5FRNA

Crystal structure of the prototype foamy virus (pfv) intasome in complex with magnesium and the insti xz419 (compound 4c)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
367
structure length
367
Chain Sequence
b'DAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVGRPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PFV INTEGRASE
publication title HIV-1 Integrase Strand Transfer Inhibitors with Reduced Susceptibility to Drug Resistant Mutant Integrases.
pubmed doi rcsb
source organism Human spumaretrovirus
molecule tags Transferase
total genus 102
structure length 367
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2015-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
A PF17921 Integrase_H2C2 Integrase zinc binding domain
A PF18103 SH3_11 Retroviral integrase C-terminal SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2300 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 5frnA04
1.10.340.70 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 5frnA01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5frnA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5frnA03
3AVJA 3T19A 5SWMA 4RW8A 1WSGA 2YKMA 3OMCA 4RW6A 4M3RA 1CZ9A 1CXUA 1RCHA 3MEVA 1X9WA 3L2QA 1OZ2A 3LX7A 2R5AA 1QS4A 3WNHA 2RHUA 4KB1A 3VQBA 2OZMA 3QKJA 1RILA 4Z4FA 3MP8A 3THVA 1TAQA 3OYLA 3AVLA 1Z25A 5HRNA 4CGIA 4CJRA 1NOZA 4J2AA 1UA0A 4DU1A 1DTTA 3S3MA 1TAUA 3NH1A 4FJ9A 4B9SA 1RT1A 3FDRA 4OKJA 3F70A 2P0KA 3I0RA 1D9DA 1JLEA 3AO3A 2RJEA 2GUIA 2OPQA 3DLKA 3QBYA 4Q0BA 1JL1A 5EU7A 1NK4A 3HL8A 3AVMA 2XK0A 1YVUA 1NJXA 4N76A 2F96A 4CRIA 2MWOA 3NCIA 3SPYA 2WACA 4NYNA 1KTQA 3KD5E 4F2RA 3OVNA 3HT3A 4JLHA 5KRTA 4DTUA 3PY8A 4JS5A 1OI1A 4CGJA 3NTKA 3ZSOA 1NJYA 4IG3A 3ZCMA 4KI6A 3CFOA 3AVFA 3WNGA 4OPKA 4ELVA 3O3GA 3LP2A 3K57A 1BI4A 4DTRA 3C6UA 2JGUA 3PMTA 1VSFA 1TVRA 1JLCA 1Q8IA 3LAKA 1NJZA 3BDLA 4CHNA 4M3WA 1S1WA 1RTIA 3O3HA 2QQSA 4B9XA 1A5WA 4DTMA 1J54A 4RW7A 4HHTA 3V9SA 3HVRA 3OY9A 2OPPA 2EQMA 5D6YA 4NS5A 1TKDA 1BQMA 2PY5A 1SKSA 3VQAA 3HP6A 1VSHA 4C8OA 3P1GA 3C95A 2QK9A 4HUEA 1G15A 1SSFA 4M45A 4AHRA 4LH4A 4RG2A 3QEPA 4B9UA 1L3TA 3VQQA 5J39A 1RBVA 4FM2A 1S1VA 4GMJB 2D0CA 2F8TA 2X6NA 3LZJA 3LAMA 3PNWC 1T05A 3HPHA 2Z1JA 2LVMA 1L3VA 1KCFA 1EKEA 1OZ3A 4DSLA 3SPZA 1ITGA 2HHQA 1HJRA 5C24A 2JTFA 1BIUA 1LAVA 1YT3A 3E01A 3LALA 3MAQA 4KTWA 4QAGA 4W5NA 4QW2A 1B9DA 2XY7A 3BGRA 1D5AA 4G1QA 4PLLA 3AA2A 1VRUA 3P8HA 2RHIA 3TAGA 1JLFA 4Y1DA 5IN1A 1UOCA 1K6YA 4FLYA 1JKHA 3MEUA 3RMCA 4I9LA 5KCHA 4E89A 4ZTJA 3OS1A 2LSNA 4HUGA 2RO0A 1DLOA 4J2DA 3QEWA 3OYNA 4QQDA 4OLAA 1NK9A 2KTQA 4E3SA 4I2PA 1YTAA 3ITHA 4IUQA 4FM0A 2HHSA 4PY5A 3META 1EP4A 2HW3A 1HNIA 1BL3A 1NK7A 2X78A 3MECA 4CEAA 1LW2A 3CEYA 3NF7A 5HRSA 1U4BA 4N4GA 1U48A 4CK1A 3L8BA 1OYXA 2R58A 5KGWA 3ZSYA 1NKEA 5CYMA 1FK9A 2KQ2A 3NNQA 4CHZA 2VWKA 3F73A 4CJTA 3T1AA 3A2FA 2F8SA 3EZ5A 4KTZA 2Q3SA 2ITGA 4LSLA 4C5HA 3KJVA 2A1SA 1A5VA 3AV9A 5CY4A 4DQPA 1S9GA 2D0AA 3SZ2A 3EY1A 4RG8A 1TV6A 2XO7A 2HQXA 3DMJA 3NH0A 2XDPA 3TI0A 4O55A 4FLVA 4CIGA 2R7YA 3VQ8A 1TL3A 3IS9A 4CJ4A 3UWNA 5J2QA 4LD0A 3ZT2A 1X9MA 2HHXA 4M41A 1N27A 3U6FA 3CYMA 2QXFA 2OPRA 3NF9A 2L3RA 2O4XB 2B5JA 3NF6A 1T7PA 3PX0A 3KLIA 4ELUA 4BACA 5J26A 3PX4A 1ASVA 1W0HA 4O4GA 1UWBA 1WSFA 4IUTA 3JSMA 3OYKA 1WSEA 3ZSZA 4N41A 4A4EA 4CEZA 1WGSA 1IKVA 1KLNA 1GOAA 3ZT0A 3V1RA 2VG6A 4C8MA 2IC3A 2XHBA 4DF8A 3OYEA 4Z4GA 1QSYA 1QHTA 3AA3A 2DIQA 2LTOA 1QSLA 2BKDN 3OYFA 2GBZA 3SI6A 4CF0A 2QKKA 1RT6A 4K8XA 1ASUA 3P83D 1ASWA 4NCBA 1WAJA 3NE6A 1RT2A 3BDPA 4DS5A 1CXQA 1VSEA 4B8CA 3L2RA 4CGFA 4DSIA 3KLGA 4B8AB 5JS2A 4HCZA 2W42A 4L8RB 3AVGA 3D45A 4FLTA 4KHUA 1FXXA 3LPTA 3VQ6A 2RI3A 3DLGA 3K59A 2EFIA 4OKEA 4DS4A 4H8KA 5HRPA 1KFDA 1RTJA 4CFAA 2E6LA 1TK8A 3TWHA 3AO2A 3NGZA 4IG0A 1XHXA 1WJRA 2IGIA 4BDZA 2M1HA 2HB5A 1EETA 1N5YA 3ZT1A 4RW4A 4FK0A 2RPIA 2Z1HA 3NGIA 4C8KA 1U47A 3L2VA 1TGOA 5CZ1A 3SUNA 3SQ4A 1HRHA 3L3UA 4KAZA 5D3GA 3HK2A 1VSLA 1S9EA 4QQ6A 3AVBA 2ZQBA 5J2NA 4FLWA 3L2UA 3ZSWA 4FZYA 2RHZA 2RKIA 3SD4A 2RI2A 5DMRA 4FJGA 2GV9A 3ZSQA 3C6TA 4O0IA 3CM5A 3RRGA 1ZBUA 4DTXA 4FZZA 2XY5A 1NK6A 1KVBA 4FJMA 4KTQA 5C42A 4AHVA 1RBRA 4Z4CA 4H4OA 1TKZA 1U04A 1X1PA 2KZZA 4BWMA 1JL2A 3CQ8A 3DYAA 4HCBA 4DSJA 3LPUA 2EKOA 2VWJA 1HQUA 3VQ4A 5KRSA 3RR7A 2RJCA 1SL1A 4OJRA 5KI6A 4KI4A 5J1EA 1C1CA 3RRHA 1IO2A 2B6AA 4I2QA 3VQEA 2IS3A 3B6OA 1JXBA 3K5OA 4JS4A 4B9LA 3T3FA 5KE3A 4MQ3A 4Q5WA 4IUVA 1FKOA 4CFCA 3KLFA 1WNSA 3DB4A 3MXJA 4J2BA 4DQQA 3F9KA 3FLGA 3K5LA 4E7HA 1B92A 3EYZA 3PMIA 2OZSA 4KO0A 3U3GA 3PUFA 5DK5A 4GY5A 3AO1A 4Z4IA 1FKPA 2HVIA 5J2PA 2L89A 4CESA 2HHTA 1C0TA 3OYAA 2ZE2A 2FC0A 3M8PA 3AA5X 4DFJA 4AHTA 3P8DA 3QEVA 4DTNA 4W5TA 4IUPA 3ZT3A 4CJQA 4M3XA 4ID1A 3GOXA 3SCXA 4RW9A 1IH7A 3VA3A 4EZ6A 4EDUA 4HCCA 3OS2A 3SV4A 4DLGA 3LP3A 1ZBFA 1JLQA 1REVA 1HYSA 4B9VA 3VQ7A 3MEWA 2EQKA 3O8VA 2PYJA 1H3ZA 4PA1A 3U3YA 2BE2A 4DTOA 5I3UA 3V6DA 4AH9A 3ZSRA 2KW4A 4O5BA 5KE2A 1MHNA 5K14A 2L8DA 2P1JA 2EQUA 2OPSA 1S1UA 4K8ZA 4FW1A 4OGEA 1IG9A 3HPOA 4CJPA 4BDPA 2DFFA 3VQ5A 1SKWA 2WONA 4OPJA 1BHLA 3AO5A 5FDLA 2HQEA 4Y1CA 2P5OA 2NUBA 3VA0A 2WOMA 4DU4A 3VQPA 3V1OA 4FJJA 1SL2A 5KCOA 2OYQA 3PO5A 3ALYA 4M3ZA 1LW0A 3I0SA 2ZD1A 2VG5A 5CZ2A 1KHCA 4LY7A 3TAPA 1J53A 1WN7A 3OYCA 4CF8A 2RHXA 3QO9A 1RDCA 3O4QA 5J2MA 4FJHA 4YFUA 3DRRA 3UIQA 4NZGA 3MEGA 3OYDA 5D6WA 1Q9XA 1LWFA 3DB3A 2HHUA 4FJXA 4CEDA 3MXIA 3HP9A 2HNDA 3LDSA 3KUFA 2DFEA 4DF4A 4CHPA 3DOLA 2G8HA 4X34A 4E1MA 3OYJA 1TL1A 4KFBA 3S9HA 3PO4A 4FU6A 4FJ7A 4AILC 1LWCA 2GFUA 2EQJA 1IKYA 2HMIA 4BE1A 4BD3A 3ZSVA 4CHQA 1IKWA 3KKRA 5HROA 4FJIA 3WNEA 3L42A 2G8WA 5KGXA 3HYFA 1NK5A 3DLBA 4NCGA 3H08A 3IRXA 4CF2A 4B08A 2O4XA 2DIGA 4OGCA 3L2WA 3NF8A 1R0AA 2CKKA 4CJSA 3E9FA 1HNVA 3KLHA 2FBTA 4M3YA 3Q1JA 2G8UA 3KK1A 1BCMA 3DOKA 4QQGA 3QNNA 4QOZB 3OB9A 3HJFA 4PLIA 4CEEA 2HHWA 1L5UA 1TKTA 3CFRA 3QNOA 2PZSA 4FLXA 4FCYA 1NKBA 2R57A 1C1BA 2DAQA 4YNQA 2GF7A 3DI6A 3TAFA 3PV8A 1MU2A 3LLRA 2ETJA 3HVTA 1WJQA 3ZSXA 2BANA 2HNYA 3KKSA 4FL6A 3KLEA 4EP4A 3ZEHA 4FW2A 1S1XA 4XIUA 1I3AA 4OVAA 2AJQA 4HVJA 5CIUA 1S5JA 3QEXA 2EX3A 2LDMA 1TK0A 1RDBA 2YNHA 4Z4EA 1GOCA 3M8RA 4UC4A 3K5NA 2KZMA 5C6SA 4LSNA 4B9NA 3SNNA 4J2EA 3KD1E 4M42A 4II1A 1VSKA 3VN5A 4AHCA 4H4MA 4W5QA 4IKFA 4KHYA 4C8LA 4PL6A 3VQ9A 4KKOA 3MEDA 4N4HA 1XWLA 4C5EA 2K3YA 3MP6A 3PFSA 4UQGA 4JRPA 4CJ5A 4KHQA 4B9WA 1CLQA 3TAMA 1Z26A 4DG1A 3SUOA 4DWIA 4CK2A 5SZTA 1BCOA 1KLMA 3AVNA 4KHWA 2VYTA 4F3TA 3G0ZA 5HRRA 1NK8A 5FROA 3SJJA 3HO1A 3CG7A 5HBMA 4AHSA 4M3TA 3SQ0A 3SQ1A 2E4LA 1QSSA 4FK4A 1VK0A 3LANA 3VQCA 2X74A 1ZBLA 3LWLA 3NDKA 4GW6A 2FBVA 4A4FA 4DTPA 2E6NA 3LZIA 2R5MA 4ZHRA 4CE9A 3LP1A 1DTQA 5M9OA 3KTQA 1J9AA 4F8RA 4IDKA 1RTDA 4CGGA 4CECA 3D0PA 3SUPA 2HVHA 4FLUA 4O0JA 1RBSA 3NFAA 1RBUA 1YTUA 3FC3A 5C25A 4N5SA 4E19A 4DMNA 1GOBA 4W5RA 1C1AA 5I42A 3OMGA 4C8NA 3O4NA 3KK3A 4EP5A 4HTUA 1S6PA 3TAEA 2RN2A 3QLHA 2G3RA 4M3UA 4PWDA 1VSJA 1RBTA 1BIZA 2X35A 4N4IA 5T7BA 3OQ5A 4FJ8A 4QCLA 3MO8A 2OA8A 3LWMA 4CFBA 2BUDA 3OJSA 2HNZA 4E7IA 3V9WA 1BISA 3PX6A 3K2PA 4CIFA 4DSFA 3SV3A 2JLEA 4DQRA 3K5MA 4CEOA 2LCCA 3LH0A 3FEOA 2A1RA 1KSPA 2BDPA 2DY4A 3ISNC 4O44A 3S6WA 4EZ9A 2X4WA 4CHYA 1TKXA 3SQ2A 3QJ6A 1N6QA 1ZBIA 1F21A 2KFNA 3NBPA 4CGHA 3NH2A 4CCHA 3TARA 1Y97A 3HM9A 1JXEA 4CIEA 1NOYA 4BE0A 3E9GA 3KIOA 3H8ZA 4CJVA 4A4HA 1KVAA 3DLEA 2BIVA 4BDYA 4Z02A 1RT5A 4CGDA 4KREA 4LH5A 1RDDA 1WAFA 3K58A 4A4GA 2O4GA 1NK0A 1WSJA 3SUQA 2IAJA 2YHBA 4FXDA 3CFPA 3SYZA 2NLUA 1SL0A 1VSDA 4Q5VA 4KHNA 3NGYA 2X6SA 2KFZA 1BI4B 1C6VA 2EHGA 2B8AA 5E41A 5IAYA 4I7FA 2RHYA 1IKXA 4DQIA 4JRQA 3TANA 1WJSA 4FLZA 3WNFA 2MWPA 2ATQA 2YKNA 4GVMA 3AO4A 5HLFA 4F4KA 2P51A 1UAXA 1KVCA 2RI5A 3QIOA 2YRVA 4IFYA 4CJKA 3IAYA 3ME9A 2Z1GA 4Z4HA 3AVKA 3CM6A 2Y1JA 1C0UA 3V4IA 4TSXA 3TR8A 1HYZA 1UA1A 3NTIA 4IFVA 5C0MA 4BWJA 1VRTA 3H6ZA 2F5KA 3JYTA 4CF1A 1U49A 1LV5A 3RMAA 3TABA 3OS0A 3AVHA 1O1WA 4CFDA 4KHSA 3MEEA 1RDAA 3C94A 3RMBA 4E7JA 1RT3A 1T8EA 4ZTFA 1S1TA 3TAQA 4NCAA 3LP0A 4DSKA 2RJFA 4CK3A 3NHGA 4C5GA 2YHAA 1CZBA 3NAEA 4I9QA 4L59A 3QIIA 2M0OA 4N56A 4DFPA 1A5XA 1KFSA 3DRSA 4FJKA 1I39A 1WLJA 1L3SA 2QQRA 5KH6A 4CEBA 3MP1A 3G10A 2HHVA 3MEAA 3V81A 4HUFA 1SKRA 3NTHA 1J5OA 4CJWA 3AVAA 1Q9YA 4DU3A 1L3UA 2DTUA 2YNGA 2D5RA 4AHUA 1WSHA 4N47A 3IG1A 3ZT4A 1X9SA 4OLBA 3RTVA 3OYGA 4BE2A 3I8DA 3MXMA 2XY6A 3OYHA 2IG0A 1XI1A 2YV0X 1EXQA 3S3NA 1RT4A 3RMDA 3DRPA 2X4YA 3C4SA 1XNIA 4E7LA 4ELTA 5HP1A 3L3VA 3RWUA 1XHZA 3M8QA 3KK2A 4FYDA 2E6MA 4E7KA 3V1QA 3EAEA 4W5OA 4ID5A 1T03A 2B4JA 2GFAA 1KRPA 1BGXT 2M16A 1RI0A 3OYIA 4CJLA 4PUOA 5FRMA 2FHDA 2G8IA 2O4IA 1EX4A 3V9XA 2D0BA 1VSMA 2QKBA 4E0DA 3V9UA 4FVMA 4DLEA 4FZXC 4B9MA 4OVLA 4CHOA 2G8KA 3B6PA 4QVZA 3V9ZA 3DLHA 4DQSA 4FK2A 3QIPA 1JLGA 3LGLA 4IBNA 4WE1A 4IUUA 4FJ5A 1WSIA 4DTSA 4MFBA 1VSIA 2D9TA 4CF9A 1ZYQA 1D9FA 5D6XA 1D8YA 3UT1A 4KV8A 3HPGA 1LWEA 4KPYA 2VG7A 4KB0A 3ASMA 2X4XA 3AVCA 3HXMA 2FBYA 4CJEA 1QE1A 3P5JA 3M8SA 1QTMA 4F3OA 2LRQA 3AVIA 3LYIA 2Z1IA 3QETA 2I5JA 1TK5A 3DLRA 2FBXA 3QINA 1SUQA 1HMVA 1HQEA 3OYMA 2YNFA 1BQNA 1W9HA 4CEFA 4DFKA 2XRIA 2P5GA 2IOCA 4FJLA 4IURA 1RTHA 2PQWA 4CEQA 4CJ3A 2RF2A 1S6QA 1U45A 1NJWA 2XY8A 3OA6A 4CJUA 5FRNA 2DFHA 2PYLA 4Z0UA 4FJNA 1B9FA 4R5PA 5JS1A 2Y1IA 3S3OA 3HSTB 4B9TA 5KTQA 2G8VA 2JZ2A 3M9QA 3RR8A 3VQDA 3LGFA 2YNIA 2G8FA 4CERA 3QEIA 1G5VA 4PQUA 4CJFA 2E5QA 4LD6A 3DM2A 4DFMA 5CYQA 1RT7A 1HYVA 1SV5A 2RJDA 4C5IA 1NKCA 1ZBHA 3FFIA 3O3FA 1RNHA 1QQCA 1HPZA 4F2SA 3OYBA 3ASKA 1C0MA 4B3OA 4ICLA 3OJUA 3DLMA 3QESA 2BGGA 4DSEA 3QERA 4DTJA 3ULDA 4KRFA 3AA4A 4NYFA 4E1NA 4OKKA 1JLAA 2K3XA 1JLBA 4FM1A 2IDOA 1LAWA 1XC9A
chains in the Genus database with same CATH superfamily
3F6OA 3P9CA 3T19A 3RPUD 5SWMA 2UWMA 1WH5A 2XAJA 3H1VX 4RW6A 4M77A 3CJ1A 1CXUA 4LF9K 4EJZA 4K11A 5AQXA 2KDZA 3H92A 2RHUA 4KB1A 1K8KA 5GIOA 1WSUA 1GLDG 3KETA 1I5LA 3LWIA 3E5XA 3J80K 5BRHA 2ECZA 5LJ3e 3I5UA 1VQ6Q 1FYLA 3S8PA 3HOTA 2COWA 4Y28E 4DU1A 3BQYA 1DTTA 2MPXC 4EVVA 4XICA 4KUDK 4JP0A 4K43A 1VQOA 1RT1A 5DM7L 3FDRA 1RAHB 3AG4H 3M53A 2VJIA 1AVZC 3OL3A 2XHIA 2OPQA 3QDKA 3DLKA 2EK5A 4ZDLA 2EJ9A 2AZSA 2RNAA 3HL8A 1KFZA 1T3LA 3GTJJ 2WACA 5LJ5j 1KXPA 3D6RA 5AYFA 4XRSA 4BRGA 3PVQA 2XAFA 3HT3A 4JLHA 1Y39A 4DTUA 1U6GA 1GL5A 2COMA 1JRIA 4BC4A 1OI1A 1M2VA 2R0QC 3ERMA 4FISA 1WDXA 1NJYA 2EWNA 1NGIA 1IGQA 4IG3A 4ELVA 2BVMA 1LDDA 1XCVA 3K57A 2DA6A 4DYQA 1TBXA 4I6ZA 4MMKA 5AQPA 2KZVA 3WE2A 3CCST 4M7AC 1NJZA 3BDLA 1KQ2A 3I3LA 1BWFO 2HDDA 4PGGA 4NLCA 1RKTA 3CI5A 2R7QA 4M7AG 3TW6A 1XTDA 3VF4A 2JT4A 5EY4A 3TGNA 4DTMA 1YQAA 2VXZA 3P7NA 1J54A 2LKPA 4HHTA 2A0FB 2LOOA 3CCVN 5F0FA 2FF6A 3LL7A 4B9QA 4OIOF 5IT9Z 3E1SA 4HVWA 4UB8C 3BJ6A 4JAXA 3HP6A 3X2QH 5JVGF 1BIBA 2E5KA 1JI8A 1Q86C 4RMOA 1YTYA 4CDGA 1G15A 4M45A 2WADA 3QEPA 4RLQA 4B9UA 3S6IA 1NJIR 1W7AA 3GTLJ 2Y75A 1L3TA 2XKOA 5J39A 3QWLA 4GMJB 2Q0UA 3ZN0A 1EF4A 3KEOA 3J7AO 4MO5A 3VF2A 1T05A 1Q95G 1KCFA 2PAVA 2VJ4A 2JUFA 1BL0A 3TW7A 3VYUB 3LDOA 2W25A 3SPZA 2C6YA 1R22A 3SYTA 4M7DE 1R1TA 2A40A 3NMZC 2JW4A 3I4MJ 3E3VA 3C2BA 1UJ8A 1K61A 1VRLA 5K5OA 1AA7A 4NL3A 3E01A 3BWGA 3LWFA 2DZ9A 2XDBA 4LFBK 2HAXA 1B9DA 4G1QA 3D2EA 5BPNA 5GAOq 3RKYA 4OMMA 2K5IA 2YHXA 4NBQA 2PMZA 2NNWA 5KCHA 4E89A 2H8HA 4B6MA 3G71I 1ZGJA 2DBBA 2ZGYA 1WJAA 2ISYA 2V6EA 1DLOA 3FSPA 3E5QA 1NK9A 3G6EN 4YRVA 5EGOB 1T0JA 4HWIA 3FMQA 3X20B 2F5DA 4XLNF 4AC0A 3VYGA 3C0BA 3H9NA 3HKZN 1BOAA 3ZBDA 1HNIA 1YP5A 5LHGA 1UG2A 3QFPA 3MECA 5K5RA 4M3EA 4U7BA 3CEYA 4N4GA 5D7UA 4CK1A 1OCCH 2QWMA 2O8BA 2DK3A 5IP7J 2Y30A 4Y92A 2HCKA 1NKEA 3FIWA 1XGNA 1VQLQ 1S22A 4UB6C 1H0MA 2ZJPL 1OX8A 4CHZA 4L9VA 2DOEA 3WTSC 2UZKA 4OFAA 2HEOA 1D3BA 1T38A 2ZPIB 1XD7A 5DYMA 4LLNA 1WHLA 3EL2A 3F73A 4Y15A 3A2FA 2FNAA 2NS7A 2F8SA 2ZMEC 4KTZA 1MZBA 1SVMA 3HEFA 2YPRA 3I35A 1D8KA 3WU2C 4C5HA 3KJVA 1JU5C 5CY4A 1ZSGA 4E1JA 4IX7A 3KP2A 3RNJA 1S9GA 1ZLJA 2D0AA 3SZ2A 2O8EB 3JCUC 2E88A 2E4HA 3CCLA 1N3CA 2E2PA 2HQXA 3WG7H 3DMJA 4CZZA 4M75F 3NH0A 5J1YA 2O61A 4A3JJ 3TI0A 3RDVA 2JRTA 4CBXA 1YXQA 1O3TA 4X65K 4FT4A 5E8IA 1AZEA 2X3WD 3SFZA 1BJZA 3DBHB 4HBLA 4LD0A 2BZ8A 4M41A 1VQMQ 1N27A 1JHFA 2EILH 2IS2A 2QXFA 4XKCA 1IHVA 2L3RA 3M55A 2P9IA 2H27A 3L4IA 1GVJA 3O8GA 3KLIA 1X27A 2EIKH 2W00A 4FQGA 4BNCA 3FX3A 2E10A 1YJ9T 3PX4A 1ASVA 5CKDA 1W0HA 3G1OA 5CVUA 1PP8F 1LOJA 4IUTA 4XK4A 2FB7A 5AQZA 1WSEA 4PJOB 1BJAA 1IHWA 4CEZA 5ADXA 2VC1A 5JR3A 1IKVA 2P9LB 3WTZA 5D5VB 1GOAA 2DA3A 2O8FA 3V1RA 5ICGA 3S1MJ 5KYXA 3BT9A 3I55T 1QHTA 1YITQ 1C0GA 4YFKF 1QSLA 2K3BA 3ZN1A 7AT1B 3OYFA 1MW7A 1BOBA 3PNTA 1ZXOA 3FHGA 3AL0C 2K7AA 2L9VA 1UTIA 5ILUA 1EV7A 1YUWA 1RT6A 1M9SA 2YU9J 2GAUA 1XN7A 2KRSA 2ZMEA 2P9KB 5IPAA 5C15A 4NUBA 1DPUA 2ASPA 3M58A 1ZHIA 3DTKA 1RT2A 5FPDA 1RFQA 2DL4A 3WEEA 4PJ0C 3SEQA 4B8CA 1BI3A 2KEAA 1VQ8A 3CCET 4JI8K 1VQ6I 4B8AB 3HGGA 3S2WA 2V51B 1V5FA 2NUTA 1Y71A 1ZARA 1K73R 1ACMB 5JS2A 2W42A 1YHQI 4L8RB 1NG6A 2DXCA 2WSCE 1TZLA 1IB8A 3FK7A 2QQBA 1FXXA 3LPTA 2CGHA 2RI3A 3DLGA 3PVLA 1IREB 2NUPA 5DEQA 4DS4A 4V2SA 1WWXA 4OPAA 4H8KA 2FL7A 2HTSA 1KFDA 4JD2A 4CFAA 2E6LA 2EV5A 1SF9A 4LJZF 4M75D 2V8KA 1N3AA 5FD6A 2IGIA 2M1HA 4E70A 1X6GA 2PJRA 1JKQC 4HV5A 2FRHA 4RW4A 3OBWA 3SHFA 2K79A 4JI2K 1U47A 1YIOA 4YOYA 3L2VA 1TGOA 4YEJA 2XU8A 4FYWB 3LFKA 1SFKA 1R00A 3KP4A 1P7JA 1JXOA 2D6FA 2M30A 5J2NA 1ZN2A 3ID6A 2Q97A 3L2UA 3LSPA 1RRSA 1XQOA 4M6VA 2QCOA 3SD4A 1TWHJ 3QYEA 1OYWA 2W7NA 2J05A 4KT5C 5GAN8 4RCHA 3CXCM 4L6V5 2L01A 5GAMh 3WTYC 3CM5A 3CCQN 3EFRA 4NHJA 4JJCA 2HBMA 2JZYA 3CC7T 4FJMA 3BY5A 1OV3A 2XF5A 4BY1J 4B21A 1IC8A 3CMEA 5ICFA 3Q0VA 4AU7A 5E3OA 4Z4CA 2P4WA 3ERED 4IZZA 2A5XA 3VENA 1QVGP 1ZA1B 4H4OA 3QUIA 2M9UA 4AI5A 3JTGA 1RUNA 4HVVA 3ASNH 4BWMA 3THKA 4KGVB 4KYWA 2KR3A 4HCBA 2EKOA 5I11A 3VQ4A 3CCSQ 1QPMA 1ZAOA 1KU9A 4CZCA 3RR7A 2RJCA 1DEJA 2D1KA 5HNFA 3CF5L 4U0YA 3BG5A 5LJ5g 5J1EA 1GV5A 1XG7A 1IO2A 4B22A 3W2AA 4B3SK 2GQIA 4I2QA 2IS3A 4B1RA 2BY0A 3DLLA 1Q82C 1OX9A 4B9LA 3T3FA 2HYFA 5JLFA 3EN9A 3VWBA 4CFCA 3CMAA 3A03A 5AQHA 3KLFA 5HY6A 1JB0E 3BTCA 4QPQA 2GWKA 3CW7A 4NC7A 1ETVA 2OZSA 2Z99A 3J7ZI 2XF6A 1KG3A 2CT3A 4BHCA 1K76A 1FKPA 1QP2A 4O6JA 1NLVA 2ME0A 1W2BA 2L89A 4M78C 4KH6A 3OYAA 2RDPA 1KC8R 4AF1A 4P96A 3BG9A 1ATSA 2B9SA 3K1PA 3AA5X 2GLOA 2Y0MA 2ENMA 4M78G 1MMDA 3UNGC 3OA9A 1YBYA 2OJ2A 3OSFA 4G9ZA 3VS2A 1HYOA 4ID1A 3GOXA 3SCXA 2K3PA 4M3XA 1IH7A 2JSPA 3A02A 4C92G 2E7WA 1KZHA 3BTLA 4BS9A 4EDUA 4QT7A 4HCCA 4DLGA 1OCOH 3PIOF 3CC2N 1Q82O 5CE3A 5AQLA 2EQKA 2B7EA 2ETHA 3IP4B 3HB9A 4OB2B 1H3ZA 4B3TK 5GAOl 2WC9A 1PYVA 1IN6A 2BE2A 1NEBA 1YIJT 4DTOA 2BE9B 5I3UA 2QEXQ 4I6MA 1X1CA 2OZUA 3ZSRA 1X69A 2KW4A 3H0GJ 5KE2A 1FTZA 1MHNA 4MEYF 2EV0A 3I56Q 3UKUB 4K8ZA 1U5SA 1SKWA 2ZPFB 1WUAA 1YI2T 3CD6T 3QWYA 4OPJA 5FLXE 1ARKA 2HQEA 1K79A 1KEAA 1KSWA 4DR6K 2NUBA 2DXTA 2IBDA 5DM6L 4U0VA 2WOMA 4M63C 1VHXA 2VJJA 4F93B 1VYTA 3H0FA 1RAGB 2BHZA 3RCOA 1TWCJ 1X6OA 2VIXA 3BOQA 3N0UA 5EGOA 5KCOA 2PFBA 4RAYA 4DK9A 4M3ZA 5LBQA 1WRJA 1QZ6A 3I0SA 4CYDA 3GTGJ 2R7OA 3DJCA 3INZA 3FZLA 2XC7A 4BL0B 4MGRA 1OH7A 3ELKA 1P92A 4E6KG 2ZM6K 1UGSB 2X0LA 1KHCA 3A0HC 3TP3A 2DMTA 1KONA 3FISA 3S1RJ 3CESA 1F5TA 2NOFA 1OULA 4IXCA 1Q7YO 4KULA 3QPLA 4KJZA 4DBRA 1JTXA 2IIRA 1WGXA 2GCXA 2XKPA 1I1GA 2QWQA 1Z91A 4YFUA 3DRRA 3UIQA 3QRFF 3UA6A 2OTLT 4XSZF 1Z05A 3OYDA 1ZG3A 1VQ7A 2WB1N 3DB3A 2HHUA 1YITI 4CEDA 3MXIA 3HP9A 1JUMA 3HTVA 1QNTA 3VS3A 3BPVA 1A6IA 5BREA 4DF4A 4DV0K 2FYKA 4CHPA 1J3TA 2I2LA 2E36A 2L3SA 3S9HA 4FJ7A 2VKDA 4HF1A 1LWCA 4KUMA 2O8EA 2WAQN 2EQJA 4AG2C 3FKJA 1EH7A 2ZGZA 4BE1A 1RRQA 1GLEG 5E3MA 2QKLB 4LLGF 1IKWA 3TSPA 2KDSA 4ASNA 4OMLA 5EEHA 4FJIA 3I5SA 4D6WA 1YJ9Q 1TXQA 3CCMT 2P4TA 4HPQA 2ATCB 5KGXA 4IF4A 2KDOA 3HDDA 4PZJA 4RDUA 2PUOB 3HTRA 3CWSA 3KZIC 4M7DB 3I55Q 3M8JA 3ZLJA 2DNUA 4CJSA 1X3WB 1NU0A 4B09A 1HNVA 5CO7A 3ABUA 4BJ5C 2FBTA 1YJWT 1WEFA 3KK1A 2XICA 1KYWA 4PJOA 5CVVA 5K7ZA 2NRZA 4QOZB 4PLIA 5HL7L 1V54H 1KYZA 2P9LA 3E97A 3N97A 3F0CA 2W4SA 3V8LA 3OR2C 4FCYA 1VQOT 1R7JA 2EQIA 4S04A 4OMYA 2R57A 4EVIA 2DAQA 3CCEQ 2LSOA 2A3SA 4OB3B 3Q9VA 1AHJB 2LFBA 2EFQA 3ZQGA 3JCMV 1XUPO 5D8KB 4JKEA 2ZJQL 4LDVA 2IVMA 1WJQA 3ZL7C 1U9OA 2BANA 2AHJB 2P9KA 2K2MA 3I9V2 1NGFA 1GFDA 2JMCA 1GLLO 2QTDA 2VUMJ 5C4JJ 3GTKJ 5CIUA 1PWTA 2EX3A 2LDMA 3O5BA 3T1HK 4Z4EA 3HBLA 4HOBA 3DKWA 1GOCA 2ZJRL 2HKOA 3U1DA 2JHJA 4J6YA 3KFVA 3M8FA 1N6AA 4C30A 3SXYA 1LWWA 3H9GA 5LJ5d 5GAHP 4WQ4C 4BXUA 1VYVA 2ID6A 3M3ZA 3KD1E 2RD1A 4ZGDB 4JK9A 3P38A 4AHCA 2O8XA 4ZH4F 1RKWA 4IKFA 4A5NA 2CP7A 4GCVA 4EM1A 1K78B 5F0CA 5BS6A 3R8EA 3MKZA 4N4HA 1TWBA 2L4MA 4BRIA 4JRPA 1Q81U 3CCSI 4B9WA 1CLQA 1Z26A 4IEIA 4DG1A 2FQ3A 2VI6A 3IRQA 3H1QA 3O80A 1PU6A 2XIGA 1W36C 3J80O 3N4MA 4F3TA 4Y7NJ 4KFCA 3HRGA 3UA7A 1W0UA 4RTWA 1FOKA 3QBWA 3CG7A 1XMQK 5LRRA 1QMCA 2FZCB 2A42A 3CC7Q 2ASMA 3SQ1A 1YWOA 2E4LA 2DVEA 2HQNA 2A28A 2V4JC 2CW0F 3LANA 4M71A 3GZNB 2GBQA 2DPUA 3JCMJ 5K5QA 2JG6A 1F1ZA 2EV6A 1ZBLA 4QVCA 3G4SA 3LWLA 3RMSA 1KG2A 3HGYA 3DU5A 1TNTA 1FOYA 1WJCA 2GA2A 5FWCA 3DXJF 2XRNA 1AWJA 5E1XA 3LP1A 1XDUA 2I5WA 3KTQA 2GUPA 5LJ5f 1J9AA 2JM8A 3KYDB 2VE9A 3IV5A 4F8RA 4CZJA 1VQKN 2CH4W 1W4SA 3CCUA 1RTDA 4CGGA 3TCJA 4CECA 3SUPA 1ZUYA 1YQLA 1LVAA 3IL2A 5B8HA 4WQ4A 1RBSA 1R5ID 2XRLA 1LWVA 3NFAA 3F8MA 1G4DA 4ELYC 1M1GA 4KIBA 4LIUA 1BI1A 2OQRA 2CUDA 4XL9A 2G6FX 1X3ZB 2CFXA 3EH1A 2FOKA 3K1NA 3DXMA 3OMGA 4EM0B 4C8NA 1W70A 2RNGA 2Y48A 4EP5A 2LF8A 2EJGA 3BJAA 2GX9A 4EJWA 4J9GA 3JR9A 2QEXI 3TO9A 1ZGAA 4F3QA 3OQ5A 2M0YA 1HCRA 5GAEJ 3MO8A 2OA8A 2R7XA 3LWMA 4LG0B 3I56I 3ZQHA 4HCKA 4ENJA 4CC3A 4JV5K 2HNIA 2ZO4A 4GXOA 1M90C 2LLKA 4CIFA 1BA0A 3SV3A 1ORNA 5GANj 1M1KC 1EJ9A 5F27A 1NGCA 4Y4RA 3MK6A 4YPHA 1MWMA 3LH0A 1AWCA 1X1AA 5LHIA 3FEOA 2OJED 4XTUA 2QWNA 2JM9A 1WQ2A 1I50J 4JI0K 2FF3B 3S93A 2MF2A 4AVPA 1BR1A 3KEQA 3ISNC 2QGUA 3AGRA 4I7HA 2KNBB 3SQ2A 1K8AU 2QDLA 1HF0A 3MWTA 4YOUA 3GP8A 2DMPA 1F21A 3NH2A 2QLZA 4GYIA 5CLSA 2EAYA 2LF7A 2XGDA 2A41A 4EPCA 1JJ2S 4KA4A 2E2IJ 4IWVA 4BXXJ 1LCUA 4BE0A 4DR1K 1KG4A 3NAUA 3CLOA 4ELZC 3THXB 1PHTA 2AKKA 1TNSA 2WFBA 2LH9A 4MTEA 3CCLT 1KVAA 1VQ9Q 3CD6Q 1TTHB 4BDYA 4A3BJ 2QWWA 1RT5A 2EFOA 2HXIA 3QXEB 1R4MB 5KAFC 1RDDA 2O4GA 1FTTA 5KYUB 3FXMA 1VQNA 1HKQA 4KUIA 2Z33A 5GJVB 4KICA 4Y52J 3CMYA 4RUGA 3UKUA 4PFZA 2NLUA 3SYZA 4VUBA 3CCJA 4WXCA 5JMVA 3SB2A 2X6SA 4ISGA 2I7PA 4QS9A 2KFZA 4BRMA 3U23A 4IHVA 4C2MJ 4EMSA 1C6VA 3MN6A 1W2BP 5BR9A 2ROLA 2E2QA 5E41A 4JK1X 5IOYA 4NQWB 3BF1A 3D4VA 3EFOB 2PX9A 3TANA 1WJSA 2K9MA 2MWPA 4MO4A 3WNFA 2ATQA 3CHWA 3TL4X 3Q7BA 4BRLA 3AO4A 2P51A 1UAXA 2NZTA 5LFAA 2LTPA 5GAGJ 1E7OA 2EYZA 4ILGB 3MHXA 2RI5A 3QIOA 1I27A 2YRVA 4IFYA 4B1UB 3BLYA 1IXRC 5GAN2 4GVEA 3EGUA 1WH7A 1Z7UA 3PSFA 3V8KA 1R59O 2JNGA 2D1XA 4TSXA 3ABMH 3I55I 1XQPA 4JI1K 3VSKA 3MN2A 1IN8A 1FYMA 5A2QK 3FZVA 1DT9A 2PFUA 3RZOJ 3H6ZA 4LK1F 2LC4A 1U49A 4OIRF 1VQ8T 3RMAA 3OW2P 3C94A 3FZMA 3JCMd 4E7JA 1RT3A 1T8EA 4ZTFA 3LP0A 2J5OA 3CCMQ 2F2EA 3JCMW 1CZBA 2AS5F 1GRIA 3HSRA 1H641 1EH8A 1O9SA 4DQ8A 3CCVT 1DU6A 1I39A 2UUBK 3IRRA 1YJWQ 2HHVA 1SKRA 2DQRA 1VQLN 2QSFX 4CJWA 1BO5O 1L3UA 1SANA 3U9DA 1K0SA 4AHUA 3IG1A 4M7DA 4OLBA 1NM1A 4Y33A 1VQOQ 2RHKA 4M78F 3I8DA 2HXOA 1QQJA 5KAIC 5E3LA 4MMLA 3OYHA 2IG0A 2F5VA 1EA3A 3O6WA 4C92F 1TQPA 2X4YA 4A59A 1MNEA 4ELTA 2EWSA 1FWZA 1RAFB 1QRYA 4EIAA 4JI3K 3DBRB 5IXFA 2CP2A 5J4YA 5JLWA 2A5WA 1QPIA 4E7KA 4W5OA 2CYYA 2E19A 2RC4A 1T03A 3JCMf 2X6WA 3CQXA 1DQUA 2ZKZA 2LRDA 2X6YA 1BU1A 3CC4N 4I98B 1X6BA 3LOCA 1YQRA 2K3FA 2MYSA 4RM3A 1KRPA 4U67L 2M16A 1Z9CA 1RI0A 1DJ7B 4CJLA 1VQMN 2M9HA 1CGPA 2HSEB 4PUOA 3AKZA 5J8FA 2FUG2 4CZIA 4RM2A 1UDLA 2FHDA 2DOFA 2K5LA 4MDWA 2D0BA 3C65A 2MAMA 5IP6A 5L3CA 3V9UA 4FVMA 1YN8A 3I4PA 3UR3C 2O8CB 4DLEA 2KPMA 4AVZA 3R4KA 4AYBA 1KAYA 4DQSA 4FK2A 3G6ET 4BG8A 4J8OA 5D6EA 2RN8A 1GXIE 1C0WA 4WE1A 2VASA 1WSIA 6PAXA 2FSWA 3URGA 2CGPA 3A2KA 3DEWA 2D9TA 1S72N 2DFIA 1ZYQA 1KA8A 3K2AA 4N9IA 1PU8A 2EGAA 3FXOA 4P5NA 1Y7XA 3D2FB 2TDXA 2QW9A 1U5TB 1PG5B 2LVSA 1K78A 4IVNA 1H88C 3KWIA 2C0IA 1E4FT 2X4XA 1LNXA 4F16A 2G0EA 1Y0UA 5A0DA 2F9WA 1DGKN 1QE1A 4WFAL 4AFSC 3M1EA 1HSJA 3HTUA 2RQQA 1MJAA 2LY2A 2DD5A 5GPAA 3QETA 3QU6A 1QVFP 4F92B 1TK5A 4CCLA 2D8JA 2O88A 2DK8A 4J9BA 1HW1A 3O1WA 4BY6B 3KP6A 4C92D 2C0TA 2HPMA 3HOZJ 4FWMA 2BV6A 4UXNA 1MMAA 3E19A 4PFPA 4FJLA 3BG3A 3K70D 1B7TA 3KNTA 2H3GX 5FKOA 2BH1A 1VIEA 4ZN3A 2XHKA 3CJRB 2X48A 5J1UA 1EO1A 3NFCA 5FRNA 1UJYA 1HW5A 4B3MK 3KX2A 5E1ZB 4JI4K 2BYVE 3M9QA 2K02A 2QQ9A 3I33A 1SHFA 2YLBA 2NYXA 2WSEE 3LGFA 3TSWA 2YNIA 4DR7K 4M77E 3GW2A 1T95A 3MZYA 1OVYA 4IO9F 1B72B 3SDZA 5BN8A 3QU3A 1RT7A 2CU7A 1HYVA 3ENHA 2RJDA 1B8IB 3RKXA 1EH6A 1NKCA 1ZBHA 3ECHA 1Y0MA 1WPKA 4OMQA 2NOGA 1OPLA 5BRFA 1C0MA 3ASKA 3FXLA 4XU3A 3P9KA 4ICLA 3OJUA 4WYBA 3DLMA 3QESA 3OBYA 3S2DJ 2MW8A 1VQ9I 3CD6I 1UGPB 5I21A 4GV6A 2DTRA 3LAPA 4ESFA 9ATCB 3GFMA 1JKPC 2PMHA 4HNTA 4NB4A 2A5YB 4H0PA 3DBLB 3EHQA 1S9HA 4A5BA 1P7MA 4IIMA 3CBPA 4LG0A 1R6RA 1R77A 3S32A 2YKMA 2JK3A 4C0GA 1Q18A 1N8RR 1RCHA 4E47A 3J8AA 2LKSA 4LK0F 3CP2A 5JVGL 1LJOA 1Q81R 1D1AA 2R5AA 1QS4A 5BPDA 3FMSA 2VE8A 3VQBA 3UE5A 2OZMA 2FA5A 4Z4FA 3DEUA 3MP8A 1ODDA 3AVLA 2IVNA 2PUKB 1GCQA 1IXDA 4CCMA 4GV9A 4F55A 5GANg 4KGXB 2DYRH 1ZR2A 1FMVA 1UA0A 5M1KA 3C7JA 1I07A 3ID8A 1AWWA 3T69A 4UOBA 3E1YA 2XHCA 2LY1A 3CP8A 2VC8A 4OF1A 3I0RA 2K27A 1JLEA 1D9DA 3FGUA 5FLXZ 1KJWA 3WTVC 1UHMA 4M3BA 1IJJA 2XUBA 3AARA 1Z1DA 3THXA 1NK4A 3E5UA 4EHUA 2EFNA 2X4HA 1KD1R 3GXOA 4E9FA 1XGOA 3SEMA 1KTQA 3KD5E 3IH2A 2F5CA 4F2RA 3OVNA 5KYUA 3PY8A 2VYPA 3CLQA 4CGJA 1QWFA 2E12A 3X25B 3CCMI 1S5LC 4KI6A 3CFOA 1O3SA 1NGDA 4EV0A 3AVFA 1W5TA 4L0ZB 5CHZA 4BJ6C 1YG2A 2UUCK 1HC8A 1R0CB 2AT1B 1IBKK 1ETXA 2P9NB 3PMTA 1VSFA 4XLFA 1LPQA 3LSTA 4NQWA 4B1YB 1NJIC 3ZGKA 3LAKA 5DCMB 1VQ4A 5B1BH 3FZHA 2HOAA 1WQ7A 3EFOA 2WC2A 2AK5A 3N5NX 3OV8A 3CBOA 4QS8A 4XK8E 4J6WA 4B9XA 1JBMA 5BR8K 1XOVA 2NVXJ 2L54A 1YJWI 2GELA 5CKEA 4C3HJ 2QYOA 2FG0A 1VQ8Q 4NXNK 2OPPA 3A8LB 1VFCA 3CWAA 1FC3A 4C3IJ 3CF2A 2MMPA 2EH3A 1TKDA 4AM6A 4V19K 4OMFB 2NRTA 4H03B 3UDCA 3VQAA 2VC0A 1OYYA 2KRHA 1Y1VJ 3R2XC 4M7AE 3C2GA 5L3BA 2BTTA 4WFBL 4F04B 2R92J 1S8NA 4RWTA 3OWTA 2M3AA 1WCMJ 2Q36A 4RG2A 3CCVQ 5HNHA 1ZX6A 2QKMB 3VQQA 4R79A 1S1VA 1KQJA 4XKBA 1H92A 2R5ZB 3VGMA 1SRLA 2X6NA 1Z0XA 3ZMSA 5E84A 3LAMA 2DMQA 1K8AR 4BQQA 4A93J 1L3VA 4IHTA 2G7UA 1BC7C 2IVWA 3NRVA 3VU3C 3E6BA 2RVCA 2QG9B 2OI3A 2Y0SA 4JX5A 2RK2A 3UKRB 1NLPC 3ATUA 1BIUA 4IQ4A 3EUHC 1YT3A 3MAQA 1WYXA 4W5NA 1MDMB 1QQNA 2QQ8A 3QYFA 2XY7A 1G83A 3D5SC 1SMTA 1RUWA 3U4LA 1D5AA 3L4QA 2CW8A 2DL7A 1W36D 4PLLA 2P8TA 2YG8A 2F9TA 1X1BA 4R1HA 2ZWHA 1P4XA 1QKXA 1UOCA 1JKHA 4I9LA 5DD8A 3GL1A 2OTJA 3WTWC 3CCRA 3OYNA 4QQDA 3LDNA 1ZKGA 4K2EA 2QWLA 1T08B 1P59A 2DRMA 4I2PA 1BR4A 2HHSA 3QICA 4K0KK 4A62A 1WX6A 4PY5A 3META 1BI2A 1RUOA 1EP4A 4JBAA 2HW3A 2JXBA 2LX9A 1NK7A 5CR2A 4CEAA 1YJ9N 3LSGA 1U4BA 2LY9A 2Q8KA 3SQNA 3J7YJ 1OYXA 4KH4A 3OS5A 3G6EQ 3HBTA 4U0WA 2HEQA 5DS9A 1U78A 5ICCA 5LJWA 3CCUT 5M1QA 4M9ZA 1RLPC 2D4WA 4YTLA 3HI0A 1M4ZA 4FM4B 4ZNXA 4IFEA 1HNXK 3FM3A 1TW3A 2O8CA 1HSTA 4Y17A 3E9PA 2KZGA 4PK4A 4F14A 1G3TA 1SFEA 1I5OB 1KHIA 5AQWA 1W6XA 1A5VA 3AV9A 4DQPA 2IVOA 3EUHA 1WIEA 2GTJA 4E6RA 2IW5A 4E9HA 4PSWA 2PNIA 2XO7A 5K7FA 3MN5A 3CCEN 4J5YA 4IDHA 1R36A 1PD0A 4WF2A 1KQ0A 3D2FA 3NPFA 3IS9A 2KFDA 1U5TA 3UWNA 4ZYAA 3ZT2A 2HHXA 5B66C 3GTMJ 2DVJA 4EW0A 2WY7Q 4H4KC 1Z7LA 2KYMA 3NF9A 1IRZA 4PKGA 2FEZA 1P9QC 2GTOA 3NF6A 2JA8J 4JJBA 2DYBA 2JUGA 3PX0A 4ELUA 4V2FA 2P0WA 1U84A 1BUPA 5FU6B 4J7IA 5CHIA 1TUYA 1K73C 3VEZA 4DUYK 3JSMA 4D9JA 3OYKA 2DA7A 3HOXJ 2LBFA 3ZSZA 3THYB 3K4JA 4BI3A 1NK2P 1YJNN 2VG6A 4C0FA 1QSYA 1RLQC 5GANd 3U9GA 3AA3A 4BY9C 4XOPA 2LTOA 1NZ9A 1WEIA 4PL7A 3SAFA 2IGKA 1SHGA 1LFBA 2QKKA 5BPMA 3QBXA 2CO5A 5CQYA 1TT5B 4M9XA 3IKMA 1E3OC 2FJ1A 4IEJA 3NE6A 1YX3A 1VSEA 4YOVA 3L2RA 5D4RA 2D0NA 3RQ4A 3MEXA 1IRFA 4L18B 1B72A 5CCAA 3EUAA 1B8IA 2M0CA 3SFMA 3KYLA 4F9OA 1LCKA 1YWPA 3FFKB 3AVGA 3D45A 3CC7N 4DV2K 1ZRFA 1PKSA 4KHUA 3V7RA 3C0CA 4LF5K 3NVKA 1WJBA 4JK8A 2D8HA 3K59A 2EFIA 1OR7C 3CC2A 5HRPA 2M7BA 1RTJA 4E9GA 4JKBA 1JKRC 2EFWA 3AO2A 2NS8A 1KU2A 4QSHA 3IKTA 5EOYA 3PIPF 1PU7A 4AIAA 3AAPA 2MBFA 2CW7A 2RPIA 2XAQA 2Z1HA 4OWRB 4HAMA 5GANf 2HD0A 5J40A 2CP6A 3SQ4A 1GT0C 2KQRA 2YRDA 2DPPB 3S1QJ 1FIPA 1BBZA 3HK2A 1VSLA 1S9EA 4B3RK 4QQ6A 2DZCA 3AVBA 1IRGA 3GPLA 1I4K1 4HQMA 3DKYA 3F23A 3GTOJ 4YY3K 1FOWA 4QPOA 2JT1A 2ZXHA 3A01B 2RHZA 2RKIA 4WFNL 1QW1A 4D5CA 2AXTC 1SC7A 2NOJB 2GV9A 4O0IA 2DYSH 3WGHA 3RKWA 1UMQA 4FZZA 3REOA 1QWEA 9ANTA 2HZTA 2KK4A 2XY5A 2W84A 4CZHA 2F5TX 4BQZA 3WQTA 4B1VA 3WXKA 3OYYA 2QA4N 1NHAA 1PC0A 1E3PA 1Q82U 3PGGA 1QVTA 2BUPA 4KTQA 1VI0A 2CV2A 5GMKm 4WXDA 5EF6A 5I2MA 3Q7CA 2EZHA 4XSXF 1MIJA 2KZZA 2K57A 3I54A 4BR9A 3H3OB 1R49A 4DSJA 4B3AA 3CCVI 2V26A 3KBGA 1KC8C 3RKQA 2OCCH 3JXUA 5KI6A 1JCEA 4KI4A 3RRHA 1IXSB 1T8IA 4M77B 4HG2A 1YIJN 5AZIB 3CJ7A 4EW4A 1VQ5N 2P9NA 2DTHA 1M1FA 1IZ6A 1UB9A 2DM1A 2WAQA 1SFOJ 1FJGK 4JS4A 2A69F 2IS6A 5DCMA 1JXMA 5KE3A 3TDZC 2CUZA 1K4SA 3ZX2A 1NM7A 4MQ3A 3L7WA 1PDNC 4Q5WA 1AT1B 1WNSA 2MK5A 1J0RA 1PCXA 3FXUA 1YI2N 3K5LA 4P55A 4LXCA 3EYZA 3PMIA 1M2OA 1VQKT 3M0RA 5A2QO 3PUFA 5DK5A 2COBA 3MCPA 2DMOA 1V5GA 4Z4IA 3DPUA 2CV0A 4JKDA 4FYVB 4D1QA 1MGTA 1WLPB 1W5SA 2PN6A 4WK8F 1MGQA 1C0TA 3IHOA 1Q7YU 2ZE2A 5LL6S 1MH3A 1TH7A 2DRKA 4FWRA 2FC0A 4C2TA 1FJLA 1MNMC 3P8DA 3QEVA 2OBPA 4DTNA 5GMKj 5AQKA 5KVRA 3MKDA 1MBFA 1ZSZC 1KC8O 3G71A 3F9MA 4Q48A 4IJAA 2LT1A 3VA3A 2KP6A 2P0PA 5KYWB 1M5Q1 3GNFB 4N0BA 3OS2A 3LP3A 5CKTA 2R5ZA 1JLQA 3RSNA 4DBQA 2FE3A 1LKXA 2DODA 5E18F 2EFPA 4B9VA 4M78E 2EW3A 2PYJA 1D5VA 2JMWA 3U3YA 3VEWA 2KRMA 2VOOA 3FR0A 2OTLN 2GWRA 4WCEL 1Y07A 1KAXA 4EM2A 3UKRA 5J4VA 4M75C 2YX4A 3QZ9B 4ZGJB 5AIPA 1QHGA 5EJCA 2EIMH 5K14A 1NPPA 1WHGA 5IOZA 4YOXA 2P1JA 2EQUA 1S1UA 4CXFA 4ZN1A 4FW1A 4OGEA 2X9HA 1IG9A 1MDMA 3HPOA 4M75G 5AQTA 3SEZA 5BRDA 4Z88A 2DU9A 3VQ5A 1ETKA 2VKEA 5LJ3j 2WONA 1N34K 2VXEA 1I1JA 4BC2A 3OOPA 5DM7F 5C10A 1HSQA 1D1BA 3D5RC 4A6DA 3ER0A 4L5JA 2RQVA 1NYGA 1HKBA 3T0YA 4P5OA 5JVTA 1UJ0A 2CJJA 2JA7J 4D7NA 2O3FA 3KYCB 2W85A 3ALYA 2R7FA 1BC8C 3JRAA 5FU6C 3R0AA 1F9NA 4YOQA 3W3DA 4I0BA 3IHUA 2CQNA 4A12A 2XPVA 2JPSA 5H6RA 4LY7A 3TAPA 1NKUA 3W6JB 1J53A 1WN7A 5M1FA 1I5ZA 3I4NJ 4IOCL 2RHXA 3CDHA 2COZA 3JAME 3TREA 1RDCA 5J47A 4XLAA 3MCZA 2DLPA 5J2MA 2MA3A 1VQON 2HR3A 3GFIA 2YHYA 1MUZA 3DP7A 3ZQLA 4FJXA 4FHTA 1OPCA 3EE8A 5B5EC 3IUCA 3KUFA 1JO8A 3I0XA 4PJOE 1ATRA 3D2EB 3H45C 1XMKA 4M7AB 3DOLA 2VQEK 2VWBA 4X34A 3RYRA 4KH1B 3OYJA 3PO4A 3UPUA 1RAEB 4AILC 2KQWA 1FBSA 1VQPT 4XR6A 5TKWA 2Z2SB 1FYKA 3FKIJ 2HMIA 2FMLA 4OMNA 4X1EA 5HROA 2R7DA 2EA2A 4NC6A 4HTLA 5DV5A 5LEJA 4PNOA 4RB3C 3IAM2 5CJ9A 4XLEA 3TO7A 1RADB 4A3CJ 4W97A 4HSBA 3H08A 4NCGA 4CF2A 2L7ZA 4H5VA 3RVCA 2GBYA 3V7CA 4CZFA 1VQ6A 5L3FA 1R0AA 2CKKA 3TQNA 1K0XA 5H1SQ 3OSGA 1V76A 2XSJC 2DAOA 1YHQA 3OOUA 1WI9A 4M3YA 5HLTA 4JEPA 2Y4YA 3OB9A 2PU9B 3HJFA 3AG2H 4M3FA 4A3DJ 2GIVA 4JKAA 5IHKA 4IRIA 1X9JA 3TU5A 2GOXB 1NKBA 1NEGA 2A61A 2JWLA 4JNEA 3CCRI 2DDBA 2GF7A 4JYAK 2ESNA 3ZMTA 2HQAA 4DOWA 3B8AX 1KGSA 2VV5A 1B9MA 1HU0A 5GTIC 4I01A 1RGIA 2HNYA 4FL6A 3KLEA 2LT4A 3F0ZA 3FDYA 2GOMA 5J3LA 1PUEE 4MQVA 4BR4A 4HVJA 5FKLA 5GADP 3B6CA 1TK0A 1MBEA 3KWGA 2CSOA 1N32K 2QF7A 4EA5A 3JAMK 3TU4K 2NUZA 2YT6A 1U2WA 1JCFA 1HA8A 2IA2A 2JA6J 3M0PA 1MBHA 3J80E 3GTPJ 3SNNA 3ZP5A 1WJ5A 3JCMc 3HHTB 4II1A 3P9IA 1VSKA 3ZMVA 1IV6A 4W5QA 2JPCA 3X28B 5JVHL 3CQTA 5GAMd 2OAWA 3CC4T 4C8LA 1UZCA 3CCQI 3VQ9A 1JUSA 4KKOA 2P9UA 1D0YA 3QMLA 3ONQA 2EPDA 4UQGA 3TAMA 3SUOA 3QWXX 4DEYA 4CK2A 2PMZN 4KHWA 3T5XA 1A5JA 3DKMA 3VUBA 4I99C 3G0ZA 2ZF5O 1Z3XA 4CZGA 1TWGJ 4JI6K 2RQUA 2XDVA 2YI1A 2DXBA 1SRMA 4G7OF 2P5LC 3U8XA 2FD5A 1DP3A 2ZMEB 3F22A 2KHMA 4C8QC 4GKKK 3TPQA 3FXQA 2ZFWA 3VQCA 5GAN4 4FYXB 4WTOB 1M3BA 1VA7A 4C8QG 1J7KA 5ED4A 2JQ7A 1WXBA 4GBQA 3HUGB 3NDKA 3ABLH 2DETA 2FBVA 3HSBA 3MN9A 5BQTA 2YS9A 1WJEA 3F8FA 5BPLA 1KQSM 1UEBA 1NBEB 3G3ZA 3IKVA 5DD4A 3DWLE 4ZHRA 5LJ5h 3I58A 1DTQA 2E71A 3O9UA 3ULEB 3ZQCA 4HDVA 4JD2B 2QK0A 2V1XA 1OFCX 2P7VB 2AHQA 1QVGA 2V52B 2JWKA 3AGKA 2GWJA 2EQRA 2YJEA 2HVHA 4O0JA 2NOBA 1PUFB 4RGRA 3HRUA 3GE1A 1YTUA 4ILHA 3CQYA 5C25A 5FFXA 1R0BG 4XLCA 1M8VA 2M87A 4W5RA 3DQVC 3ZMZA 1C1AA 2F2VA 4KGZB 3CCLN 2CDTA 2LP0A 5I42A 3REBB 3GIBA 3MZ8A 2E3HA 1VQKQ 3OL4A 3TKYA 3LDPA 2NLXA 3O4NA 5AZIA 2OTJT 3JRHA 1S6PA 3M0QA 1AHDP 2RN2A 4M3UA 5CAIA 4PWDA 1VSJA 3PTAA 1X3NA 4FL9A 1BBYA 1BIZA 2X35A 5T7BA 4A53A 4DZPA 1QO0D 4G9YA 3AL0B 4FJ8A 4F7UG 4CFBA 1DUXC 2BUDA 1X2QA 4GDFA 3CC2I 3H3NO 3V9WA 1BISA 4PJMA 3MMVA 5C44J 1VQLA 2HSTA 3PX6A 3ULRB 3A5LC 1SFUA 2UV1A 4BJTA 4ATOA 4AQYK 1JT6A 5HS7A 2JLEA 2QWRA 4DQRA 1AWOA 4CEOA 2LCCA 4A2BA 2X6XA 1A36A 2GIZA 2A1RA 2H8RA 1I8FA 3QOPA 4BC3A 1NGBA 4Z94A 2K9GA 2NRWA 1N5ZA 2FVUA 1SD4A 2EZIA 2X4WA 1QP3A 2P7CB 1TKXA 2OFIA 2KL4A 4RLFA 2LCLA 5DM7R 4AM7A 1AWXA 2DKGA 1N6QA 4CH7A 1ZBIA 3NBPA 3SJMA 3ABKH 1Y97A 5KYWA 4XNFA 3SLCA 1OKJA 1B3QA 3HM9A 1JXEA 3HRTA 5D6FA 4B24A 3TTCA 4MHGA 2VGNA 1WA7A 1PP7U 4GFBA 2ZPHB 3ZCOA 3H8ZA 2CUFA 2XGCA 1T44A 4CJVA 1VQMA 1RESA 3DLEA 2K4JA 3ZMDA 1VQ8N 3K4MA 2ME6A 1YW7A 4KREA 4F91B 1ILYA 3VGKA 3K58A 3T9NA 3BR3A 1NK0A 4ZC3A 2VVKA 3PNYA 3HG9A 3K0SA 2L9RA 5AQFA 3VEOA 1WSJA 1MD0A 2YHBA 4IHYA 4FXDA 4GKJK 5KPRA 1IDYA 1SL0A 4CC7A 1MMGA 2JS2A 4Q5VA 4KHNA 4M7YA 4PKHA 1MSEC 1BI4B 3IMXA 2X3XD 3T8TA 3VS0A 2ZSIB 1XC3A 2E7XA 2VXDA 1WOQA 2ZC2A 5D4SA 3GVAA 3HOUJ 1YITA 3H3VK 3BF3A 2GM4A 2RHYA 2HOTA 3DU6A 4DQIA 4UVBA 3CUQC 2V9PA 5LJ3g 3PLAA 3HSCA 5J1RA 4WF9L 1IUFA 4ETSA 2DTZA 5HLFA 4F4KA 4LDYA 5AZJA 1U2VA 2BOLA 4KT6A 1WHKA 3WU1B 1W97L 2MGQA 1MMNA 3BW1A 2NVQJ 3ME9A 4AFQC 2Y1JA 2Z3YA 4JX4A 2V1RA 1HYZA 2P4RA 4EMHA 5CR4A 2RMOA 4JKFA 3IH4A 2HOSA 5KQ8A 4IFVA 1T2KA 5C0MA 2E2HJ 3Q0UA 4FPAA 3OGDA 5E1WA 4CCJA 1SAZA 4BWJA 5AT1B 3JYTA 3HM8A 4CF1A 1MUYA 3N05A 3GLXA 4I6MB 4RCCA 3OS0A 3AVHA 1VQPQ 1Q7YR 1VYUA 4LDXA 1N39A 3HZ6A 3DEEA 1TTYA 3FF5A 4NCAA 3A5OC 4DSKA 1ETWA 1AOYA 3O5ZA 3NHGA 2VBXA 2MABA 3CTAA 1MMSA 3CMEN 2V75A 5FJ8J 4M7AA 4DIQA 3NAEA 3TSZA 4J8FA 2WBMA 4DFPA 5HK3A 4QIWN 2BXZA 2NRAC 1ZELA 5F2RA 4AIHA 1PNJA 3DRSA 4IZ9A 2E2OA 4FJKA 1L3SA 1BR2A 4LF7K 2DOAA 5KH6A 4FWOA 4J01A 4M3GA 1Q86O 1JT0A 1K83J 4ME7A 3G10A 3LSJA 2QENA 5M1OA 3DV8A 4M78B 4WQ5C 3NTHA 2ELHA 1J5OA 2ID3A 3M9AA 4JDSA 2MFZA 2FPDA 2DTOA 2IAIA 3CUQA 2O8DA 2STTA 4CBWA 4YFNF 3GYHX 2D5RA 3ULQB 1T6DA 1Y8QB 1HKTA 2KGTA 1X9SA 4BE2A 4C92B 1XGMA 1OU9A 3PFIA 2E41A 5EC7A 3H0HA 1MH4A 3VRYA 3CMAN 3DAWA 1QCFA 1EXQA 1J75A 2DMUA 2M4KA 3VS1A 4A6EA 3QYBA 4B8XA 3C4SA 3OHRA 1XNIA 5HP1A 3E2UA 2YU3A 4L9NA 3U9ZA 1XHZA 3NARA 3PT9A 2DE0X 1E6HA 2E6MA 3CPEA 3EAEA 2HS5A 4RB2C 3K0LA 4BB7A 4B1ZA 4DV4K 1HD3A 5D5WB 4V2GA 3OYIA 3VV0A 2WBNA 1LJ9A 2PVGB 3CCSA 5GJWB 3EGXB 4XRFA 3MWPA 4M7DF 2KROA 2WA0A 3SZGA 2QI2A 4TVRA 1GXPA 2HVRA 3AG1H 2JTVA 4MZPA 2QKBA 1RL2A 1WEGA 3K4BA 3VEXA 3MCAB 4FZXC 5AONA 1IO6A 4CHOA 2Z5UA 4IXAA 3I9QA 1X2MA 3V9ZA 3CC4Q 3GCMA 4JOMA 3G1LA 4JUVA 1H8KA 5L3GA 2O9SA 3M5RA 4IBNA 2JJ7A 2BZXA 1K9MR 4NL2A 4IUUA 5HKCA 3M7GA 3ZQFA 4HSRA 3CETA 2D45A 2LQ8A 2HYJA 3RMQA 5AJ3K 2KJBA 4WQ5A 5AQQA 1ZG5A 3E6DA 5D6XA 1D8YA 1Y8RB 1IRXA 2ZGWA 3HPGA 4FE4A 4KPYA 2KKZA 2VG7A 3N4QA 2P9SB 2LJ0A 5B3SH 1WZ2A 1HJOA 2H09A 2MH2A 2FBYA 4K41A 3L1PA 1WI7A 1FW6A 2YCHA 4A69C 3ASOH 2VKHA 3M8SA 1QTMA 3Q3SA 1AD5A 4YIFA 1S72Q 2O9LA 5JLHA 3WGGA 1A35A 3K10A 4HX8A 1IF1A 3DLRA 5DPKA 2K85A 4N4OB 1LMZA 2G7HA 2CQKA 4Y3OA 2YUOA 5JHFA 5IT9K 3X24B 1HQEA 4P1WA 1H9GA 2OFKA 3M59A 1REPC 4O3MA 3G71T 1D8JA 1J5EK 1WXTA 2IOCA 2W57A 4BRAA 1RTHA 1YW8A 3S14J 2BW3A 3HUGA 2QEXA 2PQWA 1TUCA 2RQRA 4CJUA 4N0AC 3SK3A 1BA5A 4FJNA 2ROTA 3OTOK 3I56A 3QSUA 4M7DD 3HSTB 2UXBK 1E6GA 4PHTX 2AZVA 5KTQA 2JZ2A 3BE3A 5M5XJ 3ULEA 5AQOA 3H36A 3CVSA 3QEIA 2FU4A 5ADXH 3MKLA 1VQ7N 1N8RC 1J5YA 4A2AA 2EJRA 4EGZA 2M51A 1Q81C 3O3KA 1UFFA 1PUFA 2VUBA 4HXJA 3GLLA 4M6YA 3M8EA 4H0EA 1YJNT 4N9HA 4F2SA 1X3MA 3OYBA 4CYCB 3FK6A 1TWFJ 4PGHA 1OEBA 3C18A 3M0UA 4YIIA 2ZJ2A 3QERA 4DTJA 3A8OB 2MC3A 3VUZA 2ECCA 5GAN3 3KK7A 5LJ3d 4LN2A 2IDOA 1MJ9A 3QPHA 2H3EB 2FMYA 3GFLA 2CS7A 4XN0A 5AFUA 1WBBA 1MUNA 3JRIA 1IBMK 2VQGA 1WSGA 1S1NA 5EG2A 4YELA 3BROA 4BU2A 3OMCA 4M3RA 4JZ4A 1KD1C 2ZJRF 3HOSA 3WXIA 2X51A 3MEVA 1X9WA 3L2QA 2UXDK 2XGXA 4KBMB 3LX7A 1QVUA 3J81E 2J6OA 3RYPA 3WNHA 4LGWA 4BRKA 5ICEA 1QHHD 3QKJA 3HHHA 4KISA 3THVA 2MD0A 3FZFA 1N8RO 3EG0A 4BQAA 1Z25A 1IBLK 4YDUC 2VQHA 2KXCA 3KZYA 5FPNA 1GLBG 4CGIA 4CJRA 4A5MA 4BHPA 1X43A 4J2AA 5EZHA 2A6AA 2ED1A 4JLGA 2DF6A 3S3MA 3F3XA 5H2FC 3NH1A 4E7SA 2ISZA 3ZQIA 4OKJA 3F70A 2P0KA 1APLC 1WZOA 3AO3A 4JJDA 3HIFA 2GUIA 2EB7A 4Q0BA 2ELKA 4GRIA 4BG9A 2CRGA 5EU7A 4NXMK 3DXMB 2XK0A 1YVUA 3MFKA 4RCBA 1NJXA 4CRIA 4N76A 3QDRB 3LH5A 4ILJA 1NG7A 2XAHA 3SPYA 1U6ZA 3R3LA 4EJYA 2I5UA 4NYNA 1KG5A 3IC7A 2ABKA 4BR2A 3MDQA 2GZWA 1NG9A 3I55A 2HBPA 3JCMb 3D0SA 4FT2A 4JS5A 4X6AJ 5LJ3f 2NWMA 3NTKA 2JN0A 1KD1O 1S7OA 5HDNA 1BW5A 3LSHA 3WNGA 4OPKA 3LP2A 2FSJA 3RR6A 4A57A 1VQ6T 1TC3C 3JCMX 4R56A 1BI4A 1U0JA 4IO8A 2OAZA 4DTRA 1JJ2P 3EE9A 1QHAA 1TVRA 2RB6A 3SWNC 1YHQT 1JLCA 4O8UA 3JAMZ 3VS5A 2UXCK 2EZKA 1SS6A 1NGAA 3N4PA 3SJHA 4DYRA 4CHNA 2KVQG 4QKUA 2QA4T 3CCEA 4C8QF 2NRHA 2V1QA 4M3WA 3O3HA 3ZMUA 1K8AC 3R1XA 4C92C 1KU7A 4KDPA 2GXGA 1V55H 1HNWK 4N4NB 1OCPA 2O6GE 1Z21A 2R7TA 2CG4A 3S17J 2EIFA 4HDUA 3HVRA 3K70C 3CJQB 2Z1DA 2LK2A 5D6YA 2R7WA 1OQYA 4NS5A 2OV7A 1M3CA 4XORA 4W1UA 4AG1C 3HZJA 1JKOC 1T0FC 5F0XA 1WHMA 2CP5A 2Q2EB 1JE8A 4UNFA 1SKSA 2H8WA 1QZ5A 1VSHA 4J9CA 4C8OA 4ZYEA 5TKYA 1BB9A 2KRCA 3A8MB 1RIOH 1XGSA 2QK9A 3CMMA 1M8MA 1VQLI 4A54A 1VQ5T 4ON0A 1ORKA 2ZFUA 1PKTA 3G4SN 4BRDA 1SSFA 1R5HA 3J81K 3T7ZA 3E6CC 3OW2A 2K4BA 2DTIA 3CIPA 4RTXA 2XDDA 4FM2A 4J6XA 2XMFA 1FX7A 2F8TA 2RQWA 4CD1A 2V6CA 4P9FA 1X19A 3HPHA 1R71A 4FWLA 1EKEA 1OZ3A 1U8RA 1TS9A 3PNVA 3QAHA 3C6AA 5E26A 1RR7A 3CCUN 2M2EA 4H0OA 1ITGA 2HHQA 1HJRA 5AQUA 3M0TA 3EG3A 2KE9A 2JJ9A 3CBMA 4AMCA 4F7UF 1XSDA 2JTFA 4J00A 3H9QA 1QKWA 1LAVA 2XIDA 4LUEA 2BXYA 2H3JA 1UFMA 3LALA 4QAGA 2EYYA 2X1DA 1G3WA 1M3QA 3K1MA 3CXCA 3CC4I 1OH6A 5E79C 5FW9A 1AKHB 3OSSC 3BGRA 4M78A 3IH3A 3F6VA 5GAOp 1VQMI 3OSVA 4KMUX 3AA2A 3JB9H 1VRUA 4FSXA 1DDNA 3TAGA 4OAYA 3H5RA 5IN1A 2Q0OA 1RDUA 4FLYA 1K6YA 3VW4A 3MEUA 1KU3A 2EBIA 4BUGA 2LKXA 4C92A 3OS1A 2YG9A 4HUGA 2RO0A 5HOOA 4J2DA 3LSKA 3H35A 1AU7A 4IHWA 4OLAA 3RI4A 2KTQA 4C8QD 1YTAA 4CI0C 5LMUK 3ITHA 3SFIA 2XROA 1T39A 2YX6A 1Z77A 4QLCU 3T1BA 3MWMA 1YYVA 2HF3A 3O8MA 2F2XA 2VPLA 1BL3A 3AAQA 1YO5C 2X78A 5CQEA 5DDGA 2B86A 1Y6IA 1LW2A 2P6TA 1S72I 2O9VA 1U48A 2LQKA 3J80Z 1A0NB 4RTZA 1QVGM 1SFXA 2R58A 3JAMO 3ZSYA 3EGXA 2MC4A 3VMFB 2ZNYA 3LFUA 2A08A 5CYMA 2YUQA 4UHTA 2E5ZA 2J06A 2VWKA 1M27C 4BEHB 1Z9QA 4D8DA 2DN0A 4CJTA 5BMZA 4HA8A 2RV8A 2DPNA 3EZ5A 2O01E 2Q3SA 2WTEA 4EQQA 1OISA 1GXQA 2L7MP 2EINH 1EWRA 3GWZA 4IOAF 2LMDA 3EKUA 2KI7A 1YNZA 3NVMA 3PIPL 3GBTA 1NH3A 4NO7A 2HMAA 4MTDA 3U1KA 1VQNN 1WNLA 2LZ6B 2E3IA 2JSCA 4XQ3A 1ZH5A 2YX7A 2EIJH 4CIGA 2R7YA 2A3LA 3RJPA 3DCFA 2YWWA 3ZEUB 3CCJN 2W48A 4P9UA 3X26B 2P9SA 1X9MA 5EVZA 2FQ4A 3MVPA 4DV6K 3CYMA 2OPRA 2BTFA 3MN7A 2E5NA 1QGPA 2VBYA 2EGCA 3ECOA 2VLAA 2Q2RA 2X1CA 1T7PA 3VS7A 2K4YA 4RGXA 5J26A 4LD9K 3ML6A 5LRSA 5GAOm 2BZTA 1N36K 1QVFA 1MJBA 1QQOA 2HZYA 1LAWA 1BM9A 1WGSA 1I0CA 3WHBA 1KLNA 5EYRA 2LQNA 2I8DA 4C8MA 3W0LA 4Z4GA 2XHBA 1HOMA 3BUZB 3PO2J 2DIQA 3JCMg 1KK7A 1VQ9A 3CD6A 2QVOA 3PO3J 2BKDN 2GBZA 2WY8Q 5HLGA 4CF0A 2W6LA 3KP3A 4IHXA 2F4MB 5HK0A 2E65A 2Y69H 5C2DA 1LPLA 4MZTA 3EPZA 3F5TA 4K25A 3CPWA 5JI6A 2E6ZA 5IHNA 1YJNQ 2DEQA 1ASWA 2FBKA 4NCBA 2NOEA 5FLMJ 1OQKA 1WAJA 2R3SA 1AZGB 4DS5A 3FB9A 2VN2A 3LA3A 2DA5A 3ZPLA 1CXQA 2A05A 4FYYB 3ZX0A 1MPGA 1VIFA 4DSIA 4M77G 2WTUA 2KKOA 3LMMA 2DBMA 2HQ5A 1V4SA 4G94A 1O3RA 2DL8A 2QUFA 2YHTA 4DZJA 1GHCA 4HCZA 4FOIA 5TISC 3EHRA 1UHWA 3JCMQ 3P8BB 4HSTA 3VQ6A 5IP9J 4UY8O 4OKEA 2OAUA 4CYCA 1WFWA 4RB0A 4OIQF 2K9SA 4FTHA 2I7NA 3R61A 4R8HA 5HDKA 4XLPF 1TK8A 1LQ1A 3R9PA 4O5VA 1YF5L 4IG0A 5F1RA 5AQJA 1WJRA 4F7ZA 3OH9A 1ZTRA 1Y64A 1EETA 4HW0A 4L5GA 1N77A 3CUOA 3LDLA 4FK0A 5HCKA 5GANh 3NGIA 4C8KA 1JHHA 4DHYA 1XMXA 2DI3A 3K6GA 4FX0A 5CZ1A 2Z0WA 3SUNA 5HVQC 4IHSA 1HRHA 3L3UA 2XAUA 2QAZA 4KAZA 5D3GA 4XRSG 1KG6A 2DX1A 2QTXA 2DA9A 4FLWA 2F48A 3ZSWA 4FZYA 2WAFA 3HSEA 1FP1D 3CCMA 4LFUA 2EA4A 4EMKC 5H20A 5DMRA 4HQEA 3S41A 2NVUB 5FWBA 5M3MJ 3ZSQA 1KC8U 4B4CA 3MZHA 4DTXA 5AN4A 1T33A 5CYVA 1Y96B 2OZ6A 4LD5A 2QYZA 2V1UA 1NK6A 4GYGA 4IIOA 4DBFA 4E4HA 2HBJA 2SEMA 1X75C 1MWKA 4DV1K 3EO3A 1YJWA 1O7FA 2ZAEA 3BPXA 1QA6A 3MKWB 3KLOA 3R6MA 1RBRA 3PFYA 1XJWB 4LITA 1TKZA 3WODF 4MZMA 1P8ZA 4AYBN 1OLTA 4FASD 1H1VA 1JL2A 3CQ8A 1YHQQ 1HQUA 2XPWA 5KRSA 3M56A 3UKGA 1WXUA 2QA4Q 2RGVA 3DWLA 1D0ZA 1SL1A 3F21A 4XKWA 3SZPA 5A2QE 1C1CA 1FNNA 3VQEA 3KZZA 3Q0WA 2CP3A 2XKOC 1W7PB 2Y31A 3LNQA 2HSPA 4JKHA 2E2NA 3TVTA 2BVLA 2K9QA 4NB5A 4LNPA 3ISPA 3VKIA 2KRNA 4X62K 4XKVA 4A63B 4IUVA 2DQLA 3M4OJ 2HBWA 3DB4A 3MXJA 4J2BA 2ZPGB 2ZZDA 3H46O 4DQQA 2W40A 2DL3A 4RTTA 4PSXA 4E7HA 1B92A 3SBGA 2NNNA 1YIJQ 3B73A 1VQ5Q 5CVIA 1A04A 4B3XA 4EMKA 4GY5A 3AO1A 2HVIA 1UGVA 1T0HA 3ZQ7A 3QO3A 3G7ZA 4X1VA 2PMUA 1FSHA 2VPRA 2Q2EA 3KTUA 4HKEA 1QCNA 3M8PA 4ABZA 1XTAA 1YI2Q 4DFJA 3V4GA 5GINA 2KAFA 3O9SA 5DLQE 3BZKA 2GXBA 2FOWA 4IUPA 3UF4A 2JPBA 1NGGA 4QS7A 4EZ6A 1B9NA 4CICA 2LMJA 2BE5F 5IY5H 2OC6A 2FNPA 2IS4A 1M90O 3H41A 5FU7C 3VEVA 2R7SA 1XNRK 2A07F 5I22A 1M1KO 1G2BA 5EDNA 3MEWA 5FLVA 2E20A 1IN5A 1DP7P 4J9HA 4XONA 2KSSA 3IAS2 5HDGA 4G7ZF 3H0IA 4EJUA 5EXWA 1HNZK 5IXBA 1ZRDA 3IUOA 5FPEA 3WE3A 1H89C 1YJ9I 3D1NI 4M7XA 4BDPA 3L9FA 2DFFA 2E1OA 2Y9ZA 1AKHA 2J5PA 2AIRB 3TOAA 3L09A 1F4KA 3ZYYX 4B23A 1BHLA 1VQPN 3AO5A 4A3IJ 2OTLQ 2QWOA 4Y1CA 2P5OA 4G8XA 4UNOA 1ATNA 1OU8A 4ESRA 1GV2A 2UXXA 3VDXA 1JXSA 2O0YA 5EG0A 4ENKA 2HHHK 4PJJA 2I10A 4M75E 4JZ3A 4A0YA 4HF0A 2JVGA 3PO5A 1JGGA 2J6KA 3T8RA 1LW0A 2VG5A 1PVEA 3ZOBA 1IUYA 2QASA 2YLCA 5CZ2A 2QEXT 1KQSS 5HLHA 3W2WA 1FMWA 3CCEI 4RAFA 1CSKA 1BIAA 3I56T 2G9WA 3JCMP 3A1PA 3IQLA 5CKBA 3QO9A 2O5RA 4YPRA 2E8AA 1ETYA 4FJHA 4FT8A 4BGBA 4ZYDA 1WFXA 2LX7A 3MEGA 2VGMA 4OB0B 4H5WA 5GTHC 4BEHA 1LDJA 5D6WA 1Q9XA 2KT1A 3MD2A 2FO0A 2LQWA 1JJ8C 6AT1B 3CXCP 4XH4A 2HNDA 3M0SA 3SDBA 5GAN7 1CF7A 1NBWA 1Q1VA 1B59A 3CJBA 2CGKA 2G8HA 4E1MA 1TL1A 1EFNA 4FU6A 1SQKA 4LF6K 4GLKA 1HW2A 2F69A 3OR1C 1ON2A 1YJNI 1IKYA 4BD3A 3ZSVA 5EEGA 5F04A 1NPRA 2P5VA 3KHYA 2E1MC 1NK3P 3WXJA 3ZEUA 1DIZA 2G8WA 5LLQA 1HR0K 3VJPA 1ZK8A 5CVRA 4DB3A 1P6RA 1JTYA 3DLBA 2GNCA 4DNCA 3GBQA 5IT9O 3KXTA 2LD5A 3O8HA 5F1JA 4IJNA 4G6TB 2DIGA 2LREA 1BA1A 2X4JA 4FWKA 5F64A 3QFUA 5CQGA 3I59B 5AQYA 1VQ4N 2V1DA 2FRWA 2NOHA 4FSSA 5GAEP 3E9FA 3KLHA 2Q31A 1SEMA 1YRNB 3CMET 3Q1JA 1GLFO 1BCMA 3HM5A 1ERDA 2HHWA 3CC7I 2M34A 5J8CA 5BPIA 3CFRA 1J2XA 3GX4X 3QNOA 2PZSA 4JJNK 1TQIA 2HQHA 3O4WA 2KT0A 4YNQA 2M4GA 4IQJA 3DI6A 3W3CA 2W0ZA 2DILA 3TAFA 1HLVA 1MV0B 2E70A 1MU2A 3R6OA 2HFHA 2AQFA 5AQRA 4C0ZA 1G3YA 2V7ZA 4EP4A 2DT6A 3A8GB 4Q4ZF 4FW2A 3ZEHA 4EJVA 1I3AA 4OVAA 3EG1A 2AJQA 1UCRA 1K7AA 2ICWG 5TRDA 1OPKA 1S5JA 3VFZA 1B34B 1RDBA 3CMAT 2YNHA 4B44A 2ZCFB 1USSA 2QSHX 4DKWA 2DLLA 1R1VA 4UC4A 2HPIA 2W6KA 3K5NA 1W2BM 1N75A 3FRNA 5CPRB 2KZMA 4LSNA 4B9NA 1ZBXA 2Y0SN 1O57A 1WB9A 1AEYA 1RC9A 3J81Z 2ZPBB 3PIPA 4M42A 3PSIA 2VBWA 3K4LA 4PJLA 3TO6A 2KLAA 3VN5A 2J7IA 4EJOA 4KHYA 4B47A 4PL6A 2A6HF 4M73A 4TV7A 2LBFB 4II2A 4XEIA 3V42A 1FLIA 1HDDC 4KN7X 2O03A 2ZXIA 3MEDA 1LWYA 1XWLA 4C5EA 5M5WJ 3MP6A 3PFSA 1FSEA 4CJ5A 4BY7J 5BN9A 4ANJA 2QA4I 4J9IA 1D0XA 3GO5A 5CKFA 5SZTA 1BCOA 1KLMA 1E3MA 3AVNA 2VYTA 2R7ZJ 2UXNA 5LJ5e 2OTJN 3CCRN 1KAZA 2LYCA 1XMOK 2W04A 5FROA 3FBNB 3CCVA 2DD4A 3M07A 4AHSA 3CPWP 4M3TA 3EFSA 5GAGP 3SQ0A 5I9EB 4A4KA 5AR0A 3OW2M 4HNUA 2O31A 2X9DA 1NNEA 2ED0A 3G2BA 3RERA 2X74A 1YQMA 1XSXA 1WHUA 2EZLA 5GPCA 2YHWA 4A61A 1YIJI 4BQLA 2E6NA 2K5FA 1VQ5I 3A4CA 1Y96A 1XQHA 3DTEA 1XMAA 5FPMA 2LJ1A 3CJNA 1LFUP 5M9OA 4DR4K 3JRZA 4H0YB 1N33K 1ZBJA 2W10A 3EKSA 2JVHA 4EEFG 1YI2I 4OFEA 4C8QE 2P9PB 3K4CA 4JRIA 2L3DA 1RI7A 5JLXA 2H6CA 1R4NB 3L0QA 2QTVA 1D3YA 4AIJA 1NE8A 1RBUA 2CS3A 2V1NA 4N5SA 2XB0X 2HKQB 2NOZA 3K9JA 1GOBA 4GV3A 4BGAA 4QVDA 3LWHA 2OPTA 5M1NA 2DJNA 2NYSA 1W7PA 3KK3A 5BOXA 3LA7A 3RPQA 2F6CA 3V7SA 4KITB 2KIUA 1RAAB 2G3RA 5EEAA 4KBOA 1RBTA 4L5EA 3JS6A 1TL8A 3JB9G 4N4IA 2D1HA 2QWPA 2XVCA 2CREA 1UG0A 4D0PA 3G6EA 1DKGD 4WWCA 3TP0A 2V9KA 3CCLQ 4ISEA 2DJIA 2XPUA 4CZEA 1VQ7T 2CSIA 3HKZA 2ZBKA 4OMZA 3DXKB 2HTJA 4DSFA 2OTLI 1L0OC 3J81O 3K5MA 4JKCA 1RI9A 4RGSA 5IT3A 4M77F 2X85A 5GAN6 3I64A 5M1PA 2UYTA 2CMPA 4UY8I 3WTXC 1SAUA 4F7UE 3VPRA 2DY4A 5J3BA 3S16J 3K69A 4EZ9A 3FLCO 3FE1A 4CHYA 3M1FA 3QDFA 2C06A 1T98A 2OU2A 3M1CA 3QJ6A 2KFNA 5ILVA 2YSQA 1G3SA 3HC7A 2NRRA 3QYGB 1T56A 5GAMj 3WTUC 3N5BB 1SG5A 2CGJA 4CIEA 4DV5K 4M4ZA 4BR7A 1VOMA 3IH7A 3E9GA 3KIOA 1SVOA 1B1BA 4A3LJ 4JHDB 4H5TA 1GLJO 3AFHA 3LSRA 5J6XA 3C2HA 4CGDA 2P81A 2PI0A 5GAHJ 4A2UA 5EZGA 1K1ZA 3JSCA 4LE9A 4JN4A 1Q86U 3SUQA 3SHWA 2IAJA 1HPMA 3EG9B 1R58A 3CFPA 5K1YA 4B1WB 1VSDA 4KIFA 2E1YA 1ZYRF 2PZ1A 1QVFM 3HFOA 3D5LA 2EHGA 3KEYA 4LDWA 2B8AA 1Q7YC 5IAYA 1U06A 1IKXA 4Y91A 1VQOI 4JRQA 2E1NA 2HKNA 4G12A 3VETA 4A3GJ 4AM3A 4AFUC 2RK1A 4FLZA 5IHIA 2YXYA 3F8CA 1S7AA 1J6ZA 5HODA 2IIMA 3WT0A 1VQ9T 3MMYB 4LOCA 4CCKA 2ZPEB 4DCHA 1P4AA 3VYHB 2Y90A 1NGJA 4XTWA 4CJKA 2Z1GA 3IWFA 1QVPA 4Z4HA 3CPWM 4H5NA 3CM6A 1OKRA 1M30A 2R4GA 3TR8A 1SSHA 1WQWA 1UA1A 3NTIA 1XS9A 3BR6A 5F1XA 1WJDA 4M77D 1NJIO 2HL5C 1VRTA 2BBYA 3LL3A 1BK2A 2D0QB 2F5KA 1EWQA 1LV5A 1O1WA 4KHSA 4CD3A 3MEEA 1Q1HA 3P31A 4BQOA 1HBXG 3RMBA 3SDGA 4FWSA 2L9NA 3TAQA 4PJOC 2HVQA 4A3MJ 3I0WA 5FB2A 4JPBW 3L00A 1MA9B 2RJFA 1IAWA 3MJXA 2RREA 4GY2B 4LF8K 4LB6B 4AUXA 1OCRH 3OH6A 5AQMA 2LP5A 4PJOG 5FFZA 5L23A 3G1MA 4L59