5FRMA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz384 (compound 4a)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
367
structure length
367
Chain Sequence
b'DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Recombination
total genus 100
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frmA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frmA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frmA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frmA03
3T19A 3MXJA 3AO4A 4XIUA 3BDPA 4DLGA 3P1GA 1D8YA 2P51A 1NK7A 1SL2A 3RMCA 1JLEA 3AVAA 5JS1A 3VQ9A 1VSEA 3SPZA 4CJFA 3OB9A 4AHCA 2DFFA 3NF8A 4FJJA 4QQDA 3PX0A 2G8WA 3DMJA 4JRPA 4N5SA 4DSJA 4Z4EA 1RT1A 4IUPA 1ITGA 4DF4A 3O3FA 3QEIA 3TAMA 4B9TA 3H08A 1QE1A 3KUFA 3DLRA 3B6OA 2QK9A 2IGIA 1IH7A 4ELUA 1RT3A 4IG3A 4FU6A 4CEAA 2EQKA 3MEVA 3OYLA 3E9GA 2DFEA 4FJNA 3AA5X 4KI6A 3LANA 2HNZA 5FRNA 5KI6A 4LH4A 3PX4A 1S1TA 3PO4A 2X4YA 3RR8A 3IAYA 2PZSA 1NKBA 2RPIA 1S1WA 4HTUA 3PMIA 3BDLA 1REVA 3FC3A 1BCMA 4UQGA 2LSNA 2W42A 3Q1JA 3DRSA 1NJYA 5CZ1A 2OZSA 2DFHA 1C0MA 3ZSYA 1T03A 4IFVA 4KI4A 1NJXA 4NZGA 4FJKA 1K6YA 1LAVA 3CQ8A 3L2QA 4CCHA 4LD0A 3CM6A 4E1MA 2O4XA 4QOZB 1KFDA 4DSEA 1NKCA 3SD4A 2I5JA 3MEAA 4C8LA 1A5WA 3KJVA 2RN2A 3BGRA 4O44A 2AJQA 3L2WA 4F4KA 2R5MA 3L2RA 2DIQA 5HROA 1Z25A 3M9QA 4GVMA 1G5VA 2RI5A 3L42A 1JLGA 1TV6A 3A2FA 3H6ZA 4DS5A 2EFIA 4CGFA 4O0IA 4I2PA 1NOZA 2RHZA 5KRTA 4Q0BA 2L8DA 1YVUA 3HPGA 1BL3A 3ZT3A 3WNEA 1RBTA 4LD6A 2YNFA 3E01A 4MQ3A 5KE2A 4IDKA 1KVAA 4KB1A 4M3RA 1OZ2A 5KGXA 2VWJA 4CFBA 4IUUA 4CFAA 2KFZA 3VA3A 2GF7A 3VQ5A 1VRTA 2RJDA 3OYEA 3AV9A 2QXFA 5SWMA 1C0UA 4E7LA 4F2SA 2G8FA 1J53A 4KHWA 3HP6A 3C6UA 2KW4A 1VSIA 1XHZA 4DFPA 3LWMA 3QIIA 1JLCA 2X6SA 2VWKA 1HJRA 3ZSVA 1JLBA 5FDLA 3RRGA 4NYNA 4B9MA 4AHTA 4CEBA 2HVIA 4QQ6A 4DG1A 1Q9XA 1IG9A 4DTSA 2F8TA 1L5UA 4I2QA 1CZBA 1HQUA 2X35A 4FJ7A 5M9OA 1KSPA 1WSJA 4BE1A 5J2NA 3O4QA 2XK0A 3LP3A 3NF7A 4FJIA 2GFUA 3DI6A 3PUFA 4H4OA 3ZSWA 1TL1A 4N41A 2O4XB 3PMTA 3OYKA 1J5OA 4C8NA 4OLBA 4PUOA 2OPSA 1JXBA 3V6DA 3OS1A 4E19A 3AVGA 4HCBA 1JXEA 4H4MA 4DU4A 4KAZA 5J39A 4HCCA 1NOYA 1WJSA 3HXMA 4FJGA 3ZEHA 2IC3A 1B9DA 3SUPA 3U3GA 4J2DA 4PL6A 4IG0A 4CJQA 2HQXA 1SKRA 4OJRA 3LALA 2EQJA 3P5JA 1LWEA 2IAJA 3LAKA 4OPJA 3D0PA 3EZ5A 4PLLA 5J2QA 4FJ8A 1JKHA 3SPYA 1XWLA 3KLIA 4B9XA 3PFSA 3LP2A 4KO0A 2EQMA 3MEWA 2YRVA 2X74A 4OKJA 4CJVA 1DTQA 4CF1A 2KFNA 1ZBIA 3VQ4A 3P83D 1UA0A 4F3OA 3JSMA 3V1RA 1S5JA 2HHSA 1A5VA 4DQQA 1X9SA 4W5QA 4FLYA 3ZSQA 1CXQA 4DFJA 2O4GA 3V4IA 3SUOA 1D5AA 1Y97A 1NK9A 3VQBA 4FLWA 1WN7A 2LCCA 1WJQA 5I3UA 3MEGA 2YHAA 3NTKA 4CHNA 4L8RB 3RRHA 2P5GA 5CZ2A 4DS4A 3S9HA 5C25A 4CHOA 3NHGA 4B9NA 4B8CA 4RW6A 4CFDA 3NGYA 3L8BA 1TKZA 4QCLA 1BIUA 3AVMA 3RMBA 4CJWA 4ZHRA 3RMDA 3QIPA 3CYMA 3K5NA 4CJSA 4ID5A 1W0HA 1JL2A 4IURA 2B6AA 4NYFA 4RG8A 2G8KA 3VQ8A 3OYGA 4M41A 2P1JA 1U48A 2X4WA 1B9FA 3QNOA 4IFYA 4BDZA 1OI1A 1L3SA 3WNFA 4PWDA 3VQQA 3NGIA 4HUEA 3UWNA 1QSLA 1TVRA 2BKDN 4OLAA 1DLOA 2BIVA 4BE2A 3MO8A 1I39A 2O4IA 4YNQA 3KD1E 1FK9A 1C1CA 3HJFA 4B9LA 2WONA 4CGDA 1C1BA 3VQPA 3M8RA 4YFUA 1N27A 5HP1A 3SV4A 4AH9A 4FLZA 4M42A 1IKWA 4HUFA 1IKYA 3P8HA 3QBYA 4CGJA 3TWHA 3DOKA 4B3OA 3KTQA 2L3RA 3TAEA 3SNNA 4W5RA 1WAJA 3MP1A 1UOCA 4ZTFA 5CYQA 3V1QA 4CK3A 3F73A 1U04A 4Y1DA 4F8RA 3OYIA 1JLQA 1HYSA 1RI0A 4ZTJA 4B9SA 4KHQA 4CJTA 1QTMA 3HP9A 4GY5A 1QQCA 3AVJA 2EHGA 2QKBA 3OYCA 3I0SA 4EP4A 3CFPA 1R0AA 3NNQA 5FROA 3KD5E 4FZZA 1TAQA 3TABA 1D9DA 4QQGA 1GOAA 4F2RA 1QSSA 4FM0A 1UWBA 3T3FA 2EX3A 3LX7A 4CF9A 1QSYA 1D9FA 3JYTA 1FKPA 1RDAA 3NE6A 4CJPA 4EDUA 3OS2A 4FK4A 3NH1A 2K3XA 5D3GA 4FK2A 4J2AA 1BI4B 3ZSXA 5D6XA 2GFAA 4FJMA 4IUQA 3EYZA 3VQ7A 1TGOA 1SKSA 3PX6A 2WACA 1EP4A 2B4JA 1SSFA 3L2VA 3AA3A 4RW8A 3DM2A 4EZ6A 1U49A 3LLRA 3NTIA 2GBZA 4IUTA 1VSJA 1BGXT 2HHTA 3B6PA 5HLFA 3OYMA 1TKDA 3O3GA 5HRSA 2JTFA 4DTNA 4E7IA 3AO5A 3CFRA 4C5GA 3NH0A 2R57A 1B92A 2IOCA 1NK8A 1WJRA 4AHVA 1VSKA 2BE2A 1RDDA 4Q5VA 4FJXA 1X1PA 4KHNA 4KHSA 4B9VA 4BD3A 4FM2A 4CHPA 1RILA 3KK2A 1S6QA 3DB4A 3OMGA 2Z1GA 3RWUA 1HMVA 4OVLA 2HHVA 5KE3A 3P8DA 2HNYA 4FM1A 3AVCA 4FW2A 3OS0A 2A1SA 1S1VA 1NK5A 3FDRA 3QIOA 3LGFA 3NDKA 4BDYA 1KVCA 3HO1A 4CF2A 1EETA 2G3RA 2RJCA 4N76A 4FW1A 4FLVA 2LRQA 3HM9A 3NF6A 2RJEA 4CEFA 1RBSA 4DTRA 3SUQA 2DTUA 1BCOA 3MEDA 3AVLA 3MXMA 1SL0A 5J26A 1WNSA 3ZT4A 4NCBA 1RBVA 3AVBA 2D0CA 1I3AA 4O4GA 4M3WA 4E7KA 3HPHA 2MWOA 3OYNA 1X9MA 3M8PA 4GMJB 4CIFA 4CF0A 1HNVA 1JLAA 3LH0A 5CIUA 2PY5A 5HBMA 2ZD1A 1X9WA 1ZBLA 5J1EA 5CY4A 4BDPA 2X78A 1YT3A 4DFKA 3SYZA 2XY6A 4ICLA 4B8AB 4R5PA 2ETJA 1SUQA 4CF8A 3KLEA 4FZYA 4DU1A 2BDPA 2EKOA 1S1XA 4KTQA 2VG6A 4BWJA 3MEEA 2XDPA 4CJ4A 4OPKA 3ZSZA 2Y1IA 1L3VA 1BISA 1Z26A 1LV5A 3DRPA 2X4XA 4O55A 4NS5A 3PO5A 2HW3A 3ZT1A 2XRIA 3OQ5A 1RT7A 2XY8A 4DQRA 1SV5A 4FLXA 3CFOA 2F96A 1MU2A 4KREA 2E6MA 3S3OA 3ZSOA 5T7BA 1SKWA 2BGGA 4A4GA 1VSFA 2Z1JA 2FHDA 3O3HA 4FLUA 1NJZA 1UA1A 1NJWA 3CG7A 3MECA 3M8QA 1VRUA 1S6PA 4QAGA 1T8EA 3AVKA 1WSHA 1JL1A 2XO7A 3OYAA 4II1A 3VQAA 1WAFA 3KLGA 4LH5A 4HVJA 2QKKA 3ITHA 4CE9A 3K58A 1IKVA 5DMRA 4Z4CA 4L59A 1RTHA 4DU3A 4FCYA 1KRPA 4CGHA 4DTOA 2YNIA 3SJJA 3AO2A 3KLFA 5IN1A 1Q8IA 3TR8A 4CK1A 2OPRA 2L89A 1Q9YA 3ULDA 3LZIA 3S3NA 4AHRA 2RHIA 4ELVA 4CGGA 5KCOA 3QEWA 3HSTB 1HNIA 1KHCA 2R7YA 4CESA 2OPQA 4HHTA 2PQWA 3QINA 5HRRA 2XHBA 2OA8A 1ZBHA 1KVBA 4FJHA 1J9AA 2P0KA 3AVIA 4KKOA 4C5EA 5C0MA 3ISNC 2E6NA 4CRIA 4DTPA 4KRFA 1N6QA 3TARA 4KHYA 3TAPA 2D5RA 4DQSA 4LSLA 2K3YA 4MFBA 3MAQA 4RG2A 3MP8A 4M3ZA 2ATQA 2HVHA 3QERA 1YTAA 4M3XA 4H8KA 4X34A 3K5LA 4I9QA 5D6WA 1KFSA 2D0AA 1SL1A 1EXQA 2D9TA 1WSIA 3DLHA 4DSKA 3L2UA 1HPZA 3ZSRA 5SZTA 4DSLA 1U45A 2HHXA 4CHYA 2E5QA 5KH6A 4DMNA 3SQ4A 3IG1A 2D0BA 1NK4A 1IO2A 4CJEA 1BIZA 4I7FA 2VYTA 1WSFA 1U4BA 1HRHA 2RI2A 3F70A 4DSFA 5D6YA 1QHTA 3NAEA 3T1AA 2DAQA 3M8SA 3VQDA 4CIEA 3NF9A 4CJKA 3D45A 2G8VA 2M0OA 3QEXA 1RTDA 2YKNA 3AO3A 1T7PA 4FJLA 4JRQA 3TI0A 1TAUA 3PV8A 1TL3A 5HRNA 2Z1IA 3KKRA 4KFBA 3KK1A 4CECA 4EP5A 4W5OA 4JS5A 4KV8A 4OGCA 2DY4A 2HHUA 3ME9A 2A1RA 2E6LA 2YHBA 2R58A 3OYBA 1TK5A 4OKKA 3AA2A 3TANA 4CHQA 3WNHA 4QVZA 3SQ1A 2KQ2A 4CEDA 2KTQA 3LGLA 1RT5A 2F5KA 4DTXA 3LZJA 3OVNA 1XHXA 4FXDA 4C5HA 1CXUA 1BHLA 1RBRA 5I42A 1S1UA 2IS3A 4CEEA 1U47A 3ZT0A 2Y1JA 4Y1CA 3OYHA 1VSHA 3LAMA 3LYIA 4FVMA 4RW9A 4RW7A 3THVA 4BE0A 3KK3A 1ASUA 4FZXC 3PNWC 3IRXA 3K2PA 2JGUA 1VSLA 3NH2A 3HPOA 4C8MA 4M3UA 1WGSA 4N4GA 1RTIA 3AA4A 3DB3A 4N4IA 4K8XA 3UT1A 4W5NA 3SUNA 2KZZA 3QKJA 2BUDA 3LWLA 2RHXA 1RNHA 1LWFA 1VSMA 3VA0A 3META 2M16A 3SQ0A 1HQEA 3CEYA 3QJ6A 2CKKA 3DLGA 1WSEA 1S9GA 2RHYA 3LP1A 4A4HA 4PA1A 2JZ2A 4DQIA 4A4FA 1NKEA 1C6VA 1UAXA 3OJSA 1J54A 4M3TA 1GOCA 2XY7A 3V9WA 3FFIA 4Z4GA 4HCZA 2RHUA 2G8IA 3V9SA 2JLEA 3OYJA 2QQRA 1YTUA 3VQ6A 5J2PA 2DIGA 2R5AA 4CK2A 2G8UA 3S3MA 4TSXA 2YV0X 1RCHA 3QEVA 3K5OA 4LY7A 1N5YA 3OYFA 4AHSA 2FBTA 4FLTA 4CJUA 3S6WA 4N56A 1H3ZA 1ZBFA 3WNGA 3U6FA 1EKEA 4DTMA 3HVTA 2G8HA 4CEOA 3EY1A 4Z02A 4Q5WA 5C6SA 4DSIA 1CLQA 4CJ5A 1C1AA 1NK6A 1WLJA 1XC9A 2IG0A 3ASMA 3SV3A 1XI1A 3E9FA 4EZ9A 3V9ZA 3V9UA 1S9EA 4AHUA 4C5IA 2FBYA 3HK2A 1MHNA 3O8VA 4IUVA 3HT3A 3LPTA 3K59A 5K14A 1RDBA 3LP0A 2P5OA 3SI6A 4E7JA 3OMCA 1FXXA 4CEQA 3NBPA 4CJLA 3DLBA 5DK5A 1TK8A 1RT2A 2OPPA 2HQEA 3NGZA 3C94A 3VQEA 3AVFA 3V1OA 3TAFA 2FBXA 2LTOA 3C4SA 2ZE2A 2YNHA 5JS2A 2LVMA 3CM5A 1GOBA 1OZ3A 3HVRA 4G1QA 4PLIA 4N47A 3QO9A 4C8OA 4CIGA 3LPUA 4RW4A 3DOLA 2RI3A 3I0RA 4B08A 3RR7A 2B5JA 4KPYA 4B9WA 4KHUA 4M3YA 5C24A 4KTZA 2VG5A 5KRSA 1F21A 3ALYA 3MP6A 1RT6A 3EAEA 1RTJA 1RT4A 2FC0A 1RDCA 3MEUA 1EX4A 5KTQA 4B9UA 4DTUA 3F9KA 3K5MA 4CHZA 3DLKA 4BWMA 1HYVA 3IS9A 1BQMA 4O0JA 4K8ZA 2E4LA 4E3SA 4OVAA 3QEPA 4JLHA 3HYFA 4I9LA 3SZ2A 3SCXA 1VSDA 4IBNA 3G0ZA 1XNIA 3V9XA 4N4HA 2RJFA 4UC4A 1KLMA 1ASWA 3VN5A 4JS4A 1TK0A 4HUGA 1W9HA 4Z4IA 2PYLA 5KGWA 1IKXA 1T05A 3ZT2A 5E41A 2FBVA 1KLNA 2IDOA 1QS4A 3DRRA 3TAQA 3RTVA 3L3UA 2OZMA 3DLEA 4CERA 1VK0A 4GW6A 2HHWA 3OYDA 4E1NA 2YNGA 4KTWA 4Z4HA 3KLHA 3SQ2A 2OYQA 4PY5A 2VG7A 3V81A 4C8KA 3HL8A 4DLEA 1FKOA 1BQNA 4FYDA 4A4EA 5CYMA 4NCGA 5EU7A 3KKSA 4E0DA 1WSGA 4W5TA 4CEZA 2YKMA 2RKIA 1DTTA 3QESA 2HNDA 3QNNA 4FJ5A 5FRMA 4E7HA 3L3VA 2B8AA 1L3TA 3NFAA 2KZMA 3ASKA 3H8ZA 5KCHA 4QW2A 5IAYA 2X6NA 2ITGA 2WOMA 2HMIA 4CJ3A 4O5BA 3ZCMA 3PY8A 1ZBUA 3KIOA 3G10A 4PQUA 5HRPA 1G15A 4F3TA 2HHQA 1LAWA 4DF8A 3RMAA 5C42A 4CGIA 1ASVA 2MWPA 3VQCA 1ZYQA 4WE1A 3DYAA 2M1HA 2Z1HA 1KTQA 4ID1A 3AVHA 3I8DA 4FJ9A 4DTJA 3OA6A 2Q3SA 1TKTA 1OYXA 3OY9A 4IKFA 2LDMA 4ELTA 3NCIA 1O1WA 2ZQBA 1A5XA 2RF2A 1LW0A 2GUIA 1LWCA 2BANA 2GV9A 4E89A 4J2EA 1JLFA 3AO1A 2HB5A 4NCAA 1NK0A 1TKXA 4J2BA 1BI4A 4DQPA 3LDSA 2XY5A 4OKEA 3K57A 3U3YA 1KCFA 2QQSA 3O4NA 1C0TA 3QETA 4DWIA 1RBUA 3MXIA 4KB0A 3OJUA 4FL6A 4LSNA 5J2MA 4FK0A 2NUBA 3FEOA 4Z4FA 3DLMA 2RO0A 3QLHA 4CFCA 3AVNA 3C95A 4AILC 2EQUA 2PYJA 4OGEA 1CZ9A 4Z0UA 3TAGA 2NLUA 4DFMA 1LW2A 3C6TA 3GOXA 4BACA 1HYZA 2F8SA 3FLGA 4M45A 3NTHA 1L3UA 3UIQA 4CJRA
chains in the Genus database with same CATH superfamily
5IP6A 1VQ4A 2JHJA 3H45C 1UG1A 3JB9F 3JAMZ 3ZQCA 3T8RA 1D8YA 5LJ3f 1YJWQ 2P51A 1NK7A 1SL2A 5CVJA 4KH0B 5JS1A 3VQ9A 3DLLL 2DO7A 3SPZA 1RADB 1NKUA 3HYIA 2DFFA 3M0SA 1E0EA 4QQDA 1IBMK 4HAMA 2ISZA 4A0YA 4IX7A 4Z6YA 4JRPA 3LSPA 1LCKA 2PNIA 5KHDA 5FU7C 3QEIA 3TAMA 4XSZF 3FGUA 4B9TA 3EN9A 3HRTA 1KQ0A 2P0QA 3KP5A 5JVTA 5ADXH 4RCBA 5KYXA 3A5OC 3WVDB 2VJIA 3BWGA 2K5IA 3S1RJ 1VQ5A 2KDZA 1XPXA 2DTOA 2RF0A 4CEAA 1IRFA 1TWGJ 1XGMA 5CKDA 1M1GA 1KG3A 3TCJA 1A35A 2CYYA 2DFEA 4HWIA 2PFUA 3QYHB 5BRHA 1KC8U 1JTYA 2FO0A 5AQXA 1WFXA 1Z3XA 2DA6A 1G3SA 5ELZA 2C6YA 5HVQC 1HPMA 3RR8A 5AQOA 3GLXA 4KH4A 1N75A 1EWRA 3K0LA 2JA6J 1BCMA 1DJ7B 1NJYA 5LY3A 4BNCA 5CQGA 4XKWA 4IRIA 3MAJA 4IEIA 1EZZB 4FT4A 1MWMA 1MDMA 3KEYA 3ZSYA 3VEOA 4B21A 1ZQ1A 4NZGA 4FJKA 1K6YA 3M53A 3PIOA 3AHUA 2DLPA 1ZR4A 4X66K 3AAQA 2PZ1A 3OW2M 2VGMA 5KYUA 5HODA 3ZOBA 4IFEA 1A36A 1KD1C 1OCCH 2O4XA 2SRCA 1R23A 1KFDA 5A2QZ 1BC7C 4DSEA 1NKCA 3SD4A 1WKMA 1G4DA 1MSFC 2H3GX 3QB0A 1ZLMA 3ERED 2OAZA 3KJVA 1RIOH 3E6DA 2RN2A 2CUBA 3G71I 2AJQA 5KVRA 4WWCA 5HNHA 1T39A 5J47A 4ESRA 2CH4A 3L2RA 4KITB 1O9SA 4O5VA 5HROA 4LFBK 5JR3A 5L23A 3M9QA 3VUZA 1G5VA 4XTZA 4FWKA 1QU3A 4RTVA 4WX9A 4Q47A 1PUFB 2D5VA 4DGWB 4HVWA 3RCOA 1IHWA 5EC7A 4IIOA 1JLGA 3OWTA 1YQAA 2YUQA 2O8FA 1TV6A 3LDQA 2EIMH 4CGFA 5JLFA 1OH7A 1VQNN 2HWVA 1SSHA 4I2PA 4DBHA 2GWRA 1NZ9A 4CSWA 4BRPA 2KQRA 4MIMA 4DV4K 2H09A 2MMPA 4DV5K 3HPGA 1MMAA 1H1VA 4M7AC 5BRDA 4CZMA 3DXJF 2COBA 1YS7A 4MQ3A 2Z16A 4M7DF 1F9NA 4OIQF 1UHSA 4LF8K 4CDGA 1KO9A 4CFAA 3MKWB 1VRTA 1K79A 3WEEB 1P4WA 3OYEA 3AV9A 4JI2K 3CMAI 1HKCA 5E1ZB 4E7LA 4WYBA 4WFBL 1N36K 1P6RA 2JG6A 2WAEA 2G8FA 2RQTA 3CWUA 2DPPB 4KHWA 3LAJA 1NGFA 2P9PA 2E1OA 2EILH 1IXSB 2ME6A 3I3LA 2EYYA 1WHHA 3B6AA 3I35A 3RMQA 3N4QA 2Z99A 3FRNA 2FSKA 3QIIA 2ELJA 2VUBA 2O8CB 3PJRA 2V6CA 1X43A 2LZ6B 1T0JA 3ECHA 5FDLA 4GRIA 4J9BA 1YJ9N 1WCMJ 1WWXA 4CEBA 3CCMT 2W04A 3E9PA 2DN0A 4GKKK 2V7FA 3I9QA 2J7IA 2JVHA 1WSJA 3QPSA 1KU7A 2ASOA 4DUYK 1S9HA 3HOTA 3V8LA 3CCLT 4FJIA 3FHFA 3DI6A 3MHXA 2DKGA 3I55T 4H4OA 3CCRQ 5JLXA 5LJ5f 5ILSA 1J5OA 1M8VA 5CKFA 4PUOA 2NNYA 5GAOl 3C12A 1KQSS 1JXBA 2STTA 1SFXA 2VC1A 4JD2B 3VOVA 4JPBW 1I1SA 5I21A 1BW6A 5ICGA 4KAZA 1MJ9A 5J39A 3BG7A 1WJSA 2K85A 5LGUA 4DR3K 2EFPA 2CZ1B 3DCFA 1K61A 2WAQN 1N32K 1K73R 3D2FB 5AQYA 3SUPA 1PHTA 4PFZA 5IWAK 1MBEA 4J2DA 4IG0A 1W36D 4OFAA 2HQXA 1SKRA 1CF7A 4DBQA 4L9JA 3MKYB 1D3BB 2KT8A 1X1AA 3F21A 4OPJA 3SZTA 4AI4A 1RR7A 2BY3A 3LOCA 1DPRA 2YUSA 3EGDB 1NJIU 2QVOA 1W4SA 3FE1A 4HCKA 3AGKA 1P7MA 1GXPA 3KETA 2H8WA 2DMQA 4Z94A 4KO0A 1TYQA 4OKJA 4CJVA 3SMPA 1QQIA 2QAZA 3QYEA 3IFRA 4IHXA 3P83D 3R0JA 1OYWA 2DOEA 3GBTA 5ED4A 5DLQE 2VKVA 2X6OA 1ORKA 1RC9A 3EZWA 1CXQA 1B72B 2GELA 3HHHA 1OCTC 1BA1A 1NG7A 1WN7A 3J80Z 1G3WA 4CXFA 1VQOQ 4DA4A 4MDBA 1X3UA 5KYWA 1XMXA 2JT4A 2JOYA 3RRHA 5CZ2A 4DS4A 4A3MJ 3S9HA 1XTAA 2XROA 4J8OA 1YI2Q 5AQFA 3JCMd 3O6WA 1MNEA 2ZCWA 3E6MA 4PJOC 4AG1C 4Y33A 1HD3A 4C9YA 5IYDJ 1HXDA 1WQ2A 1BK2A 5GAOp 4ZC3A 2XGCA 3K5NA 5GANf 3TMOA 3OH9A 2DDBA 2XB0X 3JRBA 1YUWA 3GBGA 2X1DA 2B6AA 1P90A 3OYGA 1APLC 4CICA 3W3CA 5LFAA 1Z9CA 3F5TA 1SVLA 5LRRA 5TJJA 3E6BA 3VDXA 4PKCC 3REOA 3TOBA 2F2VA 2QDYB 1YJWN 2HSEB 4U67L 4F04B 3TSZA 4BDZA 3VF4A 2A3ZA 4X65K 1HK9A 2COYA 3C7NA 3WNFA 3H9NA 3QICA 4PWDA 1I81A 1X4PA 3UNGC 3VQQA 1QSLA 2BKDN 3BG5A 2JTMA 3L00A 4OLAA 1XC3A 2HBJA 2HBWA 1UE9A 1HSJA 1T0FC 1T3SA 2E70A 2RREA 3EPZA 1VYTA 3WE2A 2YSQA 4RDUA 3IHOA 4J9FA 3R6SA 2IS1A 2OA4A 3SAGA 1WGXA 1VQLT 1E2XA 1IGQA 4ISGA 2P9IA 3VQPA 3M8RA 4IO9L 1WFWA 2JSCA 4Y28E 5HP1A 1J7KA 2DK3A 2HDAA 1K9MC 4JYKA 4AH9A 3P9KA 2R7SA 2PTKA 2LRDA 4BBSJ 1IKYA 1LWVA 2YDLA 3QBYA 2BEOA 1LPLA 2CP5A 5C12A 2ECBA 1Y0MA 3DOKA 5B66C 3KTQA 1X01A 2L3RA 3CF5L 1JJ2M 1YITA 2L0AA 4J01A 1L0OC 3JSPA 1UOCA 1HNZK 4WXHA 2VODA 2K3FA 3M1EA 3LSJA 5L3CA 4HT8A 1H9TA 1JLQA 4N0BA 3ZMTA 2ROTA 1M2OA 4GBQA 4GY5A 1G3TA 4HKEA 2M0CA 1QQCA 3DU5A 1UGQB 2LG4A 4XKBA 4GO1A 2E60A 2JHNA 3NNQA 2EWSA 4IRHA 3CPWA 3QWXX 3M5RA 1GOAA 2W10A 3PIPA 4IF4A 3FZKA 1NM7A 2NRRA 4XQ3A 1XN7A 2OBPA 4KN7X 3RMSA 4K41A 1WHLA 3NGPA 3F10A 3H41A 5JI6A 5M5WJ 2W0ZA 3V7SA 1HA8A 1QP3A 3JYTA 2DILA 2L3PA 3I5RA 4J6WA 2X51A 1RDAA 2K7AA 4EDUA 4HX8A 1BN5A 2UU9K 3NH1A 4FK2A 4J2AA 2ZFWA 5BMZA 3JAMK 1FYLA 2JPSA 2E19A 5LBQA 1W2BA 1P7JA 2OV7A 2HVSA 3ZSXA 2BGCA 4AM3A 4IHTA 3VQ7A 2LTPA 3URGA 3K70C 1HW1A 5E79C 5FFZA 3QHSA 3VYTB 2NZTA 5MLCQ 5AQSA 1ZRFA 2LMJA 2LLKA 3JR9A 5GAN7 3OOPA 1RL2A 3M0QA 4L5GA 5GAMh 4AIHA 3LLRA 2ZB9A 3GP8A 3NWTA 1BGXT 2DMNA 4FETA 4GLMA 3DXKA 5J4YA 3OYMA 4PKHA 2KJBA 3CMET 2QA4T 2E7XA 3ZQ7A 3HDDA 4JKGA 3I33A 3FMSA 1T95A 3ZEUA 4CD1A 2FMLA 4WQ4C 1FSHA 2ZJ2A 2PMZA 2QBYB 2IOCA 4RM3A 1WJRA 4AHVA 3U1KA 4Q5VA 2V9KA 4LF7K 4OP0A 4C92G 2FB7A 4C0FA 4CBWA 3FZVA 3ABMH 1VQ5N 3VEWA 4M6VA 1RILA 3KK2A 4DYCA 3F23A 1G99A 7AT1B 2V1XA 3RWUA 2HHVA 3IQLA 5DPKA 5KE3A 2NNNA 1OV3A 3DKWA 4BRNA 4FW2A 1I07A 2NRTA 2VJ5A 1NK5A 2GTJA 2M5WA 3SQNA 4U0YA 3LGFA 4BDYA 3SZGA 2YU3A 3PLAA 2B63J 4XN0A 1KG6A 4C92E 5AQLA 3BEXA 1SAUA 4BRDA 3SBGA 4M7AD 1IRGA 2Z2SB 2A08A 2HU9A 2RJEA 4CEFA 4HLYA 5FU6B 2MGQA 4BVOA 1U78A 3CVTA 3RBBB 3AVLA 2X3WD 2LKSA 1RI9A 5J26A 1VQ9I 4NCBA 5TKWA 2FD5A 5A2QK 2D0CA 1I3AA 3CC2A 3O08A 3HPHA 3ID8A 3HOWJ 5A0GA 1TLHB 3BTIA 1W5CC 4CIFA 2DTIA 2P9UB 4M77B 2MG4A 2R93J 1QRYA 2RGVA 2I8DA 4BRAA 2K2MA 4HX4A 2ZXIA 1VQ7T 2OAWA 3LNQA 2HMAA 1X9WA 1ZBLA 2FE3A 3CJ1A 2DO3A 1OU9A 2RKHA 1KONA 3ECOA 3H5RA 1E3OC 1YT3A 1G2BA 4DFKA 1D0XA 2XY6A 4A59A 1VQ6I 4R5PA 2KMTA 2IS2A 4OMNA 2UUAK 1OPKA 1MDMB 3KLEA 2R7OA 2BDPA 1Q7YR 1BA5A 3E3VA 2P81A 2VG6A 2JN6A 2OTJI 2VQGA 2M8EA 4MNUA 1AU7A 4OPKA 1D4XA 3ZSZA 4OU0A 3RPUA 3J7AF 2RH2A 3M07A 1BOAA 1BISA 3DRPA 5IYBJ 4NS5A 1T8IA 4C2MJ 1I94K 4BREA 3KNTA 3H9QA 2HW3A 3CCJI 5AQKA 2P4TA 4P1WA 1AOJA 5LMNK 4P5NA 1OPCA 2XY8A 4DQRA 4IEJA 5F0CA 1LEBA 3PE0A 1N77A 4C0GA 1Z91A 5CR2A 3RQ4A 5T7BA 1SKWA 1BR4A 2QK0A 1T3VA 3ZMUA 4I0AA 5HNFA 4NL2A 3JCMV 4FLUA 2F4VK 3D5LA 2DL8A 3CG7A 3MECA 4KJZA 3M8QA 1VRUA 3CCEI 1S6PA 4QAGA 1NLVA 4A3DJ 1T8EA 3AVKA 1DP7P 2O8FB 1JL1A 4HVUA 2ZAEA 3ULEA 1PP7U 1VQON 3G1JA 3O8HA 4AMCA 4UV9A 3KLGA 2YG9A 2QKKA 3WU1B 2CQKA 2IVWA 3K58A 4XK4A 2FLOA 4C0DC 4DJAA 2BE5F 4B1YB 3W6JB 5DMRA 1YI2N 1HNXK 1A6IA 3BROA 1QVUA 1U3EM 2KXCA 1RRJA 3PL8A 3W2VA 4CGHA 3GBQA 1H8AC 1FC3A 2CSOA 3SJJA 2M4GA 3KLFA 4CK1A 2OPRA 4EATA 1UHFA 1B07A 1YW7A 3HSTB 2DE0X 2OPQA 3CC2Q 3HSEA 2OU2A 3RYPA 5J8CA 1NGNA 3IRQA 3I4MJ 3HOUJ 2DXBA 4JKEA 5HRRA 3P39A 2ZGZA 3CCSQ 3AVIA 3UR3C 4XN3A 5C0MA 5IT9O 1E3MA 2OZ6A 4CRIA 3O8MA 1DGWY 2MD5A 3FHNA 4M3ZA 4RG2A 1ZYRF 3QQAA 1N8RO 4OOIA 3QERA 4BHPA 4CYCA 5LGTA 4H8KA 5K7HA 1FX7A 1R7JA 1NLOC 5GAOn 1NGEA 4G9YA 1WXBA 2VKDA 1V5GA 2ED0A 4I9QA 3X26B 2UXBK 2D9TA 1OCRH 2MIOA 3L2UA 4R0KA 5E1XA 2D0OA 4LLGF 4XEIA 3N5NX 2HHXA 4WXDA 3HTRA 3JV3A 2O0YA 1PD0A 3GW2A 3N0UA 2F4MB 1LMZA 1M3AA 3SQ4A 2D0BA 1NK4A 1BIZA 2ID3A 2M1BA 1W5SA 1W70A 1QCOA 5FPEA 4EA4A 1UJ0A 2WBMA 1RLPC 5J1RA 1AWWA 4PDKA 3M8SA 4L0YB 5LEKA 3J80K 2P9LA 3D45A 2M0OA 3CESA 3T5XA 3QEXA 2X4JA 2YKNA 2AP1A 1CF7B 3EETA 4EQQA 1RAEB 2Z9OA 4JRQA 1OVQA 1XTDA 2B86A 1J5YA 3I59A 1U8BA 5ILVA 1TAUA 3PV8A 3K1PA 1M4ZA 2EFQA 4U87A 1JE8A 2H8RA 5EOYA 2Z1IA 3EUKL 3RZDJ 3KKRA 4ZGDB 5AR0A 3OW2P 4KV8A 5AZIB 1NU0A 3THWB 1HLVA 3A8LB 4WCIA 4LG0A 1TYQB 2YHBA 2ABLA 1B4AA 5BNGA 3AA2A 3TANA 4CHQA 2VPRA 2WSEE 1WJDA 2ECCA 1FOKA 4QVZA 3GYHX 4C0ZA 3SQ1A 1EV7A 4X6AJ 4CBUA 2KQ2A 3A0BC 4CEDA 3EE8A 3R61A 2L9SA 3H3OB 2F5KA 3CC4Q 2EZIA 3JSCA 3ABLH 1XHXA 4C5HA 3MN7A 1ETQA 1RBRA 4N4NB 3BR2A 4C92A 3RR6A 1S1UA 2CW7A 4P5OA 5HY6A 3ZT0A 1XNRK 2Y1JA 1M8MA 2LBFA 4L5JA 1O3QA 4AT1B 4ME7A 4M75B 1NHAA 4JX5A 5BS6A 3LWFA 2W1OA 2RM4A 2XAJA 3LSRA 5EGOB 1HSQA 4BG9A 4BR9A 3VPRA 2QWRA 4RGUA 3TU4K 3MD2A 1Y1VJ 3Q0WA 3HG9A 3CCMA 1JRIA 4BC3A 4A0XA 5AQVA 1S7AA 3DTKA 4PJOG 4MMKA 3CCLA 1Y57A 2VIXA 4K8XA 3GDQA 4M78B 1UDLA 3I55A 2MF2A 2K7LA 1I1JA 4ZGEB 4XICA 1LWYA 3A8HB 3SQ0A 4DV0K 3K9KA 3OSGA 4OFHA 5GAN5 3CEYA 3C7NB 4XTYA 4B44A 1AHJB 3DLGA 4S05A 2UXNA 1S9GA 3H1CA 3OHRA 2NS7A 4A61A 4DCHA 4PJOE 1U6ZA 2DMOA 2IVPA 3J7AP 3O5BA 2OTLI 4LD9K 3PVQA 5JICA 1VOMA 1I6XA 5C2FA 1XMAA 2EAYA 2G8IA 3V9SA 2QQRA 3RNJA 2QWLA 4HX7A 1XQOA 1OYYA 5CVUA 3CO7C 4DEYA 4RTFD 4WF2A 2F7TA 1KG7A 3R1XA 1QVFM 4ZYEA 3IKTA 3QEVA 1M1FA 4KYWA 1YIJT 2DTRA 3OYFA 5B8HA 5CYVA 2IPQX 4IVNA 3IC7A 2YHYA 1MBGA 4QWQA 1N33K 1VQMQ 3VODA 3SWNA 3WNGA 2QG9B 2HOEA 1JJ8C 3U6FA 2XI9A 4OB3B 4PL8A 5BPLA 3ISPA 1J9IA 3EY1A 4Z02A 3JCMJ 3HFNA 3OOUA 4RB1A 4EMKA 2FQ3A 2KI7A 1C1AA 3VEPA 1FYKA 3JB9G 2W41A 4R55A 1TUGB 2LCLA 1XC9A 4E7ZA 3VTHA 1WYXA 1S1NA 3E9FA 4EZ9A 4BRCA 3V9UA 1K73C 4L3QA 3V7CA 1WHKA 4FT8A 1ETWA 1IN8A 3VKIA 1ETKA 1BU6O 2P5OA 4UNOA 2QTVA 3OMCA 3OW2A 5M1OA 5CLSA 3M0RA 1YHQQ 1QQOA 3NBPA 1ABQA 1SPKA 1RT2A 4YFNF 3AG3H 4B1WB 3CCMQ 3NGZA 3C94A 3TW6A 4C3HJ 4G6QA 4GXOA 4KGZB 4D9JA 2ECZA 3ZCOA 3CZ6A 1PRLC 1YN8A 2PMZN 1X19A 2ZE2A 4LUEA 4OMPA 1R77A 4NBQA 1R9TJ 3CCLQ 4G1QA 2VXDA 4F3QA 5AQNA 4N47A 3QO9A 2V8KA 2E5KA 3VPZA 2R7QA 5HS9A 1ZELA 4K2EA 1K6OA 1EQYA 2XC7A 4KHPK 2H3JA 4KPYA 4KHUA 4M9ZA 1PYVA 4KTZA 2CG4A 2JS2A 4IWVA 2ZPBB 5H6RA 5KRSA 2IW5A 2L2OA 4VUBA 1K4US 3K4BA 1VHXA 1RTJA 1RT4A 4CCMA 1H0MA 2FC0A 4ZZLA 3QUIA 4CHUA 3MEUA 5KTQA 2YHXA 3LL7A 3ZQLA 4LB6B 2CO5A 3BJAA 3KE2A 4EM1A 3DLKA 5GAGJ 3QDRB 2CJJA 4BEHA 3CCUI 2R5ZA 2QWOA 4M3DA 4B24A 4O0JA 2X6WA 4PNOA 1TUYA 4OVAA 3GG4A 3F8FA 4RCCA 3SCXA 1Y1WJ 2KRNA 1XNIA 1VQLA 1FMKA 3V9XA 2KXDA 4N4HA 4UC4A 2K4BA 2VE9A 3CC2N 1W9HA 5C0YA 4Z4IA 2WC9A 2DU9A 3ZMSA 1GLNA 1WJEA 3OH6A 3I54A 3CCSN 5GMKl 1X3WB 2BZYA 2ZPGB 2C0IA 2RNGA 2DK5A 2IDOA 2VASA 1ZH5A 3S6IA 3TAQA 3D5SC 5FPMA 1S6LA 3CIPA 4BI4A 3DLEA 3JRFA 4I6ZA 4H0EA 2LSOA 3OYDA 1A5JA 2XF6A 3EE9A 4KTWA 5DEQA 4Z4HA 3KLHA 4M9SA 1V4TA 1NG6A 5AQHA 5FWBA 1DPUA 4ETSA 1BQNA 3JREA 3WXLA 2BY2A 3SHWA 3RPQA 5EU7A 4EHTA 3KKSA 4E0DA 1QVTA 2DYBA 1IZ1A 3FLCO 5EG2A 4E9FA 4CEZA 4B3AA 2DBMA 1X75C 3VERA 3BDUA 3FJPA 2OD5A 1DGKN 4FOEA 3IAM2 3HOSA 4E7HA 3WG9A 2CSQA 4M7DG 1B6AA 5IH2A 3DKXA 1UFFA 2FUG2 4JQFA 3KYLA 2H94A 4C8QC 2WOMA 1WPKA 1TH7A 4N0AC 5J4VA 1JJ2P 3JXUA 2QTXA 1XNQK 2DMPA 1R00A 3TKYA 2K9QA 5M1KA 2DRMA 3ZCMA 3PY8A 4IJAA 1BM9A 4Q4ZF 4PKIA 3TQ7P 3G10A 1ZGAA 1BL0A 1K8AC 3IMXA 3ZQIA 3GMEA 1LE8B 2O03A 4F3TA 1Z6RA 1LAWA 2VXFA 4M7DE 4ANJA 1TUCA 2AQFA 4A4KA 3QP5A 2A69F 3RMAA 1T3LA 1B34A 2XU8A 1JTXA 2B9SA 5C42A 1ON2A 1ASVA 1SHGA 2IA0A 2MWPA 3G4SQ 2M7BA 3VQCA 1HKQA 3CCQI 3EFSA 4B1XB 2O2OA 3THKA 3I8DA 4DTJA 2Q3SA 1ZN2A 1OMIA 1TKTA 2R7FA 1O75A 2LDMA 1Y96B 4ELTA 2OZUA 1IG8A 1UB9A 5F08A 3CMEA 1IAWA 2QA4A 4JI0K 2E1HA 2ZQBA 1TZLA 2QXLA 3CQXA 5GANd 2R3SA 4B1ZA 4IHSA 2RE2A 3K7AJ 2YHTA 1POGA 1LWCA 4E89A 4J2EA 2QGUA 2DETA 1JLFA 5DCFA 3AO1A 3K2ZA 4NCAA 1V4SA 3O9QA 2XY5A 1VQLQ 3CC4N 2DXTA 4BC5A 4PJOA 1KD1O 5GPAA 3SFMA 1XUPO 2ELKA 5IPAA 1C0TA 4L18B 1JXOA 2EV6A 4BRHA 3KVGA 3WXJA 2P6SA 3CUQC 1AKHA 1YCYA 4XNFA 3RTRA 4BR0A 4QKUA 3IRRA 2NUBA 4LG3A 2E1YA 2HCKA 3IWFA 4NHJA 3DLMA 5DM7R 3EYIA 4AILC 2JZYA 1AWXA 2EQUA 1RGIA 1HQCA 3IH3A 4Z0UA 2NLUA 2NUPB 1ATSA 1CKAA 4D7MA 1W97L 2K4YA 1HLUA 3HHGA 1VQPI 3NTHA 5LHGA 5EF6A 4XM3A 2ADUA 1VQ4I 4CW7B 3BG6A 1SD5A 3MXJA 2JUCA 4XIUA 3BDPA 4HQEA 3TTFA 1SC7A 3ZP5A 1TL8A 3CJTB 4DLGA 2OAUA 3P1GA 4JKFA 5AQIA 3RMCA 1JLEA 4DOZA 5GPCA 2P5KA 3L2CA 4UB8C 1HCRA 1V4RA 1AEYA 1HJOA 2QCOA 3SMSA 4FJJA 3HTSB 5FPNA 3PX0A 1VQ7A 4MTEA 3CCVI 2X1CA 4DSJA 4IUPA 4DYQA 3O3FA 1Q86C 4FSXA 3FXRA 4FO0A 2KQWA 3H08A 3HTVA 2LYCA 1X6BA 4KUMA 3VENA 3V8JA 4RAYA 1W0TA 2YRDA 1ZHFA 1IH7A 1YJWT 1VQ5I 3MN9A 5E8IA 1YAGA 4FU6A 4BYYA 4A12A 2XGEA 3OYLA 3E9GA 2GIVA 4CUGA 1DU0A 4FJNA 1O7LA 1TWCJ 2JWLA 4A3KJ 4KUDK 2O8EA 4YIIA 2EZKA 4A5BA 2PVOB 1Z9QA 1VRLA 2CP0A 1M5Q1 4M7XA 3OR2C 3ASNH 5KI6A 4OMLA 1VQMN 3PO4A 3A5NC 2X4YA 4I99C 2W6LA 4LF9K 1NKBA 1W5TA 4Y7NJ 2A68F 4I76A 1IV8A 5BPDA 1IDYA 2FNPA 3KFVA 4PJJA 4JI8K 1ZRCA 1S29A 2W42A 5E26A 3DRSA 5CZ1A 3J7AO 2LX7A 5C44J 3CC7T 3I59B 1ZSZB 1T03A 4IFVA 1R58A 5ICCA 3SDGA 4KI4A 1VIFA 1QW1A 1NJXA 4I02A 2YS9A 4A3LJ 4GV6A 5DTDA 3CQ8A 1AOYA 5M1PA 1YQMA 3VGMA 1ZBSA 1VUBA 1HKTA 5L8RE 2H1LA 1JT6A 1MA9B 1SQKA 4LDWA 2Y2ZA 1AZEA 1YHQN 1PSFA 4LG0B 4BR5A 5E8GA 2R7DA 4C8LA 3CCMN 4P9FA 1A5WA 2EQRA 5IT3A 4E9EA 3VEYA 3L2WA 2P9KB 1AHDP 3PFYA 1BR2A 4XSXF 2DIQA 1N8RU 2IVOA 3CCLN 1Z25A 3I55N 1HKBA 1FBSA 4BRMA 3UE5A 2K86A 1WHMA 3KWGA 1ZR2A 5AQUA 5JVHL 3S2DJ 3DKMA 1Q95G 5FKOA 4OWRB 1VA7A 2EFIA 4WQ4A 2GUPA 3EH1A 1BI1A 3HM5A 3GTQJ 1TXQA 4NLBA 3JCMg 1MBKA 2A6HF 4FYXB 1T0HA 1F5TA 1RRSA 3WNEA 4LD6A 2JMWA 2YNFA 5E3LA 1KVAA 1DGRM 3THYA 2YG8A 5GAMf 1J6ZA 5KGXA 2CV1A 2KFZA 1S5LC 2ESNA 2GOMA 3ZETA 2M30A 3CJRB 2GF7A 4F91B 3E19A 3ENHA 1WLPB 3F6VA 5FKMA 2GBYA 4DB3A 2DJZA 4KUIA 5SWMA 4H0YB 5FU7B 3WXIA 1C0UA 1J59A 5GMKm 3GZ6A 2WTUA 3HP6A 2KW4A 5DM6F 9ATCB 4A3CJ 3K4JA 2P4RA 1XHZA 2RPNA 3G1OA 3LWMA 3ABKH 4LFUA 1JLCA 3EEQA 5AONA 1R0CB 3ZSVA 1HJRA 1JLBA 2Q1ZB 2FRHA 2CUEA 4M7DA 4KMUX 2JN0A 1Q9XA 1RUOA 1GFCA 4BXUA 1RAFB 4A54A 4HW0A 2M8GX 2KKOA 3X25B 2CGKA 4EMGA 1KSPA 4BC4A 2K9NA 2JK3A 2CQQA 1KD1R 4BE1A 3ZPLA 3O4QA 2XK0A 3JRAA 1P7IA 2E2NA 3ZBDA 3NF7A 2P7CB 2GFUA 1ZLKA 1KU3A 1MBHA 4EVVA 3PUFA 3VEXA 1VF9A 3V8KA 4N41A 3SDBA 1SAZA 3PMTA 4FYWB 4MMLA 2HI3A 3EGXA 4M3GA 4OLBA 2VQCA 2QQAA 5KN8A 3J80E 3AVGA 5EEGA 1JXEA 5E84A 3H0FA 4H4MA 4DU4A 4CC3A 3ROUA 2UWMA 2E1MB 4BRLA 4KFCA 1B8IA 2MOXA 4HCCA 2RA2A 3JCMe 1JGSA 4Z8AA 2COWA 2PVGB 2XPVA 3TBIA 2F4IA 2EGEA 1IG7A 4XLHA 2E2QA 1EO1A 1OU8A 1Z9ZA 5GAEP 4LGWA 3CCRT 4H5NA 2XRNA 2KR3A 3TEEA 1K9MO 1D1BA 3LALA 5F1JA 2BV6A 5LL6S 1LWEA 2R4GA 1UGPB 2H8HA 1BO5O 2H6BA 5DYMA 5EYRA 1M2VB 2HBLA 3G4SN 2NRAC 4YPHA 1ZREA 2YHWA 2M51A 1JXSA 3VEVA 2W57A 3E5UA 3ZGKA 4FE7A 4FJ8A 1JKHA 1RI7A 1KZHA 3WT0A 1X3MA 4W97A 3PFSA 1YW9A 1WBDA 3LP2A 4O3MA 2EQMA 2YRVA 3M8JA 5B5EC 4MDAA 3VQ4A 4B1RA 3TP3A 1BBYA 4I7HA 2DD4A 2L0KA 1ZXOA 2CW8A 2MBFA 2HHSA 2GEMA 3DXMA 4FLYA 4M7AB 1VQLN 1ZLJA 3I58A 4JRIA 4JJCA 3V4IA 1D5AA 2DJIA 3ZN0A 4CGZA 3C2BA 4FLWA 2IJLA 3OW2S 1LFBA 3I71A 5I3UA 1PVEA 3MEGA 3QFUA 1YX3A 1LDDA 3FXMA 1XQPA 1YWOA 4LUDA 1SFKA 5EG0B 5HLGA 4CHOA 3NHGA 2PJRB 1JU5C 3EHQA 3LA7A 4B8CA 5LL6Z 4RW6A 1WNLA 1HU0A 3NGYA 4QCLA 3WTTC 4ZHRA 4BEHB 4CCNA 2RQUA 1W7PA 3LM9A 2CUJA 2ZXJA 1ZGWA 3G25A 4EHUA 2NYSA 4H0VB 4Y3OA 2E2JJ 1VQOT 4EW0A 1JJ6C 2K6DA 3THXA 2IBDA 1TSFA 1WVRA 3HB9A 4DBRA 1VQ6T 2GZWA 3ZMDA 2EWNA 2XAHA 2R7TA 3CHWA 1B9FA 3QNOA 1YI2T 2WSFE 5LHIA 3TSPA 1YIJA 1U2WA 3H5NA 2KK4A 1XOVA 2OTJT 2CP2A 1OI1A 1L3SA 3NRVA 1AT1B 1NK3P 3MJXA 2HOTA 3A2KA 4HUEA 4KISA 1TVRA 3LSIA 4KA4A 2HBKA 4GFBA 4J9GA 3X2QH 3CPWM 3CD6Q 4PHTX 4PL7A 2L9NA 4Z89A 2QYZA 2KROA 4FISA 1C0GA 3MDQA 1GLBG 2O4IA 1EIFA 1QPMA 4YNQA 3KD1E 3G1LA 1R59O 3V4GA 2WONA 4HF0A 2WAFA 1WDXA 2VGNA 1W1WE 2EBIA 2Z1DA 4K43A 1N27A 4ILJA 3SEQA 2EJGA 1NG9A 4FLZA 2BE9B 1QVFP 2D8JA 4F9OA 1IBLK 3DBHB 2KE9A 5HDNA 1FJGK 1IKWA 2MLGA 4M3EA 4RKUE 4F7UB 3H3VK 1ESVA 4B3OA 1YITI 4YDUC 3A02A 1KQ2A 1W2BM 3SNNA 1NPRA 3PUBA 3HKZA 1JUMA 2HOAA 3L09A 4ZTFA 2VOPA 4E2FB 3BR0A 1XS9A 2W4SA 1GBQA 2K02A 4Y1DA 1ZGJA 2KZGA 4F8RA 2GIZA 3OR1C 1KYWA 4JBAA 2FXUA 2LT4A 3CETA 1G8XA 3VETA 2JVGA 2EHGA 1R22A 3OYCA 2QTDA 3CFPA 1R0AA 3MZHA 5FROA 2F9TA 3FISA 3H9JA 1EH7A 3LSTA 2ZGWA 4RWTA 4QQGA 4F2RA 5KQDA 1YX5A 1GHCA 1NMNA 4A5AA 5DD8A 2V8IA 4XIDA 3HBTA 3DPLC 2MW8A 4HZFA 5L3DA 8ATCB 4JI6K 4FM0A 3W6VA 1ZX6A 4ZGJB 1UWBA 2X85A 1D3YA 3H5AA 4PFOA 1D9FA 4C8QE 4DK9A 4BY1J 3N4MA 4CJPA 3H0HA 4FK4A 3I0XA 2K3XA 1QQNA 2MYSA 3E9OA 3DEEA 2W40A 3CTAA 2FNAA 4FX0A 4HOBA 4GV3A 3I0TA 4BUPA 4IOCF 2YXYA 2QASA 4FJMA 3EYZA 3IUCA 4OO1J 5CQYA 3PX6A 2WACA 1EP4A 2RNAA 1SSFA 2G7UA 2L7MP 1D0YA 5J1UA 1H641 2EGCA 2QQ8A 4FIBA 1YIJQ 2E34A 4FWOA 2O8DA 2EV5A 3CQYA 2Q36A 3GXOA 2EW3A 1U49A 1UUEA 3MWTA 1BC8C 3NTIA 3KEQA 1HC8A 1IZ6A 4IUTA 3RKXA 1ATRA 4M71A 1PVSA 5KYNA 1TNSA 5CR4A 2AIRB 3MN6A 3AL0B 3K1NA 4HF2A 4DTNA 3GTKJ 2AKKA 1NBWA 2GGRA 2OJED 5J3BA 3M56A 3NH0A 1D1CA 1QZYA 1LPQA 2JA5J 2QWMA 2HYJA 2AHQA 3V7RA 2OI3A 1BW5A 4IZ9A 2BE2A 2X1EA 3I0WA 1X1PA 4BJ6C 3F8BA 4ESFA 3MMVA 3MWPA 4BD3A 1W0UA 4NXMK 2J6KA 1TS9A 4CHPA 3F22A 4ESJA 3DF8A 1JKPC 1S6QA 3SZPA 3PSFA 4ZYHA 1YS6A 4XRSA 1EFNA 2Z1GA 1HMVA 4DZJA 2IP2A 3DV8A 2LD5A 4FM1A 3AVCA 2KT0A 2ICWG 1F4KA 2F4OB 1S1VA 3QIOA 3GF5A 3OV8A 4B3SK 3WQUA 3NDKA 3QG1A 1KVCA 4XKVA 3HO1A 3M8EA 4CF2A 2VQHA 2G3RA 1K76A 2VPLA 3G0QA 4KT0E 2DBBA 4YIRX 4FW1A 4LF6K 2GA1A 3P38A 4FLVA 1ZBXA 5H2FC 3S2HJ 1NGDA 2QM1A 2VQLA 1XG7A 3SUQA 2DTUA 3Q9SA 1BCOA 3OYYA 3E5XA 1FIPA 3JCMW 3L9FA 2BYVE 1DP3A 4H0XB 1RRQA 5H1SQ 4IZZA 2R7ZJ 1RBVA 2DL4A 4CZZA 3QYFA 3CC2I 3FXUA 3DLAA 4YTLA 4M3WA 1KD1U 4B22A 2R5YA 4NC8A 1U9NA 1E7OA 4GMJB 2J06A 4J9EA 4G7OF 4CF0A 2CWEA 2G9WA 1HNVA 3C2GA 2GX9A 3L4IA 1HW2A 2HGCA 4M73A 5FB2A 3A0HC 1IN5A 2DD5A 1B9MA 5J1EA 3O5ZA 3K9JA 2X78A 1A6QA 1GL5A 1TP4A 2E5ZA 3FX3A 3SYZA 2DPNA 3G2BA 1XB4A 1NGGA 1UMQA 2GQVA 1GT0C 1SUQA 2EKOA 1S1XA 4MO5A 2PN6A 4BWJA 2O3FA 3MEEA 3WGIA 3FXOA 1QHGA 3JCMb 3UATA 1Z0XA 2Y1IA 4DR7K 4CZIA 2JRTA 5GIPA 2O7OA 1K1ZA 3HSFA 1RAGB 3PO5A 3ZXSA 1JJ2S 2ZJQF 3OSVA 2D1HA 2VV5A 1RT7A 5GP9A 2CS7A 2IIRA 4Y15A 2J4RA 4KREA 2FPFA 3ZSOA 2QUFA 2PMUA 3LCNA 3KP2A 3DEWA 2BXZA 3QP6A 4A4GA 4O8UA 2FHDA 1NJZA 2KAFA 1I5ZA 1I8FA 2OTLT 1YOVB 4EJTA 1Z7UA 3P4IA 4ILHA 2F5DA 5CK9A 2A5YB 5D5WB 3VQAA 1M3QA 2XICA 4LH5A 4HVJA 4F92B 4CE9A 5LJ3j 2JPBA 3WU2C 1UGSB 5CKTA 2CGPA 4YOXA 3QFPA 5IXBA 4Z4CA 1RAAB 3TGNA 2VB6A 2MFZA 4DTOA 4AG2C 2AO9A 1UJ8A 1NBEB 5FKKA 2MH2A 3AO2A 4FE4A 1T6CA 5D4SA 4J9CA 1FN7A 4B3RK 3GZNB 3ZETB 1JHHA 3LZIA 3S3NA 4XOPA 1KYZA 3TVTA 4IO8A 4DV1K 1SFOJ 1T44A 4AIAA 4H0PA 4ELVA 4ZDPA 3ZQFA 1WEFA 2LCSA 4CGGA 5KCOA 2E88A 3LSGA 1YJWA 1LKXA 5FLXE 2OCCH 2R7YA 5LMUK 1WSUA 2EFNA 4CESA 3TSQA 3Q0UA 4HHTA 1FYMA 2PQWA 1VIEA 3CMAQ 3JS6A 4UOBA 3GZ5A 5GADP 2OA8A 4DKWA 1QZ6A 4FJHA 4M78F 4C5EA 4CC7A 3IH4A 1XC5A 4A53A 5DM6L 2BVMA 4AVPA 4M78D 4Y0WA 4DTPA 2M0MA 1R6RA 2OPTA 1N6QA 3TOAA 4BXFA 4EEFG 2D5RA 3D0SA 4MFBA 2K3YA 1KG2A 2N8GA 3MP8A 2HVHA 3CD6N 3Q5FA 1GRIA 2LF7A 4AFZC 4QS8A 1P8ZA 4XLNF 4ENMA 1K7AA 3G6ET 2GXBA 2XHCA 1I5LA 4G6DA 1BR1A 3CXCA 4AVZA 5C4XJ 1YXQA 3CC7A 1XCVA 1KFSA 3A8GB 5C2DA 1SL1A 3J80O 4C8QA 3IKMA 2ESHA 2EYXA 4N0AA 1LNXA 4OB1B 3NVKA 4DSKA 3CCST 3ZSRA 2H3EB 5SZTA 1U45A 3A01B 3CQTA 5LJ3e 3L7WA 3ZQHA 1DUXC 1OCPA 4DMNA 1J2XA 3LQRA 3IKVA 2D0QB 1MD0A 4EGZA 1IO2A 4CJEA 4I7FA 1YQRA 2VYTA 3O9SA 5I2MA 4WK8F 1STZA 3CPEA 4GLKA 3VGKA 3F70A 1GBRA 3BPVA 3T1BA 2Y90A 1QHTA 3NAEA 4M74A 3T1AA 2DAQA 1LJ9A 2XAQA 1PCXA 2JXBA 3H1QA 3VQDA 4CIEA 3NF9A 4CJKA 1NEBA 4YRVA 1MGQA 1P9QC 2G8VA 1VYVA 4K11A 1T7PA 4L9VA 3WODF 1QHAA 2BVLA 1QVGP 2E5LK 1T08B 1NH3A 3CCUT 2NRWA 1PKTA 3LSKA 2CZ7B 1TL3A 1X2NA 1TQMA 5JHUA 3T7ZA 4MHGA 4KFBA 4CECA 2FBKA 3LW5E 4EP5A 1YNZA 2TDXA 1NTCA 3KBGA 3D6RA 2RQVA 1XDSA 4C92C 3PIPF 2HAXA 4WCGA 2A1RA 3AT1B 3OYBA 2KPMA 2PX9A 4OKKA 2JM8A 1V3FA 2EBPA 4MEXF 2E65A 3CUQA 4C0DB 2LDUA 2LQWA 1J0RA 5AQZA 4H5WA 1NG2A 1K73O 5K7FA 4LIVA 4RB0A 3CPFA 2LQ8A 4FWNA 2KTQA 2CZ6B 1VQKT 3HSCA 2KHOA 2ESWA 5AZJB 4FYVB 3BCBA 1V29B 3KEOA 2OFKA 2DJQA 4FXDA 1CXUA 1YIJN 4M77C 1Q1HA 1U47A 5M5YJ 4JHDA 4Y1CA 1FZPB 1MPGA 4DOWA 3UKUA 1VSHA 3LAMA 4YOYA 3FDYA 3ZX3A 3WTVC 2XPUA 2XUBA 3CCMI 4I6MB 3IRXA 1ZG1A 4JNEA 1TG0A 2JGUA 1UAAA 1VSLA 3NH2A 5DCMB 1XMOK 2HEOA 3P31A 2XKOA 1ETOA 1G83A 4H0TB 4J00A 3CC4T 1RTIA 3CCLI 2PI0A 1OH6A 2L7FP 2K9SA 3CC7Q 4N4IA 3I55I 2BE7D 2KZZA 2PMHA 1K9MU 2BUDA 3LWLA 3P8BB 3P7NA 1VSMA 1LWFA 3VA0A 3PQKA 2M16A 5LJ5j 2VLAA 2L9RA 3AAFA 3PVLA 4GVEA 1MBJA 3NFCA 5GMKj 2X0LA 2EV0A 3D2EA 2KGTA 2RHYA 4A4HA 4PA1A 4DQIA 2L9VA 2BTFA 3HKZN 3ER0A 2RB6A 1WJFA 4I01A 1J54A 3GF2A 3ULQB 1QWEA 2Q31A 4RTWA 3WTZA 1R5HA 3LWHA 3E97A 2XY7A 4B3TK 3SWNC 4PSXA 1WHUA 2E1NA 4OMFB 2DA9A 3CCRA 2UUCK 2KIFA 4KIBA 4GY2B 1JO8A 1AWCA 2FMYA 1OR7C 3RIRA 1D8JA 3VQ6A 1WJCA 2P0PA 2DIGA 4KT6A 4CK2A 1IGNA 4EMKC 1B3QA 2HL3A 4E70A 2K79A 2CFXA 3S3MA 1U5TC 4TSXA 2XAGA 4UB6C 3K5OA 4LY7A 4BY7J 1IO6A 3CDLA 4FLTA 3EH2A 4NQWA 4RTUA 2ZMEC 3WTXC 1A04A 3SEMA 5J6XA 2NUZA 1J5EK 3U9GA 2EH3A 2VOOA 2L3SA 2JRMA 2M87A 1REPC 4ILGB 4DTMA 2K27A 3K9TA 1WEIA 4KGXB 2V1RA 4CEOA 2BY0A 1SMYF 4DSIA 4JAXA 1G6NA 3GNFB 3U2RA 3BR5A 1WLJA 1FY7A 4PJ0C 1QVGA 2JJ9A 3C18A 1S9EA 1VQPT 4AHUA 2FBYA 1QNTA 5LJ5e 2Q0RA 5E3OA 4LE9A 3M4OJ 5D6FA 1IF1A 5GMKe 5CVRA 2WV0A 1VQMT 3K59A 2E2PA 2GWKA 1PUEE 3HOYJ 4E7JA 3S8PA 4BKXA 1FXXA 4CJLA 3M54A 3DLBA 3OIQA 1TK8A 1FYNA 4QPOA 2QM3A 4XONA 3EGUA 4BGAA 3LL3A 3IL2A 2HZTA 5GANg 1M1KR 1VTNC 2Z5UA 2RAEA 3GX4X 1K8AO 2FBHA 4MLHA 3V1OA 2FBXA 2A42A 5LJWA 2P6TA 2LTOA 2YNHA 5HDGA 1U84A 1IXCA 2VBXA 2VXEA 3CM5A 5GANj 3CCVT 2K9GA 4BB7A 4PLIA 1U1TA 3R2XC 1GFDA 3SXYA 1VQOA 3ULRB 2KVQG 3ERMA 3HTUA 2NAZA 3HFOA 3LPUA 2DMUA 1VQ6A 1ABOA 2RK1A 3DOLA 2RI3A 2FSWA 3NQOA 2V6EA 1IHVA 2LP0A 2ZC2A 3SK3A 4M3YA 1ZKGA 4EV0A 1YRNB 4IOCL 1YI2A 3JTGA 4DHYA 4OIRF 1BI2A 1YHQT 3T1HK 2OTJA 2A28A 3MP6A 3SBTA 2L3QA 4XR6A 2A6AA 1Y0NA 1RDCA 4B9UA 5AQWA 3B8AX 4YOVA 3HL2A 3VYRB 2JA8J 4CHZA 2EYQA 2P9SB 2GA2A 3G7ZA 4DR6K 1BQMA 3EUAA 2NS0A 4NUBA 4E3SA 1OKRA 3QRFF 1P92A 2EYWA 1VSDA 3EDPA 3DTEA 2FX0A 3G0ZA 1JUPA 2RJFA 1KLMA 4G12A 3DKYA 2CFOA 4JS4A 1TK0A 2O8BB 3CMAN 2L01A 1WH7A 2J6OA 3J81Z 4PZJA 2FZKB 1T05A 2DLLA 2M4KA 2O9SA 1NGAA 2JM9A 1A0NB 2XDBA 4AWXB 3MZYA 2CMPA 5GANh 2ZNYA 2ID6A 1Z77A 4YFXF 1M90C 1K8KA 4KBOA 1D8KA 5DM7F 2QGGA 2HHWA 1K78B 2DCEA 4E1NA 5KYYA 4HV6A 5GANe 3CLOA 1LJOA 3CPWP 2YNGA 4Y92A 1MW7A 2RNJA 4RTTA 2HDDA 2HKQB 5CKHA 4PY5A 4TV7A 1Z67A 3O1WA 1SF9A 4XTVA 1W7AA 1FKOA 4JX6A 4A4EA 2EIKH 3R8EA 1NGIA 3WXMB 1JXMA 3R60A 4JI5K 4PJNA 5TGTA 4M75C 1WSGA 3BZ6A 2L54A 2YKMA 1VQ9Q 5M5XJ 1SFUA 1Q86O 3QNNA 1UHMA 5IOYA 2EFWA 5M1FA 4UUSB 1CZAN 3QOPA 3ASKA 3H8ZA 4QW2A 3AFHA 2X6NA 2ITGA 2XAUA 2M2EA 2Q0UA 1I1GA 2YUPA 3IUOA 4H5TA 2V1DA 3KYCB 1W2BP 4FL9A 2QEXI 3D7SB 2HMIA 1DQUA 2NUTA 3FIFA 4CJ3A 2QSHX 3LMMA 1ZBUA 3RSEB 3KIOA 4J19A 1KG1A 3C0BA 2HPIA 1HKGA 3HUGB 1VQ6Q 1QVFS 2DYIA 3MCAB 4JI1K 5E3MA 4CCLA 4CGIA 2DODA 3BE3A 1ZK8A 2DQLA 2OTJQ 1DIZA 3RUXA 2Z1HA 4EPCA 1MWKA 1H89C 4MLEA 4L0ZB 3CJ9A 5CPRB 4B3MK 3O80A 3OY9A 1RNLA 4OB2B 2HDWA 4DW6A 3CMEI 2ACJA 3BZKA 2QA4I 1QO0D 1O1WA 3CCJQ 3VSKA 1A5XA 2ZJQL 2RF2A 5CKBA 2CREA 4G7ZF 3I8BA 2V1NA 5ILUA 1IW7F 1PDNC 2ZNZA 2HB5A 2VBZA 4KBMB 1Q7YO 1WH5A 1SHFA 4EA5A 3K57A 3NEUA 1KCFA 2CUFA 5A0DA 3G4ST 1FW6A 2MCNA 3I4PA 3S17J 3CCEQ 4ATOA 3Q7CA 3QETA 2WUSA 3EG3A 5ADXA 3E0JB 4KB0A 2OCEA 4FK0A 4Q48A 4ZJZA 3DFGA 3QLHA 3AVNA 3C95A 3JRGA 4LMYA 2DL7A 2D4WA 4C92D 1U3OA 5GAOq 5LLQA 3FZMA 2JA7J 4BS9A 4MO7A 2J05A 4HEA2 3CC7N 3UIQA 1V54H 5F1RA 4YOQA 3AO4A 3CI5A 1LFUP 1X9JA 1UFMA 3M57A 3WTSC 2FPEA 3ABUA 2ZKZA 3FMQA 2M45A 1PUFA 5GIOA 2OC6A 4YPRA 4E47A 3OB9A 4LDXA 1MV3A 2YJFA 2OFIA 4V2FA 1K8AR 3DQVC 1YTYA 3NF8A 3QU3A 3LA2A 4CZJA 1KQ1A 3I9V2 2CS3A 1VQ7I 3M8FA 2G8WA 3DEUA 2HHQA 3DMJA 2EKHA 4C2UA 3R9PA 4N5SA 4Z4EA 4PK4A 1RT1A 1X3ZB 2ETHA 3WHBA 2V7ZA 1WX6A 2DT6A 2V7YA 2PUOB 1TW3A 3B6OA 1UG2A 3FBIB 4EW4A 2PBDA 2AXLA 4C8QB 3MKDA 4YDUA 3GNGA 4B48A 2XSDC 3GFIA 3MZ8A 5FLVA 5JFRA 4S0HB 2HYGD 4ELUA 1MH4A 4DV7K 2KDSA 1U2VB 1OISA 2IGOA 1N8RC 1HYOA 4X64K 1YE9A 2E10A 2IAIA 3AA5X 4ITVA 4KI6A 2F5VA 3LANA 2E12A 4MFEA 1AWOA 1OJLA 1NK2P 2RDPA 4LH4A 3PX4A 2ME0A 2FOWA 1S1TA 4J8FA 2DRKA 3M55A 3H0GJ 3FMRA 3DAWA 4A3JJ 1T2KA 3FHZA 3IAYA 2JTVA 3MQ0A 2PZSA 2RPIA 4EMHA 1MH3A 3I56I 1YJNI 5CVVA 3BDLA 2MPXC 2O8CA 1ULYA 1KQSA 3SJHA 4UQGA 4UHTA 1WXUA 2IVNA 1Q82C 3BY6A 1U5SA 3BR3A 2NOFA 2OZSA 2OTLA 1RAIB 1R4MB 3EHRA 1C0MA 1XGSA 2ZSHB 2W82A 1RABB 3IP4B 3U9DA 3GFJA 5EJCA 2FRWA 2E1ZA 1KC8R 3L2QA 1Y07A 2DA5A 1VQ8I 2Q2RA 3CM6A 4QOZB 4QS9A 4C30A 2V52B 4GKJK 2LMDA 2BW3B 1MNDA 3VS5A 1N34K 1Y64A 2F5EA 4JD2A 3BGRA 3GE1A 2KJCA 3M3ZA 2NOJB 3PIPL 4F52A 4AM7A 3D1NI 1X58A 5CAIA 3HHTB 4GVMA 2ISYA 2A61A 2P7VB 4LITA 2IVMA 3L42A 4YORA 2HQAA 1P59A 3D2FA 2V4JC 3A2FA 1Q86R 2Y0MA 4QPQA 2X9DA 3GO5A 4DS5A 3UKUB 4M7AF 5C10A 3ID6A 3TSUA 2RV8A 5KRTA 4Q0BA 4NLCA 1D3BA 2L8DA 1SRMA 5GAHP 1YVUA 4M77G 5EVZA 2GBQA 1RBTA 4XH5A 3E01A 3AAPA 2QWWA 5KYXB 2JPCA 2Y4YA 3EGDA 2ZJPF 4KB1A 4M3RA 1Q81C 1OZ2A 4F93B 1LEAA 2ZGYA 1QKWA 2VWJA 4DR4K 5GAOm 3CCRN 2E41A 4CFBA 2AZSA 3F72A 3VA3A 2KHMA 3QPHA 4M9XA 3G6EA 1ORPA 4M7DC 3FBNB 2RJDA 4D7NA 1M9SA 4OB0B 4V19S 1HW5A 3I53A 4FWMA 2NOGA 4F2SA 1DKGD 5AT1B 4M77E 3CCSA 2XKPA 4BU2A 2Y31A 3C6UA 1IUFA 1B72A 2RD1A 1VSIA 2D2WA 3H36A 4BXXJ 3S41A 1ATNA 4JDSA 3M5AA 2X6SA 2VWKA 1YLFA 2Y9YA 4G9ZA 2M02A 3NARA 4NYNA 2E71A 1GV5A 4B9MA 3HOXJ 1R5ID 2HVIA 4QQ6A 3M58A 1IG9A 2DA4A 3KK7A 3B6CA 2HDCA 5TKYA 1RAHB 4GDFA 1SD7A 5IY5H 1HQUA 2X35A 3M0TA 5M9OA 2OTLQ 4YEJA 3LP3A 3MWMA 1KQ9A 1IRZA 3DPUA 1E4FT 3GOIA 1K73U 2I5WA 1QCFA 5KYUB 4B8XA 3CCUA 2Y0SA 2C0TA 2O4XB 5L3GA 2EYZA 3EYYA 3K4LA 3OYKA 2NVUB 5C4JJ 1YFNA 1GLAG 3OIPA 3JCMQ 2OPSA 2XGXA 1SZ2A 4JLIA 1VQ9N 3WUHA 3I4NJ 4XLAA 1WZ2A 3QWYA 4I98B 3WG7H 1E3HA 4LF5K 1NEGA 5GTHC 5HKCA 2O5RA 3SDZA 3BG9A 3BTJA 4FJGA 3D7EO 2FEIA 2DT5A 3ZEHA 2VE8A 2IC3A 2JMAA 1LWWA 4F7UF 3BC8A 1B9DA 4JV5K 3HKSA 2KBTA 2YLBA 4PL6A 2HF3A 1XCBA 4MDXA 1W36C 1VQKA 4WF9L 2VI6A 1IJWC 1VQ6N 3K2AA 2EQJA 1TTHB 1ZRDA 1K0SA 2IAJA 4FASD 4C23A 4H4KC 1DT9A 3VS7A 3U4LA 1XQHA 2EB7A 3LAKA 3D0PA 2OTJN 3EZ5A 2W48A 2VT2A 4O8KA 1QCNA 4HNVA 1AD5A 4AIKA 3SPYA 3HRUA 1XWLA 5HLIA 1X2MA 2QW9A 5D4RA 3MEWA 3AG2H 2X74A 2IA1A 3CCJN 4IXAA 1DTQA 4CF1A 2W7NA 2QGFB 1QVGS 1MDUB 1ZBIA 2EZHA 2EINH 1TWBA 5AQMA 5F27A 4F3OA 3G6EQ 2KRSA 2EVRA 3CC4A 5CVIA 1S5JA 1A5VA 3TTCA 4DQQA 2P9PB 3J81K 1OEBA 3ZSQA 2LH9A 4DFJA 3A8MB 4WTOB 2QLZA 2R7RA 2O01E 1PU8A 3DWLE 1Y97A 2OX7A 2VKNA 3CCEN 1HDPA 1MMGA 1WJQA 3O9UA 4I09A 4PGHA 3NTKA 4CHNA 4L8RB 3HOVJ 5BOXA 4PJOF 5JMVA 3KP4A 5C25A 4B9NA 4ZN3A 2XPWA 1TQPA 4R8HA 2XF7A 3U21A 4PJOD 1SRLA 4V2GA 1S72T 4CFDA 1H3HA 1TQIA 1FWZA 2HNHA 1BIUA 4AFQC 5B3SH 3RMBA 2HTSA 3HZ6A 2VKEA 2E1CA 4CZGA 1ERDA 3QIPA 2DK8A 3DLLA 2F48A 1CQTA 2JUFA 4IURA 2FZCB 4J6YA 4FWSA 4NYFA 1F36A 1PSEA 2P5VA 4UUTA 4RG8A 4X0GA 5F0XA 3ZR8X 2G8KA 3VQ8A 5FWCA 3CCUQ 4M41A 2JJ7A 4YELA 4E1JA 3VUBA 1IN4A 2P1JA 2JS0A 1OH8A 2A37A 2MK5A 3HGGA 4KH5A 1YIJI 4IFYA 4XK8E 1XGNA 3BR6A 3GFMA 5GMKi 5BR9A 3HIFA 1N39A 1VZ0A 3NGIA 2XDVA 2A5WA 1K8KB 5FLXZ 2CP3A 1DLOA 3RYRA 2XDDA 2I7NA 4IOAF 2BIVA 2EGAA 1K8AU 2RQPA 4BBRJ 3HPWA 1UCRA 2EJ9A 1I39A 4OIPF 1PNJA 4ENJA 1VQKQ 1V5FA 1XSVA 4BQLA 3H1VX 3HJFA 4B9LA 1T33A 2DZCA 5DM7L 1C1BA 2LNHB 1VQPA 5AQPA 4YFUA 5KAIC 4EJWA 2E2HJ 4QIWN 3EFRA 3L1AA 2K5LA 3OIOA 5EZHA 4LF4K 1VQMA 4U0VA 4XTWA 2XG8D 2HNIA 4HRIA 4HUFA 2V79A 4UXNA 1D5YA 3EG0A 1T6SA 4M75G 3QBXA 4ON0A 3JB9D 3TWHA 3PFIA 1AA7A 4HLXA 4OMMA 5DLOA 3CD6T 2NUTB 4A2UA 4P9UA 1K4SA 5CYQA 4BRGA 1N3AA 4CK3A 1KHIA 5EZGA 1U04A 1G3YA 4B43A 3BQZA 3OYIA 2GXGA 1HYSA 1RI0A 4B9SA 4KHQA 2DFIA 4CJTA 3A8OB 3CCVA 1QTMA 1YIOA 3QYGB 5KYWB 5LJ3d 4B4CA 1WJAA 2CH5A 2QKBA 1ENHA 4ZYAA 4XLEA 3C3WA 5KNLA 4M78G 4M75E 1ETXA 4FZZA 3O8GA 3TABA 5IP9J 1QSSA 3BPXA 5C3EJ 4IL6C 1YHQA 4FPBA 3C0CA 5FD5A 4A63B 2K9MA 4WXCA 2VN2A 5BN9A 3T3FA 3LX7A 2UZKA 1QSYA 2VVKA 3CCQQ 3VS2A 3RI4A 3VS4A 2DZ9A 4BRQA 2DA3A 1FKPA 3M1FA 5E1WA 5GAEJ 4NB4A 3GL1A 2P9UA 3KCCA 4M77A 2ABKA 4M78E 2MAMA 3UDCA 4O6JA 4BJTA 2ZPHB 3LM2A 4ZH4F 3QPLA 1M1KC 3AG4H 4K25A 5CHIA 1OCOH 2L4MA 4KNYA 5H6QA 2HEQA 3SAFA 2GQIA 4XLPF 3K70D 2DVJA 1TGOA 1VQNI 1XQSC 3EL2A 3H0IA 3UF4A 3H3NO 3AA3A 4RW8A 2E1MC 3MPUB 3GPLA 2O8XA 2GBZA 1VSJA 5BPIA 5BRFA 1I4K1 1BWFO 1Q86U 2JUGA 3VFZA 1WJ5A 2CQ7A 3O3GA 4LN2A 5HRSA 2JTFA 5K7ZA 4E7IA 1BIBA 1JI8A 3CFRA 1NLPC 4C5GA 2P9IB 1FIAA 2R57A 1RLQC 1L3LA 4KGVB 1LOJA 2KIQA 1BYMA 1VSKA 4FJXA 4KHNA 1GXIE 2XAFA 4KHSA 3OSFA 4FM2A 1VQPQ 3UKRA 3DB4A 1PP8F 1VQ4Q 3H3ZA 2Y9ZA 3A5ZB 1KK7A 2F5TX 3P8DA 2HNYA 2DJNA 1T98A 1K4TA 4OF1A 1YJ9I 1OFCX 2A1SA 4OX9K 3RJPA 2ITMA 1F1ZA 3VMFB 1OR7A 4EIAA 4A6DA 1EETA 2RJCA 2JT1A 1U5TA 4JEPA 1WBBA 2CDTA 3IH2A 1FLIA 2PVDB 4CD3A 3CCVQ 4A3GJ 4Q5SF 2LRQA 1D1AA 2WADA 2YT6A 3HM9A 2OTLN 1UECA 1RBSA 4IQJA 4D5FA 2ZMEA 4EAHD 3MEDA 1VFCA 1SL0A 4M7DD 1WNSA 1FMVA 3ZT4A 5J1YA 3NMUA 1QQJA 2LREA 1Q7YU 2BOLA 2P84A 4ZN1A 2XD0A 3PM1A 4LLLA 4E7KA 5IOZA 3DPTA 1VQ5Q 2MWOA 1F1BB 4I0BA 2YI1A 1Z1DA 3OYNA 5CKEA 1X9MA 3M8PA 4Z2YA 2GWJA 1FTTA 2KKZA 5GJWB 2QWPA 2EA2A 4XU2A 1XMKA 1JLAA 2O6GE 5AJ3K 2PY5A 3BG3A 2UXXA 3DWLA 3CPWS 3TDZC 2W24A 3OBWA 3CJAA 5CY4A 1WZOA 4BDPA 3AY9A 2H1KA 2F6CA 1TW2A 3VRZA 1KXPA 4ICLA 2ETJA 5IT9E 3HRMA 2IPOB 2PBIA 4CF8A 4DU1A 1MIJA 4A5NA 2LY9A 3RDVA 3G4SA 2YX6A 2XRLA 1L3VA 2STWA 2IS6A 1Z26A 3DXKB 1LV5A 3BTCA 4O55A 2KY9A 1WOQA 2G6FX 4XORA 2FSJA 4JKGB 1W2BS 3RSNA 3ZEUB 3INZA 2XRIA 4FLXA 2VT3A 2F96A 4FWRA 1MU2A 4MZPA 2VBYA 5KPTA 1KJWA 3RDIA 2HQRA 4BQQA 5IHNA 2BGGA 4DYRA 4A0ZA 3FZHA 5BQTA 1T6DA 3G6EN 3BQYA 5LJ5d 3CJBA 4ABZA 2WY8Q 5AIQA 3MEXA 2XB5A 3FIWA 3N5BB 1WQWA 2UXDK 4UY8I 2CT3A 3OYAA 4XTUA 4JLGA 2NRHA 3L1PA 4BQAA 3KLNA 1ACMB 1O13A 1ZUYA 2CZ0B 3ITHA 4NC7A 2ZWHA 3M9AA 2J6FA 5JLHA 5DUKA 4JI3K 1T56A 2WWYA 4L59A 1ZQ3P 4XU3A 1KRPA 1K83J 3CXCM 3K10A 2RHKA 4AIDA 2OQRA 2YNIA 3F8MA 1OQKA 3S2WA 3FWEA 5AZIA 4BQNA 2COMA 3THWA 1ORNA 3G71T 3TO6A 4BY9C 2BUPA 2F5FA 3LSHA 1CGPA 5BPNA 4XQFA 2RHIA 2X6YA 2ZJPL 4CZFA 3CCUN 2Y0SN 1YJWI 3QEWA 1HNIA 1KHCA 1AVZC 2M9HA 2V9VA 2WTEA 4XRMA 4V19K 1WJBA 3J7ZO 1W7PD 1NPPA 2XHBA 2MC3A 1P2FA 3HBLA 2Y48A 1HNWK 3TQNA 1KVBA 2E3HA 2P0KA 4KKOA 2DEQA 3PQJA 2OJ2A 3E9LA 4U88A 4KRFA 1CKBA 3TARA 4HPQA 4M6XA 4M75A 4LSLA 3MAQA 2LVSA 2DA7A 1J75A 3W0LA 1EF4A 5EGOA 1YTAA 4M3XA 1UB4A 3CVSA 4HSRA 1VQKN 1N78A 4HSBA 3CWSA 3CC7I 2G7HA 5D6WA 3UA7A 4DV6K 4AFUC 3BF1A 2D0AA 1FOYA 3CMAT 2ZPIB 1RUNA 1WSIA 3AGRA 5TISC 4MFDA 3TREA 3DLHA 1C0FA 3BCAA 2JA2A 3R6OA 4M78A 4M7YA 4CHYA 1UHWA 3AL0C 3KP3A 3QODA 4OMOA 2Y75A 1WSFA 1Y6IA 2DA2A 2V9PA 4HV5A 5F1XA 2CRGA 5K5RA 2XIDA 1HRHA 2DF6A 5D6YA 4DSFA 1UJYA 3ZN1A 2MC4A 4PJLA 3VYHB 1MJBA 4JUVA 4IRGA 4H03B 3JRIA 1PU6A 4NNJA 4J7IA 2AHJB 5LRSA 2K3BA 3ULEB 5M1NA 3VF2A 5F2RA 2VWFA 3AO3A 1D09B 1RFQA 4RCHA 1MGTA 2BBYA 2QDLA 4IHYA 2R0QC 2D8HA 2BHZA 3PGGA 3TI0A 4WQ5C 2ENMA 4JKHA 4M4ZA 4K0KK 5D5UB 3VYGA 4MTDA 2UV1A 4IDHA 4UUVA 3ONQA 1LVKA 3KK1A 5I11A 2ELHA 2IGMA 4W5OA 3ZFJA 4G7HF 1V76A 4OGCA 3V42A 3SFZA 3ME9A 1QVPA 4RB3C 3CCQN 2A6TA 1KC8C 2I10A 4EJZA 4JRKA 3PTAA 4QTRA 1TK5A 1N9SA 5GAMg 4XBFA 3HJEA 3QBWA 3I5SA 4MLOA 1S3JA 4MQ9F 1S8NA 3QXEB 4NDLA 3TL4X 4Y17A 3KFWX 5GAMj 3A0IX 2R92J 3NPFA 1HUXA 1YVNA 5KPRA 2LK2A 3IWZA 4ISFA 4M72A 4D8DA 5BR8K 1RT5A 2MI6A 3BUZB 1FTZA 4A2BA 1ETVA 1USTA 3QAHA 1HSTA 1SFEA 2LY1A 2EZLA 2XKOC 1IV0A 1BHLA 4B3XA 1JKRC 3M4GA 2IS3A 4U0WA 4CI6A 2HSPA 3FM3A 2VJ4A 5F64A 3OYHA 5FLXK 1CSKA 4RUGA 4RW7A 4JI7K 2RK2A 2LC4A 4CYCB 4BL0B 3C65A 3KK3A 2HVRA 2CGHA 1QPIA 3WTWC 3UKGA 3K2PA 1I50J 4RA2A 3HPOA 2NYXA 3BJ6A 4XU0A 3FKIJ 3X24B 3L6QA 2YLCA 2X6XA 4R79A 5E18F 4JI4K 1UZCA 4HNUA 3HM8A 1ZC6A 3DB3A 2QEXT 3UT1A 3FSPA 1RUWA 3SUNA 2D0NA 1VQPN 4XLCA 3QKJA 3VRYA 5DD4A 2RHXA 3F6OA 3META 4YOUA 3J7YP 1S22A 1VQ4N 2R7VA 2AQEA 1LUJB 3CJQB 4ENNA 2D1KA 2IA2A 3QMLA 3R6MA 3QJ6A 2CKKA 2DW4A 4Y52J 1WSEA 3K6GA 1FSEA 2D6FA 2JZ2A 2KMUA 2P9LB 2ATCB 3KTUA 1NKEA 1WI3A 1NGBA 3M0PA 1UAXA 3OJSA 1TUDA 1QVGM 4OPHA 1ZA2B 4U7BA 1SD6A 1GOCA 1QZEA 3CCVN 3V9WA 4Z4GA 5GAMe 3CCRI 2G0EA 2XHKA 3BP8A 2HZYA 1O3SA 1M1EB 1X6GA 2RHUA 2L2PA 4HT9A 4IOAL 2JLEA 3OYJA 2CP7A 4A93J 5GADJ 2RN8A 3MN5A 1IB8A 2R5AA 1GXQA 3K1MA 2F69A 4L6V5 4H5RA 2G8UA 2AK5A 2YV0X 1RCHA 4LDYA 1JGGA 2LOOA 4X1VA 4II2A 1M90O 5I2SA 2DXIA 1R49A 2P5LC 4IIMA 2GTOA 3S6WA 4JOMA 3TTDA 2Q1NA 4FWQA 1MUYA 4FQGA 3IHUA 1YFHA 2EJFA 1EKEA 4MQVA 5AN4A 4DV2K 3HVTA 2G8HA 2K57A 4OINF 1YITQ 4E7SA 2VONA 3TO7A 2JSPA 4Q5WA 3T1YK 1CLQA 2VQEK 3GTGJ 4CJ5A 2FQ4A 5L3FA 3W2WA 4OFEA 3S93A 5GAOr 5FFXA 4C92B 4BY6C 2QWQA 4KH6A 4BG8A 8AT1B 2LBFB 3QZ5B 4OAZA 1EH6A 1QHHD 5K5QA 1QMCA 1UGVA 4C5IA 1NGCA 3HK2A 2YR2A 1MHNA 2HFHA 4IUVA 4HSTA 9ANTA 3HT3A 3LPTA 2DTHA 1PRMC 4UNFA 3LP0A 3S1MJ 2BTTA 3SI6A 2GNCA 3J81E 4CEQA 4BVPA 4KIFA 1Y8RB 2HQEA 1S72A 4FPAA 3VQEA 2P9NA 3AVFA 2VKHA 1RKTA 1Q1VA 4A69C 3QO3A 3K69A 5I9EB 2UUBK 1MMDA 1BUPA 4FWPA 1NYFA 4NB5