5F3QA

Crystal structure of a noncanonical dicer protein from entamoeba histolytica
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
192
structure length
184
Chain Sequence
SSTTLHNAMQYTAFDVLSSILNLMKADPLYDLLQDQEYEKNEFYGDSYLEERASSLVLKFLRKYEQIPFEMYSGLRIHTVKNQTLGEIFDLLHLGDTKTFEKKKKGDLVESLIGGCVLLSQRENATLFLLFAHALIDYIFYHSSYIYFNANPPKLVKEEIITDIQNWFKDKLFYYRSSLEKYQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Putative uncharacterized protein
publication title Structural and functional study of a noncanonical Dicer protein in Entamoeba histolytica
rcsb
source organism Entamoeba histolytica
total genus 71
structure length 184
sequence length 192
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-12-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...