3I55S 4C4WA 4ETXA 3FRZA 2KKHA 1DJ0A 1SL1A 2HIQA 3M8PA 2HBQB 3CCES 5CYQA 2BANB 2X7IA 1PYSB 3DHWC 2IMWP 3TJ8A 4LFCJ 3CD7A 1IR1A 1NPKA 2W25A 2DGTA 4OQJA 5I3QA 1XR6A 3PW4A 1IBCB 2WLFA 3P5BP 5EX3A 3AD7C 2BANA 2G2ZA 1VQ7S 4LF5J 3KJVB 2XO6A 3R7BB 2NPOA 4EK2A 1QQ0A 3IAM9 1PBUA 4NRTA 4GO5X 2ROEA 2VH7A 2M4MA 4YY3F 4ED7A 2RAQA 3KJVA 5A8RB 1TL1B 4CLKA 1TK8A 1TAQA 4C11B 1RQ0A 2DR5A 2KT3A 1KRRA 4WE1B 4WZMA 4CLFA 3PO4A 2ZH5A 4AMLA 3MOJB 3D8VA 3VAKA 4RU2A 2H4YB 1P1TA 4CO1A 1N54B 5A8RA 3SGBI 1ULRA 4GVBB 4C11A 3MEGB 1D0EA 4QIGA 1Y3JA 4P73A 4NA1A 3KTQA 1NKEA 2H4WB 3BSSA 2VICA 4AFFA 2XI3A 1P9ZA 4GVBA 4A8YA 4GKJF 2CQCA 3PKYA 3MEGA 4B3SJ 3OTMA 3SIPB 4Y2IA 1HA1A 3ICLA 3DHOA 2ZBRA 4NLSA 1KK6A 2ALZA 1SXLA 1HEVA 3AJ2A 2KT2A 4QR2A 1HR0J 1UMJA 3BFPA 2YNFB 1U1RA 1U24A 4ECZA 3QGGA 3BDPA 2DJWA 2HMIB 4DFPA 3HI9A 4ELVA 4NOHA 4CWBA 2OSQA 1DQ8A 2JL9A 1IQTA 2I38A 2JX2A 4X4RA 4IOAQ 2KI2A 4OX7A 2HSEB 5K8OA 2OGUA 1CVJA 2LP4A 2CIMA 2DGSA 2ROPA 1S4EA 1YTYA 3MM8B 2HMIA 1FT8A 2XWYA 2BYCA 3LF0A 1CJVB 1Q16B 3HHNB 4EA9A 2CZVC 1RCOB 2ROGA 2UUTA 3GZ7A 3V6KA 2WAQD 3D00A 2UV8A 2F3CI 3LP2B 2AWZA 2VZ9A 4NLQA 2EXUA 1H98A 2BDPA 5DM6Q 3MM8A 1SJ1A 1CJVA 3I3AA 4Q44A 3AOBA 2GVDB 2CQ1A 3UOEA 1IY6A 5B0GA 3LP2A 1QRMA 4R8UA 4FDFA 1NUBA 2EK1A 1GEHA 1HLWA 2CJBA 2JZ5A 4X62J 1X5OA 2DKOB 2UXCJ 2NYIA 3TISA 1VBKA 2GVDA 4UY85 4ZLPA 1GAOA 2XB2D 4KNRA 4KAIA 1K7UA 1S57A 2ELIA 4LT6A 2HRUA 5IC4B 4DMZA 1IUJA 1RBLA 4N6BA 1W2BR 4NA2A 5KT5A 3QATA 4B9NA 1X7VA 2CKWA 4LF9F 2OU2A 2OTJS 5KFLA 1YJUA 3M05A 2FJXA 1QRLA 5KAKA 3E8OA 4M94A 4QBUA 1G4CA 4URGA 1RBOB 1WF1A 2MEWA 2WBMA 4HGUA 2SGFI 1HJAI 3T1YJ 3MR2A 4K0KF 1QY7A 3JTNA 3PY8A 1LWCB 4ZHRB 4OV6A 4ID5B 8RUCA 1TELA 3JSYA 1JJ2R 9ATCB
chains in the Genus database with same CATH topology
4UW2A 4BC9A 3VBLA 2EVZA 1NK9A 4N56A 2L48A 1Q8BA 3GFXA 3CDUA 4IRCA 5KFUA 1DLOA 4MH8A 1SUQA 3PRDA 1OS5A 3H4DA 2R2RA 2W9BA 4O3SA 4ZPDA 1LWCA 4ZHRA 3Q8QB 3BR8A 2OMOA 1I1GA 1N5SA 4NLUA 5GADU 1UFWA 3JSMB 1V3WA 3BSOA 4MIBA 3RB3A 2BJDA 3V5RA 1FJGF 1V3SA 1LKZA 2O67A 3MEDB 4MJKA 5HMYA 1HHTP 4PXBA 1NK8A 1FO1A 3TQ1A 2B7CB 4DFKA 2OPQB 4M98A 3J7ZT 4ID5A 1GXTA 2LECA 3WC2A 2CPEA 1Y3KA 2YH1A 2MKJA 3PXGa 3GB0A 2DITA 1QREA 1FRLA 2K7JA 2FLNA 3H25A 1PC4A 3W3SA 1T3NA 4DQSA 1WHYA 1NJYA 2YWGA 3TRGA 3B4DA 1SIZA 3JSMA 5HL7Q 2ASLA 2DNLA 1ZM9A 1VC0A 4RW4B 2IBOA 4M5DA 4E79A 3Q8RB 5F8JA 3TV0A 4J9QA 4AYBD 2RS8A 2YKQA 2VODA 3FGVA 4X4SA 2OPQA 2VPXB 2VOPA 3UI3A 1YP2A 4Q7AA 4KTQA 2DGWA 1U1NA 2AGPA 2DNNA 2ZZNA 4AL5A 5AFUV 2LU1A 2FLPA 4ED5A 2LQJA 1X4CA 2GNKA 1WTFA 2HHPA 3OHBA 2EPIA 2HZCA 1U47A 3QO9B 2AQ9A 1FD2A 4ZVHA 4QCLA 1HQUB 2AGQA 5ADXU 2KZZA 2BM0A 5E3CA 5HMXA 2N7YA 3E3XA 4DR1F 2LEBA 4DSLA 1JK9B 1U7LA 2ZE2A 1VRTB 1VQ5S 3FMWA 4OZJA 3DRSB 2IRXA 2XMJA 1SC6A 2CPHA 4O4GA 4AXIA 2MSSA 1R0AB 3G8TA 1DFDA 1R8CA 4RW4A 4RW8A 5DJBA 2NSBA 1IBKF 4Q8EA 2IM2A 3O5TB 4MMOA 3IC1A 2J0SD 5CZXA 4LF7F 2QIFA 3LPYA 2IC3B 3CWJA 2JF3A 3DN9A 5I3UB 1RWUA 1SBRA 5IFMA 2PA8D 1RYSA 3PW7A 4WIIA 4CH1A 4MYOA 3QO9A 4KO0B 1NHVA 3J7YU 1L5UA 3IXCA 3G6VA 1U48A 3EGZA 4ERDA 3I4PA 2YKOA 2DHXA 4MYUA 1VRTA 2JDJA 3NP5A 2GJIA 3NAIA 4ZVFA 4WKYA 1D1UA 1FEHA 3DRSA 2UU9F 4WK3A 2O5DA 3CJ0A 4IH7A 1HNVB 3TWDA 1R0AA 1KRUA 2CVEA 5ADZA 3VBKA 3DLHA 3VAMA 3SFGA 2XY5A 2OTLS 2W7AA 4O23A 4OX9F 1HBUB 3U02A 2ZHAA 2V8DA 2IC3A 4FNHA 1KR4A 3EH0A 2E1CA 4KGMA 5I3UA 1TAUA 4F3OA 4H4KA 1AROP 2CVIA 3F44A 3DLBA 4NWBA 3R5AA 2KDOA 4J9KA 3LGMA 3DFEA 3RRGA 2EFVA 1QM9A 2WW8A 1U09A 2DR7A 4I2PB 3ULHA 3OSPA 2LA4A 2SXLA 3UDCA 4DL3A 4C0OC 2Z2MA 2KB2A 1KS2A 1HNVA 1S0OA 2HLTA 1MMNA 3CPWR 2VONA 4B9LA 2IVYA 1DHMA 2XZWA 3H5XA 1Y0HA 3T6BA 3KKFA 4JBCA 3PR5B 5G4DA 1X9WA 3SCLE 1NZAA 2ATLA 4AA7A 4TYAA 3G4SS 2VBZA 2ZNYA 4FYDA 1WHVA 4DV2F 2YVSA 5KOWA 3NRBA 4YDXA 4MTPA 7FDRA 1VQMS 1GTHA 2GO8A 2G9OA 4F2RA 4FF3A 1VJWA 3SCJE 4C9DA 2IM3A 3MURP 1LWEB 4EAAA 2C3UA 4ES2A 2B0GA 4I2PA 4KSEB 5HBMB 2K2PA 3KK2B 3I32A 2DNPA 3KG1A 2ZH8A 3HF5A 3PIOQ 4J9LA 3G6YA 1Q86T 1C4AA 4JV2A 1M0SA 1RJJA 1NNDA 3PDNA 3PJWA 1D8ZA 4C8YA 3HJFA 1BD6A 1HM0A 1BLUA 4LQ9A 3L7OA 1KEKA 2B9YA 2FVRA 2IJFA 1HD1A 4ZPTR 2GMHA 5D4PA 4ZPAA 1C1BB 2I1RA 4U7UK 1V9OA 5B0CA 3OR2A 3K59A 2NR0A 2G4BA 1LQ9A 1LXNA 2DIUA 3JYTB 4FBUA 1LWEA 5KFWA 3MR6A 5LMUF 1GXLA 5HBMA 3HHLD 3KK2A 4KPZA 2BJEA 1JLEB 4UQGA 1RGVA 2MY8A 3WDOA 3G96A 2GFFA 3CDWA 4I6YA 3H5YA 3Q22A 4ILLA 4B3TF 1KRVA 1VQOS 3ENQA 2XY7A 4MK9A 2MZRA 4P6QA 5KFYA 3CC2S 1YG0A 1KLMB 2DCUB 4DV4F 3CXCR 1FA0A 2F8HA 5KFJA 2EFOA 2ILZA 1KRPA 1C1BA 1TR0A 4YB1P 1S79A 1Q82T 3TAPA 2O66A 4PCQA 4UUWA 2QRRA 2W24A 1DZ5A 1G95A 4OHYA 4KR0B 3JYTA 2VA2A 3O44A 2VB6A 4I7FB 3DOMA 2MHEA 5EWGA 1FRJA 2ASJA 3HHLB 1T8EA 1J5OB 1KTQA 1JLEA 4A8MP 1LXAA 3F1XA 2OLWA 4Y2MA 2RT3A 2VA3A 4HT5A 4K4WA 1K1SA 2AJ4A 2FC8A 3IWXA 2R9LA 1PO6A 1RTDA 1KLMA 3AJ1A 2J0XA 1T3DA 1W25A 4I0WA 4LIWA 1R6YA 5DQIA 4QU6A 3RR8A 3HVRA 1ZTWA 4NLRA 4FF1A 4F2SA 4J9NA 3QGPA 3OJSA 3CCVS 3EXCX 2KU7A 4OL8A 1G1XA 3O1LA 4OI0A 3SPTA 3TA1A 3OTCA 4CZCA 2Y1IA 4CO5A 2R7TA 4WCEQ 4I7FA 4UY8T 3HHLA 4OV1A 1RT7B 3SFUA 3MHYA 3J81Y 1KQAA 3UQSA 3G8SA 1LK7A 4RBTA 5L9XA 2ZHBA 5DS7A 1TFYA 4ICLB 3GIIA 3U1LA 4EABA 1HBOB 4OHXA 3V6JA 5HP1B 3PNIA 1O8BA 3BRKX 4OX6A 2R7SA 1FTCA 4CNZA 2HGMA 2OFHX 4K5RA 4F50A 2CJ9A 4E6TA 3KHGA 3BO3A 4I67A 5BYRA 2FVQA 3AB2B 2ZH4A 1NRKA 2YKPA 3OW2R 4XPCA 2Q4JA 2OEGA 3R2WA 1JIHA 1Q8IA 2DNGA 5FIIA 3DLGB 4DN0A 1KQSR 1RK8A 4DG1A 3KLHB 1M5VC 1RT7A 4UQTA 2WOMB 3CCTA 1QE1B 1TKZB 1NK6A 1TKTA 3MM9A 3RZAA 4W90B 2DIVA 1UJ4A 4KC5A 2B4VA 2GA7A 2HVIA 2D41A 2YWHA 5E33A 4FBTA 1HBOA 2R2TA 3ZZRA 2UUBF 3MUTP 5HP1A 3OL8A 1N32F 4DL6A 1MMLA 3TIOA 1IKYA 1R43A 4YB5A 5D6GA 5A6PA 2LKZA 2W9CA 1KC8T 4QWBA 4ELUA 3IS9B 3MECB 4O3QA 2F8MA 2ZH9A 3VAGA 2ASDA 2ZH1A 1UVJA 3DLGA 2VQEF 3KLHA 5AE2A 3RW7A 3CDAA 3HVTB 3L09A 4HTIA 4I4BA 2WOMA 4OI4A 2XLJA