5FWZA

Fasciola hepatica calcium binding protein fhcabp2: structure of the dynein light chain-like domain. p41212 mercury derivative.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
97
structure length
97
Chain Sequence
APTLSTDIEMIATTMSVPRQVEVTEKFKSLVTAHNGKDEEMKDVAQDMKNYMDEKYGRVWQCVILTGSYWMHFSHEPFLSIQFRYGRHICLAWRTPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Calcium-binding protein
molecule keywords CALCIUM BINDING PROTEIN
publication title Fasciola hepatica calcium-binding protein FhCaBP2: structure of the dynein light chain-like domain.
pubmed doi rcsb
source organism Fasciola hepatica
total genus 29
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01221 Dynein_light Dynein light chain type 1
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...