5FJ4C

Structure of the standard kink turn hmkt-7 as stem loop bound with u1a and l7ae proteins
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
118
structure length
118
Chain Sequence
b'ASYVKFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINEGELRKELGSLVEKIKGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U1 SMALL NUCLEAR RIBONUCLEOPROTEIN A
publication title A Critical Base Pair in K-Turns Determines the Conformational Class Adopted, and Correlates with Biological Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 118
sequence length 118
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 5fj4C00
4BW0B 1VQ4F 1S72F 3NVKE 1VQ9F 1T0KB 5FJ4C 3NK7A 2VGNA 1K9MH 1Q82H 5EO3A 1NMUB 3CMAF 4BY9D 1CK2A 2VGMA 3CCVF 1VQLF 1VQPF 1YJWF 2I6DA 1QVFF 3NVIB 1VQMF 3VI6A 1YJ9F 3I55F 1VQ8F 5G4VC 1VQ5F 1YITF 3SIUA 3CCJF 5EWRA 3J81M 1VQ7F 5GANK 1JJ2F 4TZZA 2OTJF 1H7MA 5G4UC 5A2QM 4LCKA 3I56F 3G71F 1M90H 3PAFA 5IT9M 3RA6A 3E20B 1YIJF 1RA4A 3NMUC 3LWPC 1Q7YH 3HAXD 1KC8H 1X7PA 2BO1A 1X7OA 3OBYA 3VMFB 3CPWF 3CCQF 1K8AH 1W41A 2AIFA 1M1KH 3AGKA 2QI2A 1PXWA 1ZWZA 5GIPC 3CC2F 3CG6A 1E7KA 1CN7A 3CCLF 1GZ0A 1VQ6F 3CC7F 4C4WC 3OW2F 3LWOC 3CCMF 1GO1A 3LWRC 3J7AR 3LWVC 1YHQF 3NK6A 1VQNF 5FLXM 3JCMM 3SIVA 1W2BF 1DT9A 3RA5A 1GO0A 3IR9A 2OTLF 3ON1A 4X3LA 5GIOC 1QVGF 2FC3A 1VQOF 2OHWA 4X3MA 3LFOA 5GINC 3CCEF 2HVYD 1K73H 3CC4F 3E1YA 2KG4A 1IPAA 3CPQA 3FFMA 3CMEF 1VQKF 2QEXF 3LWQC 1NJIH 1X52A 1YI2F 3V7EA 5GAPK 2LBWA 1Q86H 2KTVA 2JNBA 2QA4F 3J80M 3CCRF 1W40A 1XBIA 3N4YA 3HJWC 2KTUA 3WXMB 3JAMM 2ALEA 2WALA 3V7QA 3O85A 3MCAB 3G6EF 1SDSA 1YJNF 3CXCF 3OBWA 1N8RH 1Q81H 3CCSF 3G4SF 3PLAC 3GYQA 1KD1H 3N4ZA 5DCVA 1W3EX 2CZWA 3CCUF 4NUTA 2OZBA 3CD6F 1W42A 2LBXA 1KQSF 1RLGA
chains in the Genus database with same CATH superfamily
3WGLA 1S72F 1PF5A 4BT3A 1KNKA 3S0YA 1U43A 3UT5A 1T0AA 5EIBD 3S0HA 4X1KB 3RYHA 4IIJA 2Z1TA 2CSLA 5CB4A 3I7TA 3RYHB 2I6DA 2Z1FA 1VQMF 1JFFA 3B6NA 2HQSC 2CWJA 1VQ5F 1FNJA 3HKCA 3SIUA 5LYJA 3J81M 4G4WA 4TZZA 4EI9A 2OTJF 1IV2A 3ZP7A 5A2QM 3VOAA 3T80A 4I4TA 3G71F 2IAFA 3RA6A 4BVQA 3E20B 2RHLA 4ZOLA 3GTZA 5IJ0A 4BT6A 4I4TB 2IQQA 1X7OA 4EI7A 4ZOLB 3RYIA 3C8LA 1K8AH 1W41A 5CA1B 4G4YA 3P0ZA 1QAHA 1M1KH 5GIPC 1E7KA 2EWCA 5HY4A 3IEWA 3JARA 3MDOA 3JAWB 1VQ6F 1NQ3A 4PWTA 1COMA 4FFBA 3JARB 2BTOA 2HRYA 1OFUA 4O2BB 1W59A 4FFBB 1W55A 3E22A 3HKBA 4YJ3A 1ODEA 3KJJA 3TD3A 1VQNF 1KNJA 3JCMM 3VTIC 3P4EA 1XHOA 2CHSA 3E22B 2RHJA 4X3LA 5EAZA 5GIOC 5JCOC 3KJKA 1IV3A 1W5EA 4DRXB 3LDTA 5IYZA 2Z1UA 4IHJA 1K73H 2H8CA 2KG4A 4NQ3A 5FNVA 2I6RA 1X25A 3N2KA 2KGWA 3CMEF 2Q1YA 3D54A 4ZHQA 4KWEA 5FNVB 5GAPK 5LP6C 1XBIA 3HJWC 2KTUA 4NWOB 4ZHQB 3K14A 2AIZP 2F9ZC 1SDSA 3HTNA 5KX5B 1Q81H 3G4SF 3QHDA 3PLAC 4O4HB 2CW4A 3QUWA 5GONA 5J2UA 4U3JA 2VAWA 5J2TA 3HKDB 3KIZA 5LOVA 1VHAA 2H6LA 2MQEA 2ZVZA 2OZBA 4G88A 5J2UB 3IKEA 2LBXA 3F0GA 4U3JB 3VOBA 1Q8RA 5J2TB 3ELCA 4X1YA 3F0DA 3NVKE 1VQ9F 3VYUC 4TV8B 4O4LA 2VGNA 3FD5A 3IKFA 2HP0B 2PHNA 3FD6A 4B45A 1NMUB 2VAPA 1CK2A 4O4LB 4TUYA 2UZHA 3JASA 3MCQA 4B5CA 3CYPB 3CCVF 1YJWF 2LBTA 1W581 4TUYB 1YJ9F 3I55F 5EZYA 2HS3A 2R6R1 5LA6A 1UFYA 1VQ7F 5GANK 3RYFA 3U0OA 5JQGA 4RHAA 4BT2A 5CA0A 1SA0A 4HNAB 1W57A 1Z5WA 5G4UC 5LA6B 3RYFB 5JQGB 4LCKA 4X1KA 1VQVA 2HP3A 3I56F 2N48A 5CA0B 1SA0B 1M90H 2HX0A 3VCZA 1W5BA 3PAFA 3NMUC 3C9UA 1X7PA 1FSZA 3VMFB 4BT7A 1R1MA 4YJ2B 1CN7A 1IV4A 3CG6A 4ZHWA 2YYEA 4O4IA 3IEQA 1GZ0A 3K2XA 2P6YA 2UYPA 3VYSC 3LWOC 3CCMF 4ERHA 4O4IB 3LWRC 2DT4A 2HS0A 1YHQF 1ONIA 3NK6A 3ERNA 2HRUA 5FLXM 3JATA 3S03A 3SIVA 1W2BF 1DT9A 4RQOA 5CA1A 3C9TA 4C82A 3JATB 2OHWA 3LFOA 5MN4A 3JAWA 3JVHA 3CC4F 1QD9A 5AVMA 3FFMA 1XV2A 4O4JB 1YGYA 3VYTC 3V4DA 4O2BA 1UI9A 3V7EA 1GX1A 2LBWA 2JNBA 2RHOA 3WXMB 5C8YA 1YQNA 2ALEA 2WALA 4ZHYB 5MN5A 1XRGA 3IMPA 4DRXA 2YXZA 1VH8A 5C8YB 1H47A 1N8RH 2K1SA 3C9SA 3CCSF 3LMEA 1JN1A 3GYQA 4F6RA 5DCVA 3C9RA 3WJRA 3KE1A 1SZQA 3VIUA 4BVSA 4C8EA 1W42A 5JH7A 3CD6F 4X1IB 4F6RB 1QU9A 1KQSF 4ZI7A 1U40A 2UYNA 1OAPA 4BW0B 4X20A 1VQ4F 5JH7B 4E6EA 4ZI7B 1K9MH 2UYNB 4X20B 1Q82H 5EO3A 2L26A 4BY9D 5BMVA 5KX5A 2VGMA 2Z01A 4O4HA 3ZO8A 3EORA 4I50A 5HXUA 1JD1A 2DYYA 5BMVB 1VQPF 4O2AB 5KMGB 3M84A 3NVIB 2B33A 3HKDA 3VI6A 4C8GA 5EB0A 1TUBB 4I50B 4BT5A 3ESJA 3FPIA 3CCJF 4XCQA 3WGKA 3D00A 2NMUA 4TV8A 5LXTA 2VXYA 4U39A 2HP0A 3HWUA 2OTMA 3WJPA 5LXTB 5JCOA 2FGYA 4ZK7A 5IT9M 1RA4A 3WGNA 4DXDA 3HAXD 2BO1A 3OBYA 3CYQA 1RQ2A 3CCQF 3BYQA 2AIFA 3AGKA 1PXWA 5HY0A 3CCLF 3JAKB 5LP6A 3CC7F 4HNAA 2BTUA 5IJ9B 4C4WC 3OW2F 1GO1A 2GLZA 4BVTA 5LP6B 4TV9B 3HKEB 4G4XA 2RHHA 2R751 4YJ2A 1GO0A 3RA5A 2W8BC 3IR9A 2OTLF 3ON1A 2ZOVA 2GZLA 3ZP4A 3WPXA 3F6MA 5GINC 3VO8A 3F0FA 1J7HA 3CPQA 3DDNA 2IG8A 1W5FA 1VQKF 2QEXF 3K12A 1X52A 3WPWA 1Q86H 4WBNB 1U3LA 2GVIA 2QA4F 3J80M 3CCRF 1W40A 3OONA 3V3TA 3M1XA 3JAMM 3V7QA 3O85A 3S0WA 2PMPA 5EIBC 3UT5B 3TD5A 2Q1XA 2ZAUA 2ZF8A 5EYPA 4I55A 3WGMA 4IIJB 2RB9A 5CB4B 4O4JA 1KD1H 4G4VA 4R40B 5EYPB 4I55B 1JFFB 4BVRA 1W3EX 2CZWA 4ZHVA 3HKCB 1FFXA 5LYJB 3FBAA 4C8IA 3D01A 1T0KB 5FJ4C 3NK7A 1FFXB 1RQ7A 2UYJA 3LYBA 5B8FA 2CHTA 4B46A 3CMAF 5HP8A 1H48A 3DC2A 2ZODA 1VQLF 3JALA 1DBFA 5IJ0B 1QVFF 3S06A 3GHZA 1VQ8F 3R0PA 4X1IA 4BT4A 3RYIB 5G4VC 1IV1A 3JALB 2AMTA 1YITF 5EWRA 5HY1A 1JJ2F 1RLUA 3WJQA 3RYCA 1H7MA 4G4ZA 3L7QA 3RYCB 4B62A 5HWEA 1U3PA 5HXZA 1YIJF 4EB6A 4O2AA 5KMGA 3HKBB 4YJ3B 3LWPC 3S02A 2BTQB 1Q7YH 1KC8H 3CB2A 4EI8A 1TUBA 3CPWF 2H8EA 4EB6B 2QI2A 1ZWZA 3CC2F 1Z5VA 2G9IA 4LNUA 5IYZB 4IHJB 5ITZA 2CVLA 3RE3A 3N2KB 4LNUB 3J7AR 1FNKA 1TVKA 5ITZB 3LWVC 2VAMA 2QTPA 1TVKB 5HY2A 2ZVYA 1JY8A 1QVGF 2FC3A 1VQOF 2HS4A 1CLIA 4X3MA 3JAKA 3CCEF 2HVYD 3MBMA 3E1YA 3QTYA 5IJ9A 1IPAA 5GONB 3I3FA 3N2GA 3TD4A 1VK3A 4TV9A 3HKEA 3LWQC 5LOVB 1NJIH 1YI2F 2Z1EA 3P10A 4C81A 2KTVA 3Q8HA 3N2GB 3N4YA 4X1YB 5EB1B 1W5AA 3MCAB 3G6EF 4M8IA 5HP7A 2V9YA 3F0EA 1YJNF 3CXCF 2UYKA 3OBWA 3JASB 3ZOPA 3MQWA 3WGJA 3N4ZA 5JVDA 3CCUF 4NUTA 5EZYB 3KHNA 2LCAA 4WBNA 3M4SA 5JVDB 5MN6A 3K0TA 1RLGA
chains in the Genus database with same CATH topology
4BW0B 1VQ4F 1S72F 3NVKE 1VQ9F 1T0KB 5FJ4C 3NK7A 2VGNA 1K9MH 1Q82H 5EO3A 1NMUB 3CMAF 4BY9D 1CK2A 2VGMA 5HXUA 3CCVF 1VQLF 1VQPF 1YJWF 2I6DA 1QVFF 3NVIB 1VQMF 3VI6A 1YJ9F 3I55F 1VQ8F 5G4VC 1VQ5F 1YITF 3SIUA 3CCJF 4XCQA 5EWRA 3J81M 1VQ7F 3D00A 5GANK 5HY1A 1JJ2F 4TZZA 4EI9A 2OTJF 1H7MA 5G4UC 5A2QM 4LCKA 3I56F 3G71F 2FGYA 5HWEA 1M90H 3PAFA 5HXZA 3RA6A 4BVQA 3E20B 5IT9M 1YIJF 1RA4A 3NMUC 3LWPC 1Q7YH 3HAXD 1KC8H 1X7PA 2BO1A 1X7OA 3OBYA 3VMFB 4EI8A 4EI7A 3CPWF 3CCQF 1K8AH 1W41A 2AIFA 1M1KH 3AGKA 2QI2A 1PXWA 1ZWZA 5GIPC 3CC2F 3CG6A 5HY0A 5HY4A 3CCLF 1E7KA 1CN7A 1GZ0A 1VQ6F 3CC7F 4C4WC 3OW2F 3LWOC 3CCMF 1GO1A 3LWRC 2GLZA 4BVTA 3J7AR 3LWVC 1YHQF 3NK6A 1VQNF 5FLXM 3JCMM 5HY2A 3SIVA 1W2BF 1DT9A 3RA5A 1GO0A 3IR9A 2OTLF 3ON1A 4X3LA 5GIOC 1QVGF 2FC3A 1VQOF 2OHWA 4X3MA 3LFOA 5GINC 3CCEF 2HVYD 1K73H 3CC4F 3E1YA 2KG4A 1IPAA 3CPQA 3FFMA 4NQ3A 3CMEF 1VQKF 2QEXF 3LWQC 1NJIH 1X52A 1YI2F 3V7EA 5GAPK 2LBWA 1Q86H 2KTVA 2JNBA 2QA4F 3J80M 3CCRF 1W40A 1XBIA 3N4YA 3HJWC 2KTUA 3V3TA 3WXMB 3JAMM 2ALEA 2WALA 3V7QA 3O85A 3MCAB 2F9ZC 3G6EF 1SDSA 1YJNF 3CXCF 3OBWA 1N8RH 1Q81H 3CCSF 3G4SF 3PLAC 3GYQA 1KD1H 3N4ZA 5DCVA 4BVRA 1W3EX 2CZWA 3CCUF 4NUTA 2OZBA 4BVSA 3CD6F 1W42A 2LBXA 1KQSF 1RLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BW0 B;  1VQ4 F;  1S72 F;  3NVK E;  1VQ9 F;  1T0K B;  5FJ4 C;  3NK7 A;  2VGN A;  1K9M H;  1Q82 H;  5EO3 A;  1NMU B;  3CMA F;  4BY9 D;  1CK2 A;  2VGM A;  3CCV F;  1VQL F;  1VQP F;  1YJW F;  2I6D A;  1QVF F;  3NVI B;  1VQM F;  3VI6 A;  1YJ9 F;  3I55 F;  1VQ8 F;  5G4V C;  1VQ5 F;  1YIT F;  3SIU A;  3CCJ F;  5EWR A;  3J81 M;  1VQ7 F;  5GAN K;  1JJ2 F;  4TZZ A;  2OTJ F;  1H7M A;  5G4U C;  5A2Q M;  4LCK A;  3I56 F;  3G71 F;  1M90 H;  3PAF A;  5IT9 M;  3RA6 A;  3E20 B;  1YIJ F;  1RA4 A;  3NMU C;  3LWP C;  1Q7Y H;  3HAX D;  1KC8 H;  1X7P A;  2BO1 A;  1X7O A;  3OBY A;  3VMF B;  3CPW F;  3CCQ F;  1K8A H;  1W41 A;  2AIF A;  1M1K H;  3AGK A;  2QI2 A;  1PXW A;  1ZWZ A;  5GIP C;  3CC2 F;  3CG6 A;  1E7K A;  1CN7 A;  3CCL F;  1GZ0 A;  1VQ6 F;  3CC7 F;  4C4W C;  3OW2 F;  3LWO C;  3CCM F;  1GO1 A;  3LWR C;  3J7A R;  3LWV C;  1YHQ F;  3NK6 A;  1VQN F;  5FLX M;  3JCM M;  3SIV A;  1W2B F;  1DT9 A;  3RA5 A;  1GO0 A;  3IR9 A;  2OTL F;  3ON1 A;  4X3L A;  5GIO C;  1QVG F;  2FC3 A;  1VQO F;  2OHW A;  4X3M A;  3LFO A;  5GIN C;  3CCE F;  2HVY D;  1K73 H;  3CC4 F;  3E1Y A;  2KG4 A;  1IPA A;  3CPQ A;  3FFM A;  3CME F;  1VQK F;  2QEX F;  3LWQ C;  1NJI H;  1X52 A;  1YI2 F;  3V7E A;  5GAP K;  2LBW A;  1Q86 H;  2KTV A;  2JNB A;  2QA4 F;  3J80 M;  3CCR F;  1W40 A;  1XBI A;  3N4Y A;  3HJW C;  2KTU A;  3WXM B;  3JAM M;  2ALE A;  2WAL A;  3V7Q A;  3O85 A;  3MCA B;  3G6E F;  1SDS A;  1YJN F;  3CXC F;  3OBW A;  1N8R H;  1Q81 H;  3CCS F;  3G4S F;  3PLA C;  3GYQ A;  1KD1 H;  3N4Z A;  5DCV A;  1W3E X;  2CZW A;  3CCU F;  4NUT A;  2OZB A;  3CD6 F;  1W42 A;  2LBX A;  1KQS F;  1RLG A; 
#chains in the Genus database with same CATH topology
 3WGL A;  1S72 F;  1PF5 A;  4BT3 A;  1KNK A;  3S0Y A;  1U43 A;  3UT5 A;  1T0A A;  5EIB D;  3S0H A;  4X1K B;  3RYH A;  4IIJ A;  2Z1T A;  2CSL A;  5CB4 A;  3I7T A;  3RYH B;  2I6D A;  2Z1F A;  1VQM F;  1JFF A;  3B6N A;  2HQS C;  2CWJ A;  1VQ5 F;  1FNJ A;  3HKC A;  3SIU A;  5LYJ A;  3J81 M;  4G4W A;  4TZZ A;  4EI9 A;  2OTJ F;  1IV2 A;  3ZP7 A;  5A2Q M;  3VOA A;  3T80 A;  4I4T A;  3G71 F;  2IAF A;  3RA6 A;  4BVQ A;  3E20 B;  2RHL A;  4ZOL A;  3GTZ A;  5IJ0 A;  4BT6 A;  4I4T B;  2IQQ A;  1X7O A;  4EI7 A;  4ZOL B;  3RYI A;  3C8L A;  1K8A H;  1W41 A;  5CA1 B;  4G4Y A;  3P0Z A;  1QAH A;  1M1K H;  5GIP C;  1E7K A;  2EWC A;  5HY4 A;  3IEW A;  3JAR A;  3MDO A;  3JAW B;  1VQ6 F;  1NQ3 A;  4PWT A;  1COM A;  4FFB A;  3JAR B;  2BTO A;  2HRY A;  1OFU A;  4O2B B;  1W59 A;  4FFB B;  1W55 A;  3E22 A;  3HKB A;  4YJ3 A;  1ODE A;  3KJJ A;  3TD3 A;  1VQN F;  1KNJ A;  3JCM M;  3VTI C;  3P4E A;  1XHO A;  2CHS A;  3E22 B;  2RHJ A;  4X3L A;  5EAZ A;  5GIO C;  5JCO C;  3KJK A;  1IV3 A;  1W5E A;  4DRX B;  3LDT A;  5IYZ A;  2Z1U A;  4IHJ A;  1K73 H;  2H8C A;  2KG4 A;  4NQ3 A;  5FNV A;  2I6R A;  1X25 A;  3N2K A;  2KGW A;  3CME F;  2Q1Y A;  3D54 A;  4ZHQ A;  4KWE A;  5FNV B;  5GAP K;  5LP6 C;  1XBI A;  3HJW C;  2KTU A;  4NWO B;  4ZHQ B;  3K14 A;  2AIZ P;  2F9Z C;  1SDS A;  3HTN A;  5KX5 B;  1Q81 H;  3G4S F;  3QHD A;  3PLA C;  4O4H B;  2CW4 A;  3QUW A;  5GON A;  5J2U A;  4U3J A;  2VAW A;  5J2T A;  3HKD B;  3KIZ A;  5LOV A;  1VHA A;  2H6L A;  2MQE A;  2ZVZ A;  2OZB A;  4G88 A;  5J2U B;  3IKE A;  2LBX A;  3F0G A;  4U3J B;  3VOB A;  1Q8R A;  5J2T B;  3ELC A;  4X1Y A;  3F0D A;  3NVK E;  1VQ9 F;  3VYU C;  4TV8 B;  4O4L A;  2VGN A;  3FD5 A;  3IKF A;  2HP0 B;  2PHN A;  3FD6 A;  4B45 A;  1NMU B;  2VAP A;  1CK2 A;  4O4L B;  4TUY A;  2UZH A;  3JAS A;  3MCQ A;  4B5C A;  3CYP B;  3CCV F;  1YJW F;  2LBT A;  1W58 1;  4TUY B;  1YJ9 F;  3I55 F;  5EZY A;  2HS3 A;  2R6R 1;  5LA6 A;  1UFY A;  1VQ7 F;  5GAN K;  3RYF A;  3U0O A;  5JQG A;  4RHA A;  4BT2 A;  5CA0 A;  1SA0 A;  4HNA B;  1W57 A;  1Z5W A;  5G4U C;  5LA6 B;  3RYF B;  5JQG B;  4LCK A;  4X1K A;  1VQV A;  2HP3 A;  3I56 F;  2N48 A;  5CA0 B;  1SA0 B;  1M90 H;  2HX0 A;  3VCZ A;  1W5B A;  3PAF A;  3NMU C;  3C9U A;  1X7P A;  1FSZ A;  3VMF B;  4BT7 A;  1R1M A;  4YJ2 B;  1CN7 A;  1IV4 A;  3CG6 A;  4ZHW A;  2YYE A;  4O4I A;  3IEQ A;  1GZ0 A;  3K2X A;  2P6Y A;  2UYP A;  3VYS C;  3LWO C;  3CCM F;  4ERH A;  4O4I B;  3LWR C;  2DT4 A;  2HS0 A;  1YHQ F;  1ONI A;  3NK6 A;  3ERN A;  2HRU A;  5FLX M;  3JAT A;  3S03 A;  3SIV A;  1W2B F;  1DT9 A;  4RQO A;  5CA1 A;  3C9T A;  4C82 A;  3JAT B;  2OHW A;  3LFO A;  5MN4 A;  3JAW A;  3JVH A;  3CC4 F;  1QD9 A;  5AVM A;  3FFM A;  1XV2 A;  4O4J B;  1YGY A;  3VYT C;  3V4D A;  4O2B A;  1UI9 A;  3V7E A;  1GX1 A;  2LBW A;  2JNB A;  2RHO A;  3WXM B;  5C8Y A;  1YQN A;  2ALE A;  2WAL A;  4ZHY B;  5MN5 A;  1XRG A;  3IMP A;  4DRX A;  2YXZ A;  1VH8 A;  5C8Y B;  1H47 A;  1N8R H;  2K1S A;  3C9S A;  3CCS F;  3LME A;  1JN1 A;  3GYQ A;  4F6R A;  5DCV A;  3C9R A;  3WJR A;  3KE1 A;  1SZQ A;  3VIU A;  4BVS A;  4C8E A;  1W42 A;  5JH7 A;  3CD6 F;  4X1I B;  4F6R B;  1QU9 A;  1KQS F;  4ZI7 A;  1U40 A;  2UYN A;  1OAP A;  4BW0 B;  4X20 A;  1VQ4 F;  5JH7 B;  4E6E A;  4ZI7 B;  1K9M H;  2UYN B;  4X20 B;  1Q82 H;  5EO3 A;  2L26 A;  4BY9 D;  5BMV A;  5KX5 A;  2VGM A;  2Z01 A;  4O4H A;  3ZO8 A;  3EOR A;  4I50 A;  5HXU A;  1JD1 A;  2DYY A;  5BMV B;  1VQP F;  4O2A B;  5KMG B;  3M84 A;  3NVI B;  2B33 A;  3HKD A;  3VI6 A;  4C8G A;  5EB0 A;  1TUB B;  4I50 B;  4BT5 A;  3ESJ A;  3FPI A;  3CCJ F;  4XCQ A;  3WGK A;  3D00 A;  2NMU A;  4TV8 A;  5LXT A;  2VXY A;  4U39 A;  2HP0 A;  3HWU A;  2OTM A;  3WJP A;  5LXT B;  5JCO A;  2FGY A;  4ZK7 A;  5IT9 M;  1RA4 A;  3WGN A;  4DXD A;  3HAX D;  2BO1 A;  3OBY A;  3CYQ A;  1RQ2 A;  3CCQ F;  3BYQ A;  2AIF A;  3AGK A;  1PXW A;  5HY0 A;  3CCL F;  3JAK B;  5LP6 A;  3CC7 F;  4HNA A;  2BTU A;  5IJ9 B;  4C4W C;  3OW2 F;  1GO1 A;  2GLZ A;  4BVT A;  5LP6 B;  4TV9 B;  3HKE B;  4G4X A;  2RHH A;  2R75 1;  4YJ2 A;  1GO0 A;  3RA5 A;  2W8B C;  3IR9 A;  2OTL F;  3ON1 A;  2ZOV A;  2GZL A;  3ZP4 A;  3WPX A;  3F6M A;  5GIN C;  3VO8 A;  3F0F A;  1J7H A;  3CPQ A;  3DDN A;  2IG8 A;  1W5F A;  1VQK F;  2QEX F;  3K12 A;  1X52 A;  3WPW A;  1Q86 H;  4WBN B;  1U3L A;  2GVI A;  2QA4 F;  3J80 M;  3CCR F;  1W40 A;  3OON A;  3V3T A;  3M1X A;  3JAM M;  3V7Q A;  3O85 A;  3S0W A;  2PMP A;  5EIB C;  3UT5 B;  3TD5 A;  2Q1X A;  2ZAU A;  2ZF8 A;  5EYP A;  4I55 A;  3WGM A;  4IIJ B;  2RB9 A;  5CB4 B;  4O4J A;  1KD1 H;  4G4V A;  4R40 B;  5EYP B;  4I55 B;  1JFF B;  4BVR A;  1W3E X;  2CZW A;  4ZHV A;  3HKC B;  1FFX A;  5LYJ B;  3FBA A;  4C8I A;  3D01 A;  1T0K B;  5FJ4 C;  3NK7 A;  1FFX B;  1RQ7 A;  2UYJ A;  3LYB A;  5B8F A;  2CHT A;  4B46 A;  3CMA F;  5HP8 A;  1H48 A;  3DC2 A;  2ZOD A;  1VQL F;  3JAL A;  1DBF A;  5IJ0 B;  1QVF F;  3S06 A;  3GHZ A;  1VQ8 F;  3R0P A;  4X1I A;  4BT4 A;  3RYI B;  5G4V C;  1IV1 A;  3JAL B;  2AMT A;  1YIT F;  5EWR A;  5HY1 A;  1JJ2 F;  1RLU A;  3WJQ A;  3RYC A;  1H7M A;  4G4Z A;  3L7Q A;  3RYC B;  4B62 A;  5HWE A;  1U3P A;  5HXZ A;  1YIJ F;  4EB6 A;  4O2A A;  5KMG A;  3HKB B;  4YJ3 B;  3LWP C;  3S02 A;  2BTQ B;  1Q7Y H;  1KC8 H;  3CB2 A;  4EI8 A;  1TUB A;  3CPW F;  2H8E A;  4EB6 B;  2QI2 A;  1ZWZ A;  3CC2 F;  1Z5V A;  2G9I A;  4LNU A;  5IYZ B;  4IHJ B;  5ITZ A;  2CVL A;  3RE3 A;  3N2K B;  4LNU B;  3J7A R;  1FNK A;  1TVK A;  5ITZ B;  3LWV C;  2VAM A;  2QTP A;  1TVK B;  5HY2 A;  2ZVY A;  1JY8 A;  1QVG F;  2FC3 A;  1VQO F;  2HS4 A;  1CLI A;  4X3M A;  3JAK A;  3CCE F;  2HVY D;  3MBM A;  3E1Y A;  3QTY A;  5IJ9 A;  1IPA A;  5GON B;  3I3F A;  3N2G A;  3TD4 A;  1VK3 A;  4TV9 A;  3HKE A;  3LWQ C;  5LOV B;  1NJI H;  1YI2 F;  2Z1E A;  3P10 A;  4C81 A;  2KTV A;  3Q8H A;  3N2G B;  3N4Y A;  4X1Y B;  5EB1 B;  1W5A A;  3MCA B;  3G6E F;  4M8I A;  5HP7 A;  2V9Y A;  3F0E A;  1YJN F;  3CXC F;  2UYK A;  3OBW A;  3JAS B;  3ZOP A;  3MQW A;  3WGJ A;  3N4Z A;  5JVD A;  3CCU F;  4NUT A;  5EZY B;  3KHN A;  2LCA A;  4WBN A;  3M4S A;  5JVD B;  5MN6 A;  3K0T A;  1RLG A; 
#chains in the Genus database with same CATH homology
 4BW0 B;  1VQ4 F;  1S72 F;  3NVK E;  1VQ9 F;  1T0K B;  5FJ4 C;  3NK7 A;  2VGN A;  1K9M H;  1Q82 H;  5EO3 A;  1NMU B;  3CMA F;  4BY9 D;  1CK2 A;  2VGM A;  5HXU A;  3CCV F;  1VQL F;  1VQP F;  1YJW F;  2I6D A;  1QVF F;  3NVI B;  1VQM F;  3VI6 A;  1YJ9 F;  3I55 F;  1VQ8 F;  5G4V C;  1VQ5 F;  1YIT F;  3SIU A;  3CCJ F;  4XCQ A;  5EWR A;  3J81 M;  1VQ7 F;  3D00 A;  5GAN K;  5HY1 A;  1JJ2 F;  4TZZ A;  4EI9 A;  2OTJ F;  1H7M A;  5G4U C;  5A2Q M;  4LCK A;  3I56 F;  3G71 F;  2FGY A;  5HWE A;  1M90 H;  3PAF A;  5HXZ A;  3RA6 A;  4BVQ A;  3E20 B;  5IT9 M;  1YIJ F;  1RA4 A;  3NMU C;  3LWP C;  1Q7Y H;  3HAX D;  1KC8 H;  1X7P A;  2BO1 A;  1X7O A;  3OBY A;  3VMF B;  4EI8 A;  4EI7 A;  3CPW F;  3CCQ F;  1K8A H;  1W41 A;  2AIF A;  1M1K H;  3AGK A;  2QI2 A;  1PXW A;  1ZWZ A;  5GIP C;  3CC2 F;  3CG6 A;  5HY0 A;  5HY4 A;  3CCL F;  1E7K A;  1CN7 A;  1GZ0 A;  1VQ6 F;  3CC7 F;  4C4W C;  3OW2 F;  3LWO C;  3CCM F;  1GO1 A;  3LWR C;  2GLZ A;  4BVT A;  3J7A R;  3LWV C;  1YHQ F;  3NK6 A;  1VQN F;  5FLX M;  3JCM M;  5HY2 A;  3SIV A;  1W2B F;  1DT9 A;  3RA5 A;  1GO0 A;  3IR9 A;  2OTL F;  3ON1 A;  4X3L A;  5GIO C;  1QVG F;  2FC3 A;  1VQO F;  2OHW A;  4X3M A;  3LFO A;  5GIN C;  3CCE F;  2HVY D;  1K73 H;  3CC4 F;  3E1Y A;  2KG4 A;  1IPA A;  3CPQ A;  3FFM A;  4NQ3 A;  3CME F;  1VQK F;  2QEX F;  3LWQ C;  1NJI H;  1X52 A;  1YI2 F;  3V7E A;  5GAP K;  2LBW A;  1Q86 H;  2KTV A;  2JNB A;  2QA4 F;  3J80 M;  3CCR F;  1W40 A;  1XBI A;  3N4Y A;  3HJW C;  2KTU A;  3V3T A;  3WXM B;  3JAM M;  2ALE A;  2WAL A;  3V7Q A;  3O85 A;  3MCA B;  2F9Z C;  3G6E F;  1SDS A;  1YJN F;  3CXC F;  3OBW A;  1N8R H;  1Q81 H;  3CCS F;  3G4S F;  3PLA C;  3GYQ A;  1KD1 H;  3N4Z A;  5DCV A;  4BVR A;  1W3E X;  2CZW A;  3CCU F;  4NUT A;  2OZB A;  4BVS A;  3CD6 F;  1W42 A;  2LBX A;  1KQS F;  1RLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...