5EBXA

The crystal structure of erabutoxin a at 2.0 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of erabutoxin a at 2.0-A resolution.
pubmed rcsb
source organism Laticauda semifasciata
molecule tags Toxin
molecule keywords ERABUTOXIN A
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1989-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5ebxA00
1I02A 2GOOB 2H7ZB 2LCRA 3QB4B 1RGJA 3VTSA 2MFAA 1HC9A 3KFDI 4BDTB 1IK8A 2VLWA 2H7ZA 4DO8A 2UX2A 2PJYC 2QC1A 2HLRA 1HOYA 1KU6B 1H0JA 4OM4A 1CXOA 2L03A 1HAJA 1F94A 5DU1A 1IDGA 2CRTA 3LAQU 1IDLA 1CTXA 1CVOA 1MR6A 4ZQYA 2H5FA 2N99A 1HC9B 1TXAA 2JVEA 1FFJA 1NXBA 2BTXA 4RUDA 1KBSA 1FSSB 1KFHA 2CCXA 5DZ5A 1FSCA 1LSIA 2MHYA 4P7UA 1REWC 1W6BA 1ES7B 1ERAA 1NYSA 1BXPA 1TFSA 2J8BA 2CRSA 2H8UA 4XJJA 4IYEA 2BHIA 1CB9A 4UY2C 2LA1A 2QJBC 1CODA 1YWHA 2CDXA 3EVSC 1ZADA 1M9ZA 1QKDA 1IJCA 1COEA 2ERAA 2OFSA 1UG4A 3BT1U 5IMYC 1IKCA 1LX5B 3KFDE 3U73U 1KC4A 1PLOA 1NYUA 4BIKB 1FASA 4FAOC 5EBXA 2PJYB 1MAHF 5DO6A 1F8UB 4FAOE 1FF4A 1V6PA 1CXNA 2JQPA 1VB0A 1ERGA 1CHVS 2MJ4A 1TGXA 2H64C 2I9BE 2UWRA 1CDTA 1NTXA 1JE9A 3BT2U 1QKEA 1IQ9A 1G6MA 1LXHA 2MUPA 1L4WA 2H64B 1JBDA 1KTZB 3U74U 1KL8A 3HH7A 1KXIA 2X8BB 1LJZA 3ERAA 1CDQA 4HQPF 2MJ0A 1FRAA 1NORA 4LFTA 1B41B 1KBTA 4EY8B 1QM7A 2QJAC 1DRSA 2H62D 2QJ9C 1CREA 2MJYA 1KS6A 1NTNA 2HLQA 1ABTA 1CDRA 1IDIA 1LXGA 3NEQA 4AEAA 1TXBA 2FD6U 3FEVA 1XT3A 1KBAA 1CDSA 3EBXA 5IMTD 2GOOC 3NDSA 2H62C 4OM5A 6EBXA 1JGKA 3NH7A 2NBTA 2MUOA 1ONJA 2CTXA 3PLCA 1CRFA 2ABXA 1NEAA 2K3GA 1IDHA 1HAAA 1CCQA 1RL5A 2L5SA 1S4YA 4QTIU 1BTEA
chains in the Genus database with same CATH superfamily
1I02A 2GOOB 2H7ZB 2LCRA 3QB4B 1RGJA 3VTSA 2MFAA 1HC9A 3KFDI 4BDTB 1IK8A 2VLWA 2H7ZA 4DO8A 2UX2A 2PJYC 2QC1A 2HLRA 1HOYA 1KU6B 1H0JA 4OM4A 1CXOA 2L03A 1HAJA 1F94A 5DU1A 1IDGA 2CRTA 3LAQU 1IDLA 1CTXA 1CVOA 1MR6A 4ZQYA 2H5FA 2N99A 1HC9B 1TXAA 2JVEA 1FFJA 1NXBA 2BTXA 4RUDA 1KBSA 1FSSB 1KFHA 2CCXA 5DZ5A 1FSCA 1LSIA 2MHYA 4P7UA 1REWC 1W6BA 1ES7B 1ERAA 1NYSA 1BXPA 1TFSA 2J8BA 2CRSA 2H8UA 4XJJA 4IYEA 2BHIA 1CB9A 4UY2C 2LA1A 2QJBC 1CODA 1YWHA 2CDXA 3EVSC 1ZADA 1M9ZA 1QKDA 4KSNA 1IJCA 1COEA 2ERAA 2OFSA 1UG4A 3BT1U 5IMYC 1IKCA 1LX5B 3KFDE 3U73U 1KC4A 1PLOA 1NYUA 4BIKB 1FASA 4FAOC 5EBXA 2PJYB 1MAHF 5DO6A 1F8UB 4FAOE 1FF4A 1V6PA 1CXNA 2JQPA 1VB0A 1ERGA 1CHVS 2MJ4A 1TGXA 2H64C 2I9BE 2UWRA 1CDTA 1NTXA 1JE9A 3BT2U 1QKEA 1IQ9A 1G6MA 1LXHA 2MUPA 1L4WA 2H64B 1JBDA 1KTZB 3U74U 1KL8A 3HH7A 1KXIA 2X8BB 1LJZA 3ERAA 1CDQA 4HQPF 2MJ0A 1FRAA 1NORA 4LFTA 1B41B 1KBTA 4EY8B 1QM7A 2QJAC 1DRSA 2H62D 2QJ9C 1CREA 2MJYA 1KS6A 1NTNA 2HLQA 1ABTA 1CDRA 1IDIA 1LXGA 3NEQA 4AEAA 1TXBA 2FD6U 3FEVA 1XT3A 1KBAA 1CDSA 3EBXA 5IMTD 2GOOC 3NDSA 2H62C 4OM5A 6EBXA 1JGKA 3NH7A 2NBTA 2MUOA 1ONJA 2CTXA 3PLCA 1CRFA 2ABXA 1NEAA 2K3GA 1IDHA 1HAAA 1CCQA 1RL5A 2L5SA 1S4YA 4QTIU 1BTEA
chains in the Genus database with same CATH topology
1I02A 2GOOB 2H7ZB 2LCRA 3QB4B 1RGJA 3VTSA 2MFAA 1HC9A 3KFDI 4BDTB 1IK8A 2VLWA 2H7ZA 4DO8A 2UX2A 2PJYC 2QC1A 2HLRA 1HOYA 1KU6B 1H0JA 4OM4A 1CXOA 2L03A 1HAJA 1F94A 5DU1A 1IDGA 2CRTA 3LAQU 1IDLA 1CTXA 1CVOA 1MR6A 4ZQYA 2H5FA 2N99A 1HC9B 1TXAA 2JVEA 1FFJA 1NXBA 2BTXA 4RUDA 1KBSA 1FSSB 1KFHA 2CCXA 5DZ5A 1FSCA 1LSIA 2MHYA 4P7UA 1REWC 1W6BA 1ES7B 1ERAA 1NYSA 1BXPA 1TFSA 2J8BA 2CRSA 2H8UA 4XJJA 4IYEA 2BHIA 1CB9A 4UY2C 2LA1A 2QJBC 1CODA 1YWHA 2CDXA 3EVSC 1ZADA 1M9ZA 1QKDA 4KSNA 1IJCA 1COEA 2ERAA 2OFSA 1UG4A 3BT1U 5IMYC 1IKCA 1LX5B 3KFDE 3U73U 1KC4A 1PLOA 1NYUA 4BIKB 1FASA 4FAOC 5EBXA 2PJYB 1MAHF 5DO6A 1F8UB 4FAOE 1FF4A 1V6PA 1CXNA 2JQPA 1VB0A 1ERGA 1CHVS 2MJ4A 1TGXA 2H64C 2I9BE 2UWRA 1CDTA 1NTXA 1JE9A 3BT2U 1QKEA 1IQ9A 1G6MA 1LXHA 2MUPA 1L4WA 2H64B 1JBDA 1KTZB 3U74U 1KL8A 3HH7A 1KXIA 2X8BB 1LJZA 3ERAA 1CDQA 4HQPF 2MJ0A 1FRAA 1NORA 4LFTA 1B41B 1KBTA 4EY8B 1QM7A 2QJAC 1DRSA 2H62D 2QJ9C 1CREA 2MJYA 1KS6A 1NTNA 2HLQA 1ABTA 1CDRA 1IDIA 1LXGA 3NEQA 4AEAA 1TXBA 2FD6U 3FEVA 1XT3A 1KBAA 1CDSA 3EBXA 5IMTD 2GOOC 3NDSA 2H62C 4OM5A 6EBXA 1JGKA 3NH7A 2NBTA 2MUOA 1ONJA 2CTXA 3PLCA 1CRFA 2ABXA 1NEAA 2K3GA 1IDHA 1HAAA 1CCQA 1RL5A 2L5SA 1S4YA 4QTIU 1BTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I02 A;  2GOO B;  2H7Z B;  2LCR A;  3QB4 B;  1RGJ A;  3VTS A;  2MFA A;  1HC9 A;  3KFD I;  4BDT B;  1IK8 A;  2VLW A;  2H7Z A;  4DO8 A;  2UX2 A;  2PJY C;  2QC1 A;  2HLR A;  1HOY A;  1KU6 B;  1H0J A;  4OM4 A;  1CXO A;  2L03 A;  1HAJ A;  1F94 A;  5DU1 A;  1IDG A;  2CRT A;  3LAQ U;  1IDL A;  1CTX A;  1CVO A;  1MR6 A;  4ZQY A;  2H5F A;  2N99 A;  1HC9 B;  1TXA A;  2JVE A;  1FFJ A;  1NXB A;  2BTX A;  4RUD A;  1KBS A;  1FSS B;  1KFH A;  2CCX A;  5DZ5 A;  1FSC A;  1LSI A;  2MHY A;  4P7U A;  1REW C;  1W6B A;  1ES7 B;  1ERA A;  1NYS A;  1BXP A;  1TFS A;  2J8B A;  2CRS A;  2H8U A;  4XJJ A;  4IYE A;  2BHI A;  1CB9 A;  4UY2 C;  2LA1 A;  2QJB C;  1COD A;  1YWH A;  2CDX A;  3EVS C;  1ZAD A;  1M9Z A;  1QKD A;  1IJC A;  1COE A;  2ERA A;  2OFS A;  1UG4 A;  3BT1 U;  5IMY C;  1IKC A;  1LX5 B;  3KFD E;  3U73 U;  1KC4 A;  1PLO A;  1NYU A;  4BIK B;  1FAS A;  4FAO C;  5EBX A;  2PJY B;  1MAH F;  5DO6 A;  1F8U B;  4FAO E;  1FF4 A;  1V6P A;  1CXN A;  2JQP A;  1VB0 A;  1ERG A;  1CHV S;  2MJ4 A;  1TGX A;  2H64 C;  2I9B E;  2UWR A;  1CDT A;  1NTX A;  1JE9 A;  3BT2 U;  1QKE A;  1IQ9 A;  1G6M A;  1LXH A;  2MUP A;  1L4W A;  2H64 B;  1JBD A;  1KTZ B;  3U74 U;  1KL8 A;  3HH7 A;  1KXI A;  2X8B B;  1LJZ A;  3ERA A;  1CDQ A;  4HQP F;  2MJ0 A;  1FRA A;  1NOR A;  4LFT A;  1B41 B;  1KBT A;  4EY8 B;  1QM7 A;  2QJA C;  1DRS A;  2H62 D;  2QJ9 C;  1CRE A;  2MJY A;  1KS6 A;  1NTN A;  2HLQ A;  1ABT A;  1CDR A;  1IDI A;  1LXG A;  3NEQ A;  4AEA A;  1TXB A;  2FD6 U;  3FEV A;  1XT3 A;  1KBA A;  1CDS A;  3EBX A;  5IMT D;  2GOO C;  3NDS A;  2H62 C;  4OM5 A;  6EBX A;  1JGK A;  3NH7 A;  2NBT A;  2MUO A;  1ONJ A;  2CTX A;  3PLC A;  1CRF A;  2ABX A;  1NEA A;  2K3G A;  1IDH A;  1HAA A;  1CCQ A;  1RL5 A;  2L5S A;  1S4Y A;  4QTI U;  1BTE A; 
#chains in the Genus database with same CATH topology
 1I02 A;  2GOO B;  2H7Z B;  2LCR A;  3QB4 B;  1RGJ A;  3VTS A;  2MFA A;  1HC9 A;  3KFD I;  4BDT B;  1IK8 A;  2VLW A;  2H7Z A;  4DO8 A;  2UX2 A;  2PJY C;  2QC1 A;  2HLR A;  1HOY A;  1KU6 B;  1H0J A;  4OM4 A;  1CXO A;  2L03 A;  1HAJ A;  1F94 A;  5DU1 A;  1IDG A;  2CRT A;  3LAQ U;  1IDL A;  1CTX A;  1CVO A;  1MR6 A;  4ZQY A;  2H5F A;  2N99 A;  1HC9 B;  1TXA A;  2JVE A;  1FFJ A;  1NXB A;  2BTX A;  4RUD A;  1KBS A;  1FSS B;  1KFH A;  2CCX A;  5DZ5 A;  1FSC A;  1LSI A;  2MHY A;  4P7U A;  1REW C;  1W6B A;  1ES7 B;  1ERA A;  1NYS A;  1BXP A;  1TFS A;  2J8B A;  2CRS A;  2H8U A;  4XJJ A;  4IYE A;  2BHI A;  1CB9 A;  4UY2 C;  2LA1 A;  2QJB C;  1COD A;  1YWH A;  2CDX A;  3EVS C;  1ZAD A;  1M9Z A;  1QKD A;  4KSN A;  1IJC A;  1COE A;  2ERA A;  2OFS A;  1UG4 A;  3BT1 U;  5IMY C;  1IKC A;  1LX5 B;  3KFD E;  3U73 U;  1KC4 A;  1PLO A;  1NYU A;  4BIK B;  1FAS A;  4FAO C;  5EBX A;  2PJY B;  1MAH F;  5DO6 A;  1F8U B;  4FAO E;  1FF4 A;  1V6P A;  1CXN A;  2JQP A;  1VB0 A;  1ERG A;  1CHV S;  2MJ4 A;  1TGX A;  2H64 C;  2I9B E;  2UWR A;  1CDT A;  1NTX A;  1JE9 A;  3BT2 U;  1QKE A;  1IQ9 A;  1G6M A;  1LXH A;  2MUP A;  1L4W A;  2H64 B;  1JBD A;  1KTZ B;  3U74 U;  1KL8 A;  3HH7 A;  1KXI A;  2X8B B;  1LJZ A;  3ERA A;  1CDQ A;  4HQP F;  2MJ0 A;  1FRA A;  1NOR A;  4LFT A;  1B41 B;  1KBT A;  4EY8 B;  1QM7 A;  2QJA C;  1DRS A;  2H62 D;  2QJ9 C;  1CRE A;  2MJY A;  1KS6 A;  1NTN A;  2HLQ A;  1ABT A;  1CDR A;  1IDI A;  1LXG A;  3NEQ A;  4AEA A;  1TXB A;  2FD6 U;  3FEV A;  1XT3 A;  1KBA A;  1CDS A;  3EBX A;  5IMT D;  2GOO C;  3NDS A;  2H62 C;  4OM5 A;  6EBX A;  1JGK A;  3NH7 A;  2NBT A;  2MUO A;  1ONJ A;  2CTX A;  3PLC A;  1CRF A;  2ABX A;  1NEA A;  2K3G A;  1IDH A;  1HAA A;  1CCQ A;  1RL5 A;  2L5S A;  1S4Y A;  4QTI U;  1BTE A; 
#chains in the Genus database with same CATH homology
 1I02 A;  2GOO B;  2H7Z B;  2LCR A;  3QB4 B;  1RGJ A;  3VTS A;  2MFA A;  1HC9 A;  3KFD I;  4BDT B;  1IK8 A;  2VLW A;  2H7Z A;  4DO8 A;  2UX2 A;  2PJY C;  2QC1 A;  2HLR A;  1HOY A;  1KU6 B;  1H0J A;  4OM4 A;  1CXO A;  2L03 A;  1HAJ A;  1F94 A;  5DU1 A;  1IDG A;  2CRT A;  3LAQ U;  1IDL A;  1CTX A;  1CVO A;  1MR6 A;  4ZQY A;  2H5F A;  2N99 A;  1HC9 B;  1TXA A;  2JVE A;  1FFJ A;  1NXB A;  2BTX A;  4RUD A;  1KBS A;  1FSS B;  1KFH A;  2CCX A;  5DZ5 A;  1FSC A;  1LSI A;  2MHY A;  4P7U A;  1REW C;  1W6B A;  1ES7 B;  1ERA A;  1NYS A;  1BXP A;  1TFS A;  2J8B A;  2CRS A;  2H8U A;  4XJJ A;  4IYE A;  2BHI A;  1CB9 A;  4UY2 C;  2LA1 A;  2QJB C;  1COD A;  1YWH A;  2CDX A;  3EVS C;  1ZAD A;  1M9Z A;  1QKD A;  4KSN A;  1IJC A;  1COE A;  2ERA A;  2OFS A;  1UG4 A;  3BT1 U;  5IMY C;  1IKC A;  1LX5 B;  3KFD E;  3U73 U;  1KC4 A;  1PLO A;  1NYU A;  4BIK B;  1FAS A;  4FAO C;  5EBX A;  2PJY B;  1MAH F;  5DO6 A;  1F8U B;  4FAO E;  1FF4 A;  1V6P A;  1CXN A;  2JQP A;  1VB0 A;  1ERG A;  1CHV S;  2MJ4 A;  1TGX A;  2H64 C;  2I9B E;  2UWR A;  1CDT A;  1NTX A;  1JE9 A;  3BT2 U;  1QKE A;  1IQ9 A;  1G6M A;  1LXH A;  2MUP A;  1L4W A;  2H64 B;  1JBD A;  1KTZ B;  3U74 U;  1KL8 A;  3HH7 A;  1KXI A;  2X8B B;  1LJZ A;  3ERA A;  1CDQ A;  4HQP F;  2MJ0 A;  1FRA A;  1NOR A;  4LFT A;  1B41 B;  1KBT A;  4EY8 B;  1QM7 A;  2QJA C;  1DRS A;  2H62 D;  2QJ9 C;  1CRE A;  2MJY A;  1KS6 A;  1NTN A;  2HLQ A;  1ABT A;  1CDR A;  1IDI A;  1LXG A;  3NEQ A;  4AEA A;  1TXB A;  2FD6 U;  3FEV A;  1XT3 A;  1KBA A;  1CDS A;  3EBX A;  5IMT D;  2GOO C;  3NDS A;  2H62 C;  4OM5 A;  6EBX A;  1JGK A;  3NH7 A;  2NBT A;  2MUO A;  1ONJ A;  2CTX A;  3PLC A;  1CRF A;  2ABX A;  1NEA A;  2K3G A;  1IDH A;  1HAA A;  1CCQ A;  1RL5 A;  2L5S A;  1S4Y A;  4QTI U;  1BTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...