5GALA

Crystal structure of human galectin-7 in complex with n-acetyllactosamine
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
135
structure length
135
Chain Sequence
b'SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GALECTIN-7
publication title Structural basis for the recognition of carbohydrates by human galectin-7.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 31
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5galA00
3AJYA 1DQ5A 4GKYA 5JOYA 1GZWA 4F83A 1W6MA 3POWA 1IKPA 3Q9OA 3TAYA 2CTVA 2UWCA 1W6OA 1MS1A 1W6QA 4YM1A 1V6OA 3WHTA 4ITCA 1N47A 2G4IA 2WT0A 3O0XA 1S0IA 5F5QA 4LBKA 4MYEA 5H9QA 2WLQA 3SNMA 1PZ8A 2DTYA 3ZYRA 1VIWB 3PJQA 2D3RA 1AJKA 1GBGA 2NM1A 1AXKA 3ENRA 4P9YA 4YW3A 4YGCA 5SV8A 3WG2A 5DUWA 1GNHA 2DURA 3WDVA 1WLDA 4FPLA 4LBNA 3ZVXA 1DYPA 1BYHA 1IS4A 3AZVA 3MPPG 2UU8A 1B09A 4UW4A 1DQ2A 4BM8A 1Q56A 3SH3A 3VKOA 3WVJA 2E7QA 1XQNA 4YZ2A 3AP9A 5IT6A 4WV8A 2D6MA 4XBQA 4XZPA 1KDMA 3AFKA 5T5PA 2EF6A 1HLCA 2ZHKA 3OPZA 3RS6A 1JOJA 3ZSKA 2GN7A 4YZ1A 4XJZA 1W6NB 3ZXEA 1N1YA 5T50A 3FBYA 1UX6A 2NP0A 1AX1A 1KRIA 3AP7A 1Z78A 1N1SA 2ES3A 4LBOA 4PCRA 4Y1UA 3B69A 5GM0A 1H30A 3AZWA 1JYIA 4FOWA 2D6KA 3A0NA 2ZKNA 4M00A 3WCRA 2OUHA 4XILA 3KM5A 1LULA 2D6LX 1WLCA 2WKKA 1WW7A 3UJOA 4ZKTB 1IS5A 1FATA 3AYDA 2YROA 1YO8A 2WSUA 4XBNA 2RHPA 3AYCA 1BKZA 1VAVA 3ATGA 3FLPA 4PQ9A 3V64A 1S0FA 3JU9A 1N1TA 4LBMA 4M3CB 4SLIA 1W0OA 2A71A 1G8WA 4FPHA 4RA0A 4ASMB 1W0PA 3N7JA 3N7LA 5HCAA 4PBPA 2YV8A 5GLTA 1MS3A 2W52A 1LTEA 4AVTA 3SITA 4ISRA 3U4XA 1DLLA 4Q1PA 1AXZA 3POYA 1APNA 3ZXJA 1JW6A 1DQ4A 1LOFC 1UZZA 4UW5A 5CNAA 4FPOB 2ZGOA 1HDKA 4AGRA 1D0HA 4BMBA 4BMEA 3JUUA 2JJ6A 4R9AA 1SBFA 1WW6A 2ZGRA 2ZAAA 4FPEA 2H0BA 5JVVA 1O4YA 2WSVA 4IQPA 5DUUA 2VW2A 4W65A 3ZXLA 1PZ7A 3OBRA 4HL0A 2ZGQA 2PHUA 2ZGTA 1V6MA 1WD3A 3WZ1A 3AXDA 2GMMA 5CA6A 5JOXA 2ZGKA 1MS9A 2VXRA 5GLUA 1C4RA 3FUQA 2EXKA 5E8AA 1ULDA 3AZZA 4KBBA 1S0DA 1CIWA 2DWRA 3TB0A 2V5YA 1MS8A 1LU2A 1Q8PA 1UN1A 1O4ZA 2Z42A 2ZACA 1JN2P 3KQRA 1ULGA 5E89A 2R49A 4BLIA 2A75A 2AYHA 2DVFA 1S0JA 4YM2A 4LBQB 5DZEA 4L8QA 2P37A 3AYAA 1UAIA 2LALA 5T5LA 1QKQA 4WVWA 4AYUA 3OY8B 1OFSA 4FPJA 1WBFA 3V0BB 1WUVA 3NV2A 1FNZA 4CTEA 1YRZA 4XE9A 1FX5A 3POSA 2FHRA 1MACA 3PVEA 4TZDA 2GNDA 1HKDA 2ARBA 2C9AA 3BTAA 2VUAA 3N3HA 4HANA 5CB7A 1V6JA 4FPFA 2D6PA 4WZFA 3WHUA 2ZHMA 2ZGMA 1LESA 3AZXA 4R9DA 2WT2A 5KXCA 4YFWA 1LJ7A 2R0HA 4UW6A 5H9SA 3OYWB 1WD4A 4XOGA 3NV1A 5GZDA 3VKLA 1GKBA 1QF3A 1SFYA 1N3PA 4K20A 1ENQA 1A8DA 1MS5A 2KM2A 1S1AA 1ULEA 1Z0HA 2DVDA 3AP4A 4M3CE 5H9RA 1GLHA 1W6NA 4FPCA 1ENSA 3PMEA 2DTWA 2UURA 1QOOA 3D5OA 2DYCA 3ILNA 2JE7A 4FPKA 3WCSA 5KXDA 1Y7BA 1QGLA 1MS4A 3IN9A 3N35A 2WNEA 4YW2A 4AGGA 1GNZA 2BQPA 2HYKA 1G7YA 1LENA 4R9BA 3RG0A 3RMYA 2XG3A 1UZYA 5AVAA 5IK4A 1GZ9A 1IOAA 1RIRA 2A7AA 2D6OX 2VH9A 4LBQD 2R1DA 4LBJA 3IPVB 4RL7A 1IS6A 1PZ9A 5JDBA 3R05A 2SLIA 3O0WA 1LGCA 1KDKA 5EWSA 3V65A 4DQAA 1X50A 4M01A 1YXWA 1JBCA 1FYUA 4XMAA 1MZ6A 3ZSLA 1MVEA 3AK0A 1FV3A 3NWKA 4M3CF 4XTPA 4YZ4A 3UK9A 1GSLA 3H0OA 1SLCA 2TEPA 4M3CA 2AGSA 2P34A 3N7KA 3O0VA 4K1ZA 3M3OA 2W68A 1CQ9A 1LOFA 4Y22B 4FQZA 3T2TA 1S0CA 3WG3A 2GN3A 5FREA 1LGBA 1MR5A 2YY1A 1AZDA 1LOCA 4XBLA 2AREA 4Y1XA 1JXNA 4ISQA 4JCKA 1SLLA 5DXDA 4YM3A 2A3XA 1QNYA 3ZXFA 3LSDA 5GZFA 2A3WA 4ATFA 3AXEA 1LOAA 5GZCA 4JC1A 2YXSA 5GJ6A 2GNBA 1VALA 2DUQA 1AVBA 2VU9A 3M1HA 3RMXA 2NN8A 1LHWA 5GZEA 3AX4A 1DYKA 3WDTA 5EYXA 1C1LA 5GLVA 1CONA 1DIWA 1I3HA 3DGTA 3VKNA 3W58A 1Q8OA 3I8TA 5JOWA 4ATEA 1IKQA 3O12A 3APBA 1V6LA 2ZGPA 4TYSA 1ULCA 3ZSJA 2ERFA 3HMYA 2WJSA 1UMZA 1LHVA 4Y26A 1AJOA 2WQZC 1D2SA 1FAYA 1DHKB 1UPSA 4YZ5A 1C57A 1JHNA 2EXHA 4LBQA 3M2MA 2GALA 2D6NA 5DUXA 1LEMA 3PVNA 1KJRA 5BYNA 1QU0A 3OY8A 2DVBA 2D43A 3A4UA 2A3YA 3L2YA 4Y20B 3SISA 1G9CA 4DS0A 3V0BA 4K21A 3ZYPA 1LODA 3AZYA 4YGDA 2DUOA 2VW1A 4YGEA 3RSJA 2E53A 5IUQA 2NYYA 4P9XA 4ZXKA 3GALA 3OYWA 2CL2A 4PF5A 3RRDA 4Q26A 4XHXA 5E88A 3ILFA 1LEDA 3ZPYA 2A70A 4GXLA 1W6PB 3VUOA 2EIGA 3M3EA 3SH4A 1BZWA 4U2AA 1CPMA 4GALA 1SCSA 5EXOA 4XTMA 1RITA 3IKWA 5T54A 2DVAA 2EALA 3B9CA 1ULFA 1VAMA 4C1XA 1S0BA 3WG1A 1H9WA 4FP2A 1CR7A 2UWAA 3ZXKA 4XJAA 1DZQA 1FV2A 3IPVA 4YZ3A 5GLZA 3O5SA 4NO4A 3T1MA 3UL2A 3IM0A 2A6WA 2CYFA 4P14A 4YM0A 2R0FA 2A6YA 2GMPA 3SLIA 4Y1YA 4CZSA 3N36A 1IS3A 2A5ZA 5JLVA 3B00A 3ILRA 3M3QA 1OQ1A 1SBEA 4C1WA 1NLSA 3NV4A 2ZHNA 3PVOA 5DZFA 5DG1A 2DU0A 1WW4A 4OZXA 1QDCA 5F9TA 1R1ZA 1CPNA 1HQLA 1UL9A 1SLTA 1OKQA 1UKGA 4Y22A 3VKMA 1WLWA 2ENRA 2ZHLA 3OBTA 4FP3A 4XMIA 1MVQA 1Q8QA 4FPYA 5L73A 1F31A 4D69A 2A6XA 1TEIA 2D44A 1LOGA 5T5JA 4H55A 4JRAA 1Q8VA 2R16A 3DUIA 2EAKA 5KXEA 1I1EA 3N7MA 3WDUA 4AVVA 5DUVA 3WOGA 2D3PA 4AVSA 1MS0A 1YI7A 2C5DA 1GICA 3AP6A 1QDOA 4Q1RA 4U36A 5IK7A 3VKFC 3FFZA 3AYEA 3V0AB 1MZ5A 4DRRA 1QOSA 4AWDA 1F9KA 1AX2A 3ASIA 4I30A 2ZA9A 4XJ8A 5T5OA 4YFZA 5JOZA 2P2KA 3AP5A 1JYCA 3BIWE 1YIFA 1AF9A 4XIKA 2D3SA 2YMZA 4XIOA 2P3KA 2ZGUA 5HCBA 4XHBA 2Q5TA 3USUB 4NOTA 2JDZA 3WDXA 5IK8A 4XXPA 5CAZA 2W39A 2GMEA 4BQ1A 4Y1ZA 2I2SA 1ZA4A 1ZM1A 1DQ0A 2JECA 2CWMA 3B3QE 3OJBA 1LECA 4K1YA 3WG4A 2AR6A 1LCLA 3R4UA 2PHTA 1N3QA 4Y20A 3R4SA 1KQRA 1CJPA 1GV9A 2NMOA 4YG3A 3A0KA 1DQ1A 2OVUA 2GDFA 4Q8LA 2E51A 3GNEA 1J1TA 1U0AA 1URXA 4PBOA 5JMCA 1KJLA 1ENRA 3IMNA 5DG2A 1QNWA 3WV6A 1BXHA 2CNAA 4LBLA 3FUOA 2UWBA 5H9PA 4XJUA 4YGBA 2LTNA 1AX0A 3HR9A 1SACA 4FVVA 3I4IA 2ZMLA 2CWSA 2JD4A 4Q27A 2A6ZA 1GYKA 2ZMNA 1SLAA 1W6PA 3MW3A 2ZGLA 2ZGSA 3RQ0A 5HCFA 1NXD1 1WW5A 4BOWA 1G9AA 1DQ6A 1GZWB 1WBLA 1CN1A 1W6MB 2GNMA 2PELA 1A3KA 1GANA 5FRAA 4XDQA 1W6OB 1W6QB 4FOVA 3BOPA 2A6VA 2JE9A 1S0EA 2DUPA 2CY6A 4GWNA 1QMJA 1CVNA 5GZGA 2ZBJA 2ZGNA 4DRVA 1SCRA 1DGLA 1KITA 5DZGA 4UW3A 1CESA 4YW5A 5LK5A 4P9WA 2YZ4A 1H9PA 1JUIA 4XXAA 3WNXA 4Y1VA 4R9CA 2PHXA 2V73A 2PHRA 3ZSMA 1LGNA 4YW1A 2DU1A 3MW2A 5GLWA 2VW0A 2EXJA 4YG0A 3MEPA 3INAA 2PHFA 5T55A 4FOQA 1G9FA 2FMDA 4GKXA 1SBDA 2AUYA 3BODA 2JKBA 1LU1A 4Q8KA 3WUCA 1V6NA 3WUDA 3QLQA 3V0AA 3AJZA 4YG6A 2ZMKA 5KXBA 1AXYA 4AGVA 4Z8BA 2ZABA 2W08A 2EXIA 4XJ9A 4DPNA 1G9DA 3CNAA 1WCSA 5GALA 2P3JA 2R1BA 4Y24A 2SBAA 3UJQA 1SLIA 1FNYA 2ZZJA 2D7FA 4FQ4A 1F5FA 3USUA 3QCWA 1BJQA 2GNTA 3C2UA 3HN1A 1LHUA 4GA9A 3W59A 2AH2A 1C1FA 1YYNA 4CRQA 3D6EA 2B7YA 1V6KA 1HQWA 3B01A 4YLZA 1S0GA 3D4KA 4WVVA 1LOEA 3NV3A 4BPZA 3WDYA 1N1VA 1Q8SA 3VV1A 1G86A 3M3CA 2OUJA 4BLJA 2ARXA 1LHOA 2DV9A 3FLTA 1VLNA 1BQPA 1V6IA 1G9BA 1EPWA 2VY0A 4Q2FA 2P3IA 3T1LA 2WT1A 5T52A 4FOYA 2E7TA 4GWMA 4XYXA 1ONAA 1QOTA 1SLBA 1GZCA 3WLUA 2DVGA 3LCPA 1LOBA 5EYYA 3MW4A 2NZ9A 3FLRA 5IK5A 2AENA 3OGGA 4FPGA 3SH5A 2E6VA 4YW4A 5CBLA 4DFSA 1RINA 1A78A 3WDWA 2NMNA 1LHNA 4XJWA 2PHWA 2XB6C 1DBNA 3LSEA 1N3OA 1DFQA 1V00A 2OW4A
chains in the Genus database with same CATH superfamily
4C0HA 5C3OA 1RC6A 2Q0AA 4DEQA 2XWJB 1HQNA 3KV4A 3Q9OA 4FI9A 1E57A 1W6OA 1MS1A 1C5HA 1XNDA 1V6OA 2Y6FA 4YM1A 4ITCA 1MEC3 2G4IA 5DDJ2 1DG6A 2DFBA 3I3MA 4QHBA 4IXLA 3WINE 3E1F1 1NQDA 1PO11 2WLQA 4UFMA 4E2QA 1VIWB 4QGNA 1U12A 1AJKA 4OUMA 1CZTA 4Q4Y2 3H42B 3KVBA 1ULOA 4MG2A 5SV8A 3IWZA 2DF7A 2QZ3A 3WDVA 2XMLA 1WLDA 2RDQA 4QM8A 2ET1A 2HBTA 1PM4A 5FZ3A 4XUNA 3WNPA 1XQNA 4RGKA 2J1AA 1SDDB 5I0UA 2JDKA 2CGPA 1AR72 1RXFA 4XZPA 2B9UA 2ZX2A 3ABZA 2MEV1 2GAUA 5C9AA 2Y6HA 1GZTA 3FL7A 3NMBA 1DU3D 1H2NA 1NCQC 1Z7S1 5BPXA 1OURA 5A1FA 4XJZA 1N1YA 4MV2A 5ABJA 2NP0A 3AP7A 3AKTA 3H3LA 4I0WB 4LBOA 4PCRA 4EWAA 2HEWF 5B4XA 1O3SA 1XBFA 4JZRA 4OQ9A 1AYN1 2D6KA 1JZ7A 3MZHA 4QKBA 3A0NA 2ZKNA 3VB9A 1YIPA 1IPJA 4GWIA 4WM7B 1S55A 1LULA 2VMEA 4D7TA 2FCVA 4GQ7A 5FP9A 4ZKTB 3AYDA 1TNRA 2YROA 4Q4V1 1UXXX 4QX3A 1QHDA 2AEZA 2IFRA 3ACFA 4WM7C 2R072 4URTA 4AHYA 1BKZA 4A7KA 3KB5A 1UKRA 2W1WA 3DCQA 3WW4A 2Q30A 1VPHA 5FXXA 2WNOA 4LNVA 3JU9A 5FLJA 4M3CB 1IG0A 4SLIA 4CP9B 4COZA 1O8SA 2A71A 4RA0A 3ZSEA 3NNMA 3N7JA 2ILMA 4ASMB 4Z1VA 5ACA1 2YV8A 1ZBE1 3TN93 1ZRDA 1W8WA 3NJYA 3ST7A 4ISRA 4LQRA 1DLLA 1RUF3 2VZVA 4I3PA 1OBNA 3U1XA 1T6BX 3BKZA 1SHWB 1YEWA 4LORA 2B39A 2XR4A 3LOBA 4AW7A 5A3LA 1PMHX 1RUD3 1SBFA 1F4HA 2ZAAA 4FPEA 3EQEA 3PTYA 4IQPA 5JVVA 5J09A 1TG7A 3AKSA 4LITA 1UQXA 3ZXLA 3OBRA 4A7ZA 2ZGQA 1RUC2 1V6MA 2C24A 4INDA 2XPJA 2GMMA 3GHNA 3U37A 2VXRA 3HNYM 3FUQA 2WYFA 3LQCA 3MLLA 4QX7A 4Y5SA 4YVWA 5FUIA 1W9SA 4KBBA 1S0DA 4EQVA 4ARYA 1MS8A 1LU2A 1UN1A 2ORXA 2ADDA 1JN2P 2Z5WA 4N7UA 2DVFA 1YUDA 3ZO0B 4LBQB 4QU2A 3PLQA 1H8TB 1UAIA 3O1VA 2B46X 4PI2A 4UAPA 5T5LA 1S4CA 2KD7A 4HONA 3NKGA 4UFKA 4C90A 3OY8B 2P6HA 4Q4X1 3V0BB 3MLJA 2W92A 4FSJA 4DOUA 1FNZA 3E6CC 1NZIA 1EV11 2VO5A 3POSA 1Q3EA 1H8TC 3ECQA 1MACA 4CP0A 2WINB 3V56A 4TZDA 5J1XA 3ZR5A 2GNDA 3J7LA 5DDJ3 2C9AA 2W1SA 2VUAA 2VXJA 3N3HA 4AZZA 1V6JA 2V09A 5DQ0A 5FDBA 5L9VA 3PHMA 3AZXA 2ZGMA 3IDAA 2WT2A 2VMCA 1YFUA 5CFCA 3OYWB 2Q1MA 1UMIA 4Q4Y3 5LRSA 1GKBA 1W8FA 1WMEA 1SFYA 3KSCA 4X6QB 3T4HB 1Z0HA 2DVDA 4PJYA 3IDEA 1GLHA 3WP5A 4O65A 3PMEA 3PUSA 2ZTNA 1QOOA 2VM9A 1L7LA 5KXDA 5LW9A 1QGLA 3IN9A 4LHKA 4QDRA 4V1PA 1AYM1 1E5RA 3BB6A 1AR73 3NJXA 4MX3A 1UZYA 4E9KA 4YNIA 5F2WA 2QCSB 1ZREA 3THTA 4NPMA 2D6OX 4QQPA 5K0UA 3ES4A 4H2AA 5FYBA 4CXYA 4JQRA 2J1UA 4NWVA 1PZ9A 3T2QA 3P6BA 2O1QA 3I2IA 4DQAA 3OEAA 4N53C 2FDFA 1GWLA 3GCWA 2JD9A 3EXUA 2GP3A 2VZ3A 1YXWA 5E6HA 3A21A 3BTYA 5CFDB 1MZ6A 1QJU2 4MXVA 1OI6A 3NWKA 2ZCWA 3GJBA 2BNNA 4S2FA 3LKJA 2Z2SB 2P34A 5CFDC 5FZKA 4KG8A 4Q4W2 4FQZA 3T2TA 1GQHA 2WO1A 2XJRA 3WG3A 2ORZA 1LGBA 4AI2A 3FMGA 2QE3A 4QDSA 3T0BA 3U10A 4YM3A 2R073 5FPUA 2PAMA 3ZKUA 1QNYA 3LSDA 5GZFA 1GWMA 1MEC1 4F3JA 4UT5A 3P3NA 1LOAA 3PUAA 2G9GA 4AG4A 3VZKA 2A73B 4COVA 4UFJA 4CEYB 2DUQA 1AVBA 2VU9A 1Y4WA 1LHWA 3P3PA 1CD3G 3NQHA 5EYXA 1C1LA 1WCKA 1MQTA 5GLVA 2HEYF 4LO4B 4P00B 1I3HA 5FBZA 4ZY9A 3VKNA 4IEOA 3N9QA 3I8TA 3VBRA 2Y34A 2O8QA 5JUVA 3O1RA 4JHTA 4TYSA 1Y3TA 2ZGPA 3ZSJA 4IE5A 3CJIC 1QH7A 1OD3A 2ZEWA 4KWLA 3G7DA 1LHVA 4IE7A 4HXCA 4Y26A 2WQZC 1W8UA 4YSFA 1GNYA 1UPSA 2EXHA 1JHNA 4QKDA 3ZMNA 2VD7A 2Q1ZB 1GOGA 5CISA 2D6NA 1IZ3A 1P8JA 5DUXA 2Q1FA 5FP4A 1RUC3 1S2EA 4P9JA 1OT5A 1QU0A 1CWPA 3A4UA 3LOIA 2J1TA 4S2GA 1YLLA 4DS0A 5A3PA 3CQOA 1L7RA 4K21A 5C5TA 3H1MA 4QQ2A 3WEZA 5F5CA 2VW1A 4TTGA 1H1IA 2ARAA 1W03A 2NYYA 2I45A 5K7PA 4YVSA 5ANQA 5F39A 4EYUA 4MGQA 4O7XA 1A34A 1WWYA 4CEWC 2Y6JA 1T2XA 4RQPB 3ZFGA 3ZPYA 2F4PA 1BVP1 3LE0A 3W5NA 2YPDA 1CPMA 2ZZQA 4NMIA 4XTMA 5FY1A 2PLV2 5FZ8A 3IKWA 5T54A 5CKNA 2DVAA 2W2IA 4GJZA 3VD5A 4RQPC 1PGW1 1WCQA 2HWC2 1PNFA 2C26A 2IVJA 3MHZA 1SG3A 1ULFA 5DN2A 5F6KA 3OD4A 1VAMA 5BV6A 2EICA 4HK8A 1X82A 3C8XA 3TN91 3O14A 2FCTA 3AFGA 1XSQA 1UZWA 1CAXA 1RUF1 1FV2A 1COV2 5A3UA 4BQ2A 3J7NA 1NXMA 2CSGA 3H7YA 3OBZA 3T1MA 3UL2A 4BE3A 4AHZA 4BXFA 2OQ7A 4KQ7A 4WM8A 2A6YA 2VTXJ 4KMQA 3SLIA 3T0AA 4W6XA 2A5ZA 3GYDA 4Z2WA 1I5PA 1RUD1 3ILRA 2WO3A 1SBEA 2MNGA 4C1WA 3NV4A 1XOYA 2W95A 5KC6A 4OHXA 1NCRA 2DU0A 4OZXA 4BCUA 1L3JA 5F3GA 4GH4A 1GFF2 5J3UA 4NR1A 2ADEA 1UKGA 3ZFFC 4Y22A 2C1FA 2ENRA 3LIHA 1ZRRA 3TEYA 1NLQA 2YYOA 1YFWA 1OOPA 1VRH2 4A6SA 2D44A 2PHDA 1UU4A 2IXHA 3J4UH 3GXUA 2QQLA 1Q8VA 4JRAA 1AR61 5IJRA 1I1EA 1QJU3 5IVJA 5DUVA 3KZ4C 3HNBM 2C5DA 2OT7A 2O8OA 1QDOA 3MF6A 3SCFA 1VRBA 3OGVA 4U36A 5IK7A 1K5JA 1VB4A 2JDUA 4Q4W3 4AWDA 1ST8A 1RTVA 3I3QA 4BQXA 1AX2A 3DECA 3ASIA 3FHQA 1CZVA 1R64A 1Y43B 4D94A 4AXOA 1JYCA 3S30A 3BIWE 2VNOA 2X10A 5DDJ1 4IW3A 2P3KA 2DFCA 4XHBA 2Q5TA 3SCGA 3WQBA 4NOTA 2WAAA 4BQ5A 4NIHA 1DCSA 1TZOA 5FY9A 5B2GB 2F4LA 5JI9A 2BTVC 2W39A 4BYYA 2GMEA 4Q4Y1 5CAZA 1VBA2 2I2SA 2YC4A 1DQ0A 1HB2A 2JECA 2WR9A 3OJBA 4K1YA 2AR6A 3KT1A 1FPN2 2P5BA 3WQ0A 5JXGA 4I01A 4AOCA 3ORJA 1K42A 1QJX2 2OVUA 1AR71 3GNEA 2RV9A 4K6BA 3QACA 4PF1A 1KJLA 5JMCA 5D21A 5DG2A 5FOJB 4JKLA 4KI5M 2CNAA 5BNOA 2WA4A 1JZ2A 5AFBA 5TSWA 3MV11 5H9PA 3OB8A 3JQWA 4XJUA 3LGRA 1DYOA 2TBVA 1XNTA 4LUKA 3LA3A 5C5UA 1SACA 3OCPA 5M0TA 4BQYA 3B7MA 1F15A 4Q27A 5A80A 1ZZ7A 3FZ3A 1GYKA 3WNMA 3SEPA 4OCTA 1Y9GA 3RQ0A 2PA7A 3SXWA 4Z2AA 1WW5A 4M0HA 4BOWA 1C5IA 1DQ6A 1RJ8A 1AR91 4BQ4A 2GNMA 1F2NA 1GANA 5FRAA 4XDQA 1W6OB 3BOPA 2Q8OA 4EWDA 1H8VA 1FT9A 4Q29A 3PUQA 5IWFA 4LULA 1GUIA 1QMJA 1OUXA 1SDWA 5HXVA 3VHRA 2R071 1SCRA 1DGLA 1RUNA 1O7FA 1GWKA 3HN3A 2AZ5A 2PLV3 2Z79A 5D8AA 5LK5A 1F5JA 3BPSA 4XF3A 4OHZA 3AMMA 4CXXA 5IVCA 1JUIA 3U14A 1QY4A 4XXAA 2HWC3 2VMGA 5E1RA 4QKNA 4Y1VA 4LHNA 1JTZX 2PHXA 4GMP0 4X8NA 3VDBA 2PHRA 4AI9A 2XLFA 4B7KA 3M4FA 5IVYA 1COV3 3MEPA 3BI3A 1UIJA 3INAA 2JG9A 4HK9A 5KR7A 5C9AB 2JDAA 3RWKX 4IUGA 2LRPA 4EROA 4JGYB 5C3QA 1EYBA 2ZEYA 1V6NA 4YW6A 4BK5A 5A32A 3C7GA 5C9AC 5ABJB 5FY0A 5LBBA 4A2UA 2QVSB 3AJZA 1OH3A 2V5DA 1RUC1 5KXBA 1AXYA 1O3QA 2W08A 2EXIA 3MGUA 2A1XA 4XJ9A 4DPNA 5FZ4A 3CNAA 2YGLA 3RNSA 5ABJC 1VRH3 1J58A 2JE8A 2R1BA 2VNGA 4Y24A 5FXVA 3UJQA 1SLIA 1FNYA 3DPRA 2GNTA 4LHSA 5FYCA 1JYNA 3FFQA 1LHUA 4GA9A 2AH2A 2VCBA 4DEVA 1YYNA 2F6BA 3WNLA 3WX5A 1ZNPA 1V6KA 3B01A 1QWRA 5HPOA 1NA1C 3I49A 2Z69A 4LPLA 1JU3A 1NLRA 1S0GA 4YLZA 4AFDA 4MGKE 5J37A 2HKXA 1YQ5A 4BPZA 2VUDA 5LY1A 1N1VA 1Q8SA 3ITQA 3KVAA 1JZ3A 3M3CA 2BUKA 2IXKA 3I3DA 3FLTA 4UBHA 5KHHA 4ASLA 4KGGA 1X33A 3ZXDA 5T52A 4FOYA 1XU1A 2EIBA 5FYSA 4GWMA 3WP6A 1HV0A 4XYXA 4CEYA 1VBA3 1JYXA 2AACA 5A3NA 3TEWA 3WLUA 4XFBA 5JSRA 2NZ9A 4UFLA 1FPN3 3Q8EA 5FZ6A 3ETPA 4CU7A 5CBLA 4DFSA 4F8AA 3OUIA 4XJWA 2W1QA 2XL7A 1QJX3 1W2TA 2XB6C 3MDPA 2YFZA 5FZ9A 4K1ZA 1V00A 2RHPA 3POEA 4A44A 4GKYA 2Q8CA 5JOYA 1GZWA 3KV6A 4L99A 3E5UA 4DUWA 4F83A 1EUUA 3POWA 4YVWB 3BUCA 4RGAA 3CKHA 3MIBA 5C4WA 3WNKA 1N47A 5FZOA 4HSLA 1GR3A 2R30A 5JPMB 1XYOA 5JAXA 1QJFA 3HAGA 4LBKA 5H9QA 4YVWC 3SNMA 3ZYRA 3PJQA 2ETEA 5I93A 1QJU1 2NM1A 4EZ4A 3POFA 1AXKA 1YJLA 3CF6E 4JTOA 4YGCA 5DUWA 1OXCA 1XJAA 3O1UA 1EY2A 4LTAA 1IS4A 4Q4W1 2RDSA 4BM8A 4YZ2A 1Q56A 5AVPA 2E7QA 1OLQA 3HWJA 3WF1A 4MVTA 4N8MA 2HBUA 3GJAA 2FZ1A 2JDHA 4CCLA 1O4TA 2GZWA 1OMIA 1RHI2 5CFCB 1OPOA 2CDOA 2QQUA 3BU7A 4CU9A 2ZHKA 3BVCA 1Q5OA 3OTFA 1X8EA 1JOJA 3Q8AA 5FPZA 4BK4A 4AQTA 2H0VA 5CFCC 5CKMA 3FBYA 3VBFA 1UX6A 3OF1A 1AX1A 1KRIA 3LEGA 1Z78A 2ES3A 5A33A 2XBO2 5GM0A 1JYIA 4D3WA 2Y8KA 2DBIA 4D7YA 2XJSA 4M4RA 2FDHA 1IQAA 3KM5A 3ETQA 5BNNA 5K0UB 4ZONA 1IS5A 1X9TA 4GMP3 2WZPP 5C8WA 4P08A 5KHKA 5HCHA 1YO8A 2TNFA 2WSUA 4N43A 3NAPA 4XBNA 5BUVA 3AYCA 1OQDA 3W9AA 1SQ4A 3VZNA 5L9RA 3FLPA 5JXIA 2HWD1 1H1AA 3I2HA 3J7HA 3NJVA 1J3PA 1W3VA 3ZN6A 2IXIA 4B3NA 2VG9A 3ZLIA 4AQ2A 2QQIA 3RZLA 3JB4C 3SC7X 3WD5A 2YDEA 4IGOA 4J1XA 5HCAA 5D1IA 4FAHA 1MS3A 1WKYA 2W52A 2FMYA 2VBBA 4Q1PA 3NSTA 3C7EA 1APNA 3ZXJA 1M06G 2X29A 3UKNA 4BA6A 2ZX0A 4UW5A 4QX2A 4FXGB 1D0HA 2RS52 2JJ6A 4R9AA 2ZGRA 1WW6A 3EMRA 4AI3A 3BTXA 2VW2A 5C71A 3VD4A 2PLV1 1MQTB 3VBOA 4LKDA 3POJA 2PHUA 5A3WA 5A6QA 5C6CA 2HWC1 3HJRA 1WD3A 4LKEA 1STMA 3UKTA 5CA6A 4P9LA 3VBRB 5LA2A 5GLUA 1C4RA 3ZIWA 3M3IA 2XKPA 2XVGA 3AZZA 1DFQA 2DWRA 3TB0A 3T08A 4A6OA 5FZLA 1COV1 2Z42A 5FY7A 1O4ZA 3KQRA 4XQ4A 1ULGA 3VBRC 5LA9A 4YRDA 5IFTA 2A75A 4YM2A 1TQ5A 3DXTA 4NHLA 5DZEA 3AMPA 2VPVA 4HZFA 3S7EA 2P37A 4CCJA 1R1A2 4A7YA 1QKQA 4AYUA 2J1EA 3PTRB 4Q0VA 1CGPA 4EN0A 3GBWA 4QQLA 2RMU1 2VCMA 3HQRA 1J3QA 2FHRA 3PVEA 5FPBA 5EV7A 1HXS2 2K46A 2D6PA 4MZUA 5I8YA 1VRH1 3DYMA 2ZHMA 2PFWA 1LESA 4P5HA 4YVSB 1QXJA 5KXCA 1WD4A 4XOGA 5GZDA 4AFMA 1O8PA 3ZN5A 5FY5A 1N3PA 1MS5A 3D0SA 3ZFGB 4M3CE 1PMJX 2W9XA 4YVSC 3AP4A 5H9RA 5FZBA 1JOPA 4TWTA 1W9FA 5ANNA 4SBVA 1Y7BA 1MS4A 1AL21 2YC0A 2WNEA 3N35A 4LKSA 4YW2A 1GNZA 1H2KA 3RG0A 3OOXA 3RMYA 3ZFGC 3CZJA 4GWJA 2XG3A 5AVAA 5IHRA 1RHI3 4NHMA 3RZGA 1GZ9A 5IVEA 1A6CA 2FZ2A 1DF0A 1RIRA 1CAXB 3KF3A 3THDA 1D4M2 4HSJA 5CIRA 4XDOA 2J1RA 1VBA1 1LGCA 1KDKA 4WM8B 4QB6A 1CAVA 2RVAA 3H3ZA 1VBC2 1ZRCA 2VMFA 2XBO3 1KFUL 2ZOEB 2R7EB 2YGMA 1NQJA 3EO6A 1FPN1 2BNOA 4QX8A 4QX0A 3VDCA 1NCRB 4CUBA 4M3CF 4FAGA 5FFOC 4I02A 1UO9A 4GH4B 4WM8C 1QJX1 1FXZA 4K9SA 5LRRA 2HWF2 5IVVA 2W68A 2XHNA 4Y22B 5BY5A 2Y26A 3ZYGA 3S0MA 1S0CA 2WFF2 2GN3A 1NCRC 4JGYA 2VOTA 1AZDA 1LOCA 1HJFA 1OOPB 3AL5A 4Y1XA 4GH4C 3FC0A 4PIYA 5EPAA 2QBXA 3DYOA 2A3WA 4FT8A 5DPNA 2P17A 4ATFA 2VUJA 5IVFA 1I5ZA 1QJEA 4BHPA 4JC1A 4AEDA 3LAGA 3AB0A 5GJ6A 1OLME 4LR4A 1VALA 1OOPC 2B45X 4Q0SA 2PQSA 1W90A 1YQ8A 3I54A 3VN4A 2RM22 2TUNA 4LIUA 5FR3A 2G19A 2ZX4A 1S2BA 4DUXA 1DIWA 5JXJA 3DGTA 3W58A 2GC2A 5JOWA 3RJRA 4ATEA 1POV0 5JWPA 5A1AA 1QIQA 3O12A 5FZCA 5FPVA 1JZ5A 2R6QA 1VJ2A 2BZDA 3HMYA 2WJSA 2RS53 1PHMA 5FY8A 4WVMA 4NRQA 3E5QA 3JQXA 4IEWA 1AJOA 1YNAA 1D2SA 1FAYA 1DHKB 2IC1A 4FXKB 4NHYA 3NJZA 5EP9A 5FIXA 4S2DA 3M2MA 1WMXA 2GALA 2LW8A 2VZSA 1RVF2 2XXZA 3I3BA 1ND3A 1LEMA 1V9U2 5F2SA 1KJRA 3EYPA 4JRLA 4OMCA 2VGDA 3L2YA 3SISA 3ZYPA 3N9PA 5C7GA 2Y6GA 3AZYA 3POGA 1PX3A 3RSJA 5IUQA 4FFHA 1XE7A 1XSRA 2JIJA 2VZUA 4MHRA 3T3YA 4P9XA 1CIYA 1JZ4A 1NYWA 5LB6A 5LY2A 3G6JB 5BNOB 3IMMA 4QPWA 1DGWX 4QMAA 1R1A3 2DCJA 2QJVA 2HH9A 4PF5A 3RRDA 1DP0A 2X53S 1PIV2 2JDYA 2ZX3A 1LEDA 2J1VA 3ALQA 4QX5A 4OI0A 4B8EA 5JZGA 3M3EA 3DV8A 3LDBA 1BZWA 4U2AA 2ZJCA 3EJKA 4GB32 1HXS3 2WWSA 5JR7B 4M0NA 2WS92 3RZJA 4Q0PA 5FZGA 4NRMA 1UF2C 4AVCA 5K4LA 3KS7A 3ZXKA 4XJAA 1DZQA 1RYYA 2XLGA 2D93A 3IPVA 5GLZA 3S7IA 3O5SA 2BERA 2VE1A 5FPXA 2A6WA 5A3MA 1HV1A 2QQOA 4JGZA 4YM0A 5F3CA 5D8AB 3KF5A 4JDOA 4CZSA 3ZYJB 1QJZA 5JLVA 1UCXA 1EPZA 3M3QA 1HX6A 2JENA 1OQ1A 1NLSA 4QGMA 4D6QA 5DG1A 1WW4A 4KG0A 3RI8A 5F9TA 4QPGA 5D8AC 4UFHA 1XPWA 2GC3A 1NE6A 1OKQA 1ZRIA 1D4M3 1OA3A 3VKMA 2JG9B 3U07A 4XMIA 1MVQA 4NE9A 3MIHA 2W0XA 3I2DA 1QXPA 1OHFA 1LOGA 1DLCA 1H0BA 1VBC3 4MOAA 3DUIA 3VHNA 2EAKA 2CAVA 4QM9A 2Y38A 2JG9C 3WDUA 4AVVA 3WOGA 2D3PA 4UWDA 4P5YA 2FDJA 3AP6A 5A32B 5C8CA 1BEV2 1TVGA 2VCAA 4JHZA 1LKNA 3AYEA 3FWEA 2HWF3 1QOSA 3GM8A 2WFF3 2CAUA 4YYOA 2RR12 5JPNB 4IEZA 2XOMA 3DPRB 4J1WA 1NY72 5DMYA 1SZBA 2Y64A 3SEEA 5I0SA 2ZGUA 5HCBA 2VTFA 1W9TA 4QWNA 3DEMA 4Z07A 3QH6A 3ROUA 2QTWB 3DPRC 1XNAA 4LE3A 4XXPA 2RM23 4DY3A 2XLAA 3GZAA 4JKMA 4G3YC 2P3YA 3B3QE 3T0DA 2WN3A 1LECA 1LCLA 2PHTA 4Y20A 3CMGA 1KQRA 1I6XA 2NMOA 1OVSA 3AM2A 2VBDA 3LEIA 5A7WA 5LEJA 4UF0A 1W3XA 1DQ1A 3B9IA 1RHI1 1E5HA 1U0AA 1PVC2 1URXA 4HT1T 4PBOA 3J26N 3IMNA 4Y5Z0 1QNWA 3WV6A 2C6SA 2OA2A 4KNCA 4LBLA 3FUOA 1RVF3 5F3EA 2BGCA 1V9U3 5FJKA 4YGBA 1O3TA 1AX0A 3HR9A 5A7NA 3RJ2X 5I8TA 4FVVA 2BP6A 2ZMLA 3FE5A 2DBNA 4CEYC 2A6ZA 4ZU7A 3MW3A 1W6PA 2JDMA 1YI9A 4P02B 1Y9QA 2ZGSA 5HCFA 4CCDA 3RVHA 2XBO1 3BTZA 1G9AA 3J9SA 1GZWB 2E63A 2BWCA 1WBLA 3J7MA 3RGBA 2J7MA 5C4WB 3U0ZA 2WNUA 4ZPIA 3WP3A 2B5HA 2YU2A 2A6VA 2JE9A 1S0EA 2R062 2XJTA 5FZOB 1RUG2 2P1BA 2XONA 2BRTA 1PIV3 2WUHA 5LK7B 1JHJA 4LK6A 2ZGNA 4ZXEA 3O1MA 3TEZA 1ND2A 3ELNA 5C4WC 3MUZ1 4IE6A 2PAKA 5FXZA 4GB33 4P9WA 2YZ4A 1H9PA 2VVDA 1CZSA 5F7UA 1VAKA 2WS93 4FO9A 3H8RA 5AC92 3JCIA 4R9CA 1BBT2 2J42A 4BH9A 3ZSMA 1HJGA 2WNVA 1QJY2 1XYPA 1TMF2 4CUAA 3MW2A 5GLWA 1UIKA 5G04L 2PHLA 3WW1A 2EIDA 4YG0A 2K2SA 3UV9A 5FZMA 1WMFA 3J8F2 1YQ6A 4GJYA 2HWE2 5C3PA 1G9FA 1YWKA 1SBDA 2AUYA 4GKXA 4XAAA 2RS51 5FYVA 3W21A 4AR2A 3IZOA 4CPBA 3NL1A 4AI8A 3TNQA 1AL0G 3TNPB 1J1LA 3WR0A 2FD8A 3GBFA 2OIIA 3KV5A 1CAWB 3BPZA 3WUDA 3VBFB 3IIAA 4FCAA 4XFAA 3BALA 3V0AA 3FX3A 3C7HA 3I2FA 1K3IA 1F35A 4XAEA 4ORFA 5IATA 2IVIB 3H9AA 3B93A 4AE2A 5A33B 3NNFA 4LT5A 1VMJA 4DZGA 1G9DA 5FK7A 4BZ4A 1ULPA 3SMHA 1WCSA 3VBFC 3VL9A 2IXJA 3KWVA 4FFIA 5I0TA 5F1RA 3NNJA 2D7FA 5BNNB 4TN7A 2QQNA 1BJQA 3USUA 3HN1A 1W99A 2J1SA 4QPIA 4QB2A 1SPPA 1HB3A 1BEV3 4UBGA 4N43B 1C1FA 3LPFA 4CRQA 2UYBA 3D6EA 3NAPB 1R1A1 2B7YA 2BNMA 3N4MA 1HQWA 3AKQA 5BNNC 3NO8A 1K5MA 2XQXA 4H14A 2XH6A 3FBMA 4RSUA 4Y33A 3D4KA 3K48A 3ZN6B 2RR13 4AEKA 4NRPA 4O61A 5C3SA 4N43C 1X9PA 4IV3A 2YU1A 2VECA 3NAPC 3ZFEA 1G86A 1WGPA 3LDKA 1RB8G 2OUJA 4OMDA 3DN7A 5HV4A 4BLJA 3CLPA 1HXS1 1US3A 4XFGA 1KFXL 2HWB2 1R092 5EJZB 2CGNA 4Q2FA 5FO7B 4L97A 3CL1A 3GGLA 4B4QA 1ONAA 3LA2A 3EHKA 1ENXA 3OGSA 3Q8BA 5LASA 3QD6A 4RS5A 5EYYA 2L9LA 4MHUA 1NCQA 1U5YA 4E8CA 2BGOA 2E6VA 4I2OA 2YBPA 1RINA 1A78A 1RXGA 2NMNA 3VBOB 4IESA 1VR3A 2PHWA 1N3OA 3AJYA 4S2HA 1PVC3 1H4GA 2ZEXA 2O14A 2RJLA 4QXKA 4CDXA 1W6MA 3VBOC 3VBUA 2XVKA 3LDRA 2BU9A 1W6QA 1D4M1 3E6BA 3O0XA 4OI4A 3WHTA 4PHZA 2E31A 2VQ0A 4PQQA 1PZ8A 2JB4A 4XQWA 1W2OA 4AK3A 1GBGA 2XVLA 1FMD2 3KQ4B 2WABA 4K3UA 1O3RA 3WG2A 2YUEA 2X05A 2DURA 5IVBA 4HKLA 3CEWA 3DXUA 2UYAA 4LBNA 1UYZA 2HWF1 1DYPA 1O5LA 4XZUG 2UU8A 2R063 1B09A 5L19A 1DQ2A 1RUG3 2WFF1 2JKXA 1E5IA 3VKOA 3WVJA 4XF1A 4WV8A 5FMOS 2D6MA 3ACHA 4H3WA 1ZZ9A 3AFKA 5J7MA 1JYWA 3LD8A 5FP7A 5HI0A 3OPZA 2UY9A 1C28A 4MGZE 2W94A 5A7OA 4HKWA 4IEPA 2GN7A 3ZSKA 5AC93 3ZXEA 1BBT3 3MICA 4A3XA 4BQ3A 2RM21 5T50A 1QJY3 4NJ4A 1TMF3 2VL4A 1PM7A 3EB7A 3FN9A 4C91A 1RUH2 4E4HA 4XW3A 5EIYB 3B69A 1H30A 2H6CA 3AZWA 3J8F3 3PDQA 2HWE3 4JAAA 1KD7A 3VBSA 4AVBA 1NX9A 5FO8B 4QHZA 1PVXA 3WCRA 4W50A 4IE0A 2KA3A 1WLCA 3T09A 4CSWA 3UJOA 5F5IA 1FATA 3H3UA 2QFEA 1NOVA 2VBPA 1O6UA 1OA4A 4N9HA 5EZWA 4IE4A 2FQPA 1PGL2 1CAVB 1RVF1 1V9U1 3ZX7A 3LEKA 1VAVA 1OUSA 3ATGA 2JDNA 3S6PA 3P5BA 4PQ9A 3FHAA 1WMDA 1XC6A 1NAEA 3Q8CA 5EHDA 1S0FA 1D7PM 1N1TA 1OQEA 4LBMA 2E32A 1W0OA 1G8WA 4FPHA 3AKRA 1DDLA 4QU1A 3N7LA 4PBPA 5GLTA 5FP8A 5HV0A 3SITA 1ZZBA 4PLOA 3HBZA 3POYA 4I0AA 4KU8A 3KD4A 1UZZA 5CNAA 4FPOB 2ZGOA 4JGYC 1HDKA 1PIV1 4AEDB 1YQ2A 4BMBA 4R4ZA 3JUUA 2JG8A 5HBAA 4OI2A 4AFAA 2WSVA 2VMIA 2IXLA 5DUUA 3R4DB 4GB31 1YC61 5FCCA 2GC1A 2HWB3 1G6NA 1R093 2LUWA 3ZM8A 5L36A 3IAQA 4UI9L 2ZGTA 3D0JA 3POIA 2XGXA 2WS91 2ZX1A 4IETA 3WZ1A 2QUOA 3CZUA 2Y6LA 5FOBB 4F7ZA 3DYPA 4LO5B 2EXKA 1GP4A 1ULDA 1CIWA 2V72A 2C4XA 2V5YA 2RJ2A 4WVMB 5EJ3A 2ZACA 2J22A 4HG6B 1MZFA 1D4VB 3VD7A 4E4DX 4FTEA 4N53A 3RZHA 4GULA 3CDZB 3AYAA 3LB9A 4L8QA 5CYYA 3OBAA 1ND3B 2LALA 3H1YA 4WVWA 1WCDJ 3ZYBA 1OFSA 1XRUA 4FPJA 1WBFA 3IAPA 1WUVA 4ZU4A 2F17A 3QH7A 4CTEA 1YRZA 1FX5A 2VUCA 4HN0A 2I07B 2V4VA 1ND3C 1BHGA 3BTAA 1HKDA 2ARBA 3MV01 3PUIA 4HANA 5CB7A 1DGRN 4OHVA 1GP5A 3LWCA 4FPFA 5F37A 2K9ZA 3IB3A 5FZ1A 4R9DA 1JOBA 5FUPA 4YFWA 2R0HA 4UW6A 4V2VA 3GF6A 1FMD3 4X6RB 3VKLA 2ARCA 3UGGA 4BISA 4K20A 4ASKA 1BEV1 2BBAA 1ULEA 2G9FA 2B42B 4XFFA 5LBCA 4NN0A 1W6NA 5JZGB 1ACCA 1RMU2 2DTWA 2UURA 3ILNA 4LOTA 4Q0UA 2JE7A 1Y9MA 5JIAA 4FTBA 5L7OA 3T2OA 2RR11 4AGGA 4L11A 2HYKA 1UYXA 2BQPA 3FHIB 1LENA 5BXXA 2VOKA 5FZEA 4XEZA 5IK4A 5JZGC 1NY71 4LA3A 2VQUA 4XFCA 5FKBA 3MBWA 4J6GA 1XNKA 5FYIA 3OUJA 4JV4A 3RDIA 1UOFA 2A7AA 3CJIA 4AEJA 2VH9A 5FY4A 1SEFA 4LBQD 2R1DA 4XF4A 3IPVB 3MI8A 1IS6A 2G9ZA 1X36A 4RGGA 2EA7A 3SKVA 4L2NA 5CG8A 5C3RA 1XE8A 3R05A 4JGZB 2SLIA 3O0WA 2XJPA 4QD2A 5EWSA 5CU1A 3V65A 1WA6X 4M01A 1RUH3 5K8SA 2RJKA 5C33A 1FYUA 1HRI2 2I74A 4QHOA 3I7DA 4XMAA 4LOSA 1MVEA 2BJSA 2BV4A 2VVFA 3AK0A 4CA9A 5JCTA 3H8OA 4JGZC 5APAA 4QPGB 3ZPOA 1KS4A 2AGSA 3JZVA 4MADA 2Q4SA 3OUHA 5I8SA 1YQCA 5IYYA 4R52A 1LOFA 2BGPA 1PVC1 2QKDA 1ZX5A 2JXAA 5A7SA 5FREA 1UU6A 1RUJ2 4LK7A 1J84A 4XBLA 1ASJ2 1W06A 1JXNA 2AREA 4ISQA 1UX7A 4JCKA 4QPGC 1C3HA 2A3XA 3K2OA 1CAWA 1SFNA 2RS12 1W28A 2JEMA 3PURA 4Z92B 3AXEA 3EBRA 4UYBA 1NZCA 1UOGA 3D3AA 4CEWA 5JSPA 2YXSA 5C8CB 1UMHA 4K7JA 2NN8A 2E26A 5GZEA 2XQRA 2YPJA 3O1SA 1DYKA 4CCNA 4CUGA 1ZA7A 1UXZA 4ZS3A 3MFCA 3UGHA 4D6SA 4E8DA 3NVCA 3E5XA 3T4VA 4QKFA 1H1MA 3APBA 2R061 2W3JA 3MLKA 2QNKA 1RUG1 2ERFA 3AMQA 2QQWA 2VMDA 2OPWA 3UYJA 5K0UC 4Y4YA 3K4ZA 4AAPA 4DY5A 2PMWB 2VZQA 5ERLA 2BW8A 4YZ5A 1C57A 3JBG2 5LBEA 4N7IA 4JDMA 3AVSA 4CDWA 2DCZA 2B4KA 3MF9A 1ZZ6A 1ZBA2 1V70A 5FZ0A 3VDDA 5AC91 4IEVA 1BBT1 4COUA 4Y20B 1QJY1 1TMF1 2VZTA 1BVVA 1LODA 1IG3A 1REDA 2P6CA 5A7WB 1ZZCA 4UF0B 1CX4A 4YPJA 4GZ9A 4YGEA 2E53A 5LZ6A 2YB7A 3J8F1 2ET7A 4WZCA 2HWE1 4TLFA 2VCCA 1US2A 2WQ8A 2OQ6A 2VAUA 2ZXQA 2Z4FA 3OG2A 1PK6A 5FMCA 4ZXKA 4CUCA 1XE0A 2FDGA 2CL2A 1HN1A 3S5AA 3LF7A 2WO2A 5G05L 1LAJA 2OZJA 4XHXA 3THPA 5F5AA 4O9EA 1JYTA 2A70A 1W2NA 1W6PB 3VUOA 3SH4A 4RHV2 4UOJA 2Q8EA 5F8PA 3THCA 5EXOA 2HEVF 1TME2 4GALA 1SCSA 1MQTC 5CZKA 3KCYA 3ZDVA 2EALA 1XU2A 4META 4UFIA 5FYZA 4Y5TA 2QDRA 1ALYA 2D40A 2WNUB 4C1XA 1S0BA 1H9WA 4FP2A 1JMUB 1CR7A 3I2OA 2WDBA 4RYDA 2BDRA 3I3EA 4A42A 1U5ZA 1NKGA 3L9JT 5FQ0A 4YZ3A 4CP2A 1ND2B 4NO4A 2WNUC 4AFBA 1RMU3 3IM0A 4NROA 3RYRA 2CYFA 4P14A 3WF2A 2R0FA 3R0RA 4PLMA 3N36A 1IS3A 3DL3A 2H6BA 4LUMA 1NUKA 1OKOA 1NT0A 5FYMA 1DZRA 1ND2C 2ZHNA 3A7QA 3PVOA 4A3ZA 2JDPA 5A6XA 2GSYA 2WNVB 2XWBB 4LE4A 1R1ZA 1R091 2HWB1 5FMDA 2VNRA 4RR3A 1CPNA 1HQLA 1UL9A 2WZ8A 2VMHA 1SLTA 2IFWA 2XJVA 4A45A 2XKOA 1OF3A 2ZKLA 4LKFA 3OBTA 2N7GA 4XCBA 5FUNA 1VBE2 2BOJA 4QQHA 4QT6A 5L73A 1F31A 2RG4A 2WNVC 2A6XA 1TEIA 5FP3A 3ZDSA 4D69A 5T5JA 4H55A 1IGOA 2R16A 1UD1A 1HRI3 3KV9A 4MGTA 4R8HA 1I9RA 3ZYFA 1MS0A 1YI7A 2GU9A 5IAVA 3V0AB 2CGOA 3W5MA 5JSOA 2QDNA 1AR82 4NHKA 4CCMA 1AR62 1RUJ3 4I30A 2ZA9A 4XJ8A 3UNPA 1ASJ3 5JOZA 1FOD2 2P2KA 1BMV2 3AP5A 5C70A 1OVPA 2RS13 2JICA 1YIFA 1AF9A 4XIKA 4CXWA 5IFPA 2D3SA 2YMZA 3K4DA 3F2ZA 3IBMA 4XIOA 3USUB 4KH9A 4QPIB 5IK8A 1SPPB 1E5SA 4MXWA 2O0OA 1CAUA 2YC2A 3BOWA 4PIXA 1FMD1 1K5MB 1VP6A 2W87A 2XHKA 4Y1ZA 4CE8A 1ZM1A 1WA4A 1V0AA 4QPIC 1GOFA 3POBA 2JIGA 4HLTA 3GZUC 4IV3B 4IGPA 3ZFEB 4OFGA 3HEIA 5KHJA 4OVEA 1GV9A 1CJPA 1K5MC 3GBGA 1H6XA 1RUE2 4MLOA 1KEXA 4YG3A 3A0KA 5I91A 2GDFA 2E51A 4AFCA 4D7SA 1J1TA 3AKPA 4IV3C 3ZFEC 5JXHA 5FPAA 1ENRA 2YG0A 3SCHA 3JBG3 1BXHA 1D2QA 1BK1A 2UWBA 4MSVA 2OX0A 3VGIA 1ZBA3 4W6WA 4RS5B 4PT6A 1NCQB 3IT8A 4DUVA 3ZOIA 1U5XA 2VOWA 4HOOA 2CWSA 4L92A 4EZHA 2ZMNA 1UU5A 1IHMA 4JDNA 1RUH1 2ZGLA 4LLFA 4RS5C 5CEHA 3M70A 1OH4A 3ACGA 3HQXA 2KR2A 4XUQA 1W6MB 2BVBA 2PELA 4CDXB 1O5UA 4IV1A 3VBUB 1QH6A 5A7PA 3VD9A 1W6QB 4FOVA 1WLTA 4WVZA 5F32A 1FI2A 4GWNA 2CY6A 4JQTA 4LO7A 3UGFA 3K4AA 4CDUA 4D6RA 2YBKA 3I2KA 1AR92 4CDXC 1UW8A 5GZGA 1PGL1 3ZXGA 4DRVA 3ZYHA 1OC1A 4W6YA 1PNGA 4RHV3 3VBUC 4AQSA 4KWUA 3VDAA 1KITA 1TME3 5DZGA 4UW3A 3UESA 1NA1A 3Q8FA 2BFUS 4Y3OA 3QBQA 2WQ4A 4CP1A 4BU2A 4OULA 3TYJA 3WNXA 4E2GA 3JXSA 4HBNA 2VZ1A 4NVPA 2V73A 4ONUA 5IW0A 1LGNA 1PX4A 4NPLA 2EAAA 1JUHA 2PXJA 3H1WA 4GMP1 2PHFA 1YFYA 3USSA 4EV0A 5T55A 5BNOC 2FMDA 4MGIE 4COYA 3O1TA 4OI1A 1LU1A 4K40A 5FTTC 4Q8KA 4ZZ8A 1REFA 2PN5A 3HT2A 3QLQA 1HRV2 2GH8A 4JX0A 1UYPA 5FV3A 5FZ7A 1TE1B 3VHPA 3HNMA 4TSVA 2ZABA 3K3NA 4Z8BA 3VBSB 3M7AA 1VBE3 3LFMA 5FYUA 5GALA 3BU0A 3L2HA 4RFRB 4XCAA 5DAPA 2EIEA 3B02A 4B4RA 4FQ4A 1F5FA 1RJ7A 3QCWA 3VBSC 5I0DA 4DXSA 2XUEA 3NW4A 3HD8B 4KL1A 5F3IA 2LROA 1H4HA 4XUTA 5DAXA 1UYYA 2DCTA 3PVBB 1LB2A 1AR83 3PNAA 1AR63 1LNSA 4QB1A 2WYSA 4AVAA 2BWAA 1FOD3 3NV3A 2VTXA 3A23A 3WDYA 2OYZA 3PJYA 3SHRA 2FBEA 2V4AA 3RPQA 4FTSA 2X5IA 3A22A 3PMSA 1X7NA 3OD0A 3DKQA 1LHOA 4M4PA 5FK8A 5CG9A 4EE2A 5DAWA 3I59A 4K8RB 5BNPA 1SFPA 3AC0A 1V6IA 3NNLA 4CCOA 2LM3A 5JR2A 2VY0A 4XUOA 3ZXAC 1UY1A 3LFIA 1J3RA 2E7TA 3VZMA 2VNVA 1H6YA 1QOTA 2VZOA 1U5IA 1QQP2 1SLBA 1GZCA 4N90A 3ZMOA 4OUEA 4DO0A 2DVGA 3N9OA 1PO22 2JG8B 3C7OA 1CJDA 5CKQA 5CVRA 4I0BA 1RMU1 2AENA 3OGGA 4QPYA 1RUE3 3VBHA 3WDWA 1AUYA 1X8MA 3JB8A 3RWNA 2OZ6A 3ZYIB 4OLLA 4FFFA 3URFA 3CJXA 2JG8C 1DQ5A 5E16A 4CYDA 3H8XA 5I0RA 4D0QA 1XNCA 1UZVA 1IKPA 4KGQA 3TAYA 1RUI2 2CTVA 2UWCA 3H7JA 2WT0A 3O1PA 1DGWA 1S0IA 5FMBA 3KCXA 5F5QA 2IXCA 3HT1A 4MYEA 3I2GA 1JI6A 3MPBA 2LS6A 4N53B 2W1UA 2DTYA 4P9GA 3K3OA 1HRI1 4IEYA 1R082 2D3RA 3U4SA 4PLNA 5FKCA 2BVVA 3ENRA 4NAMA 4P9YA 4YW3A 3KGLA 1UY0A 2ZS6B 5FMOL 1GNHA 1ZZ8A 4FPLA 3ZVXA 2AC1A 1BYHA 3AZVA 1NE4A 3MPPG 3T30A 4UW4A 1VBB2 2X8KA 3SH3A 1LRHA 1RUJ1 1AR93 1ASJ1 3AP9A 5IT6A 4XF9A 3CHXA 4QX1A 1POV3 4XBQA 1EUTA 2RS11 1KDMA 3JD72 2EF6A 1HLCA 4RFT0 5T5PA 3U11A 4CDQA 2W5FA 3I2JA 3ME2A 1HB1A 3RS6A 1K45A 1KS5A 4YZ1A 1W6NB 1B35A 2UY8A 1T6GC 4I09A 3AL6A 5FYTA 5FO9B 5L7OB 4LHLA 1N1SA 2WIIB 4HVOA 4Y1UA 5JI7A 4CVUA 1W8TA 3KT4A 4FOWA 2WC2A 5LATA 2RS32 4G4FA 5KBFA 4BB3A 4M00A 2OUHA 2Y0IA 4XILA 4QGLA 4XUPA 5L7OC 3CJIB 2VOXA 4IERA 2D6LX 2WKKA 1WW7A 3KHBA 4OHWA 4LO8A 4MH0E 1W8NA 3D8CA 3JBG1 3TEXA 3N9LA 3VHOA 1HRV3 4E27A 3WW2A 4X8PA 1ZBA1 3PUHA 3UT0A 1POQA 2JX9A 3KMHA 2WBKA 3M8LA 1QEXA 2C9KA 1H2LA 5FJHA 3PU3A 2NQYA 3V64A 4BIOA 4AI0A 4PDWA 1ODMA 3D82A 5BNQA 1W0PA 1JYVA 3OSDA 1XYNA 2E9QA 2W47A 2HWD2 1LTEA 1Q43A 5DAVA 4AVTA 4CCKA 3U4XA 1UY2A 4DXTA 2FDKA 3W20A 1AXZA 1VBD2 1JW6A 1K12A 1DQ4A 1LOFC 2PYTA 1WZXA 4CEWB 3K75B 4AGRA 5J36A 1PGSA 4BMEA 1QXRA 2FCUA 3ON7A 4AHWA 4RHV1 2H0BA 2E7AA 1O4YA 4XPVA 1KXGA 1TME1 4Q5OA 4W65A 1PZ7A 2G1MA 4HL0A 2Y60A 5A3TA 4EN9B 1IPKA 3AXDA 4BWOA 2ID4A 5JOXA 2ZGKA 3E6DA 1MS9A 4AL9A 2HLEA 2RDNA 4LEJA 2GC0A 4XETA 5E8AA 1QQP3 3B94A 1EAH2 1PO23 2B9VA 4LA2A 1Q8PA 3WQ7A 2PTMA 1HW5A 1VMFA 2HJIA 3T2PA 5E89A 1MPXA 3U78A 2R49A 4BLIA 5D2AA 5FZDA 2AYHA 1S0JA 2VQTA 4IDZA 2WWUA 4B7EA 4EN6B 4EWEA 4CDWB 1ZRFA 2W91A 5LWBA 3VDDB 2VVEA 1YFXA 4XC9A 4E4ZA 3MUY1 4QXBA 3NV2A 1C8M2 1BCXA 2VZPA 4XE9A 4O9GA 1RUI3 4CDWC 2R042 1YCIA 3VDDC 3ZFFB 1A8MA 4MUVA 4HVRA 4DNYA 1VBE1 2IZWA 3ZIXA 4WZFA 3WHUA 2RMU2 2QQVA 1PK6B 4H7LA 3S5QA 4ET7A 4OHYA 1LJ7A 5H9SA 1R083 4Q0QA 1W2AX 2VQAA 3NV1A 1JH5A 1QF3A 3ZSLA 2WZR2 3U75A 3WP4A 1ENQA 1A8DA 2KM2A 4I3GA 1S1AA 1J83A 4NIAA 1PK6C 4ZZ5A 4Y4RA 4FPCA 1ENSA 4FPKA 1AR81 3D5OA 2DYCA 4QAWA 1VBB3 5GKAC 3WCSA 1JZ8A 1BMV1 5HXMA 4OUSA 1UY4A 5KHIA 1GQPA 1ZYBA 1FOD1 3UKVA 4HFSA 4XVHA 4B4PA 1G7YA 4R9BA 1XB9A 4XACA 3QOPA 5DABA 1C8NA 4BQWA 3JD73 4A4AA 4B29A 4CU6A 4IL7A 2BBVA 4J25A 4E2SA 4NHXA 3LPGA 3PU8A 1NG0A 1IOAA 4WM7A 1VBC1 3AVRA 4PI0A 1AL22 1W05A 1W8OA 3LEMA 2IUWA 3B5LB 1F4AA 4LBJA 4RL7A 5FQ0B 3VD3A 3LA7A 3MO4A 4B1LA 1CX1A 5JDBA 3S57A 1OLRA 1PO12 5F6LB 3MIGA 2ZEZA 1X50A 2XDVA 3WY6A 1JBCA 2CHHA 4DMIA 2QQKA 1GU3A 1FV3A 2RS33 3WF4A 4XTPA 2VOVA 4YZ4A 1RUE1 3UK9A 1GSLA 3H0OA 1SLCA 2TEPA 4M3CA 2EVXA 3N7KA 4JKKA 4CP9A 1W2UA 4RR3B 3O0VA 5FWEA 3M3OA 1CQ9A 5A1LA 2OPKA 2XL9A 4IEUA 3BIEA 1MR5A 2YY1A 3BYWA 1YHFA 5FYHA 2ZAHA 3TWIA 1SLLA 3MIDA 5DXDA 4RR3C 2MEV2 3VL8A 4XFIA 4V2WA 3ZXFA 5JIUA 1D0GA 5ISLA 5GZCA 1W0NA 1GMMA 2QQJA 4NUBA 4BXSV 4CPBD 2GNBA 1XXNA 4IEXA 4HVQA 3M1HA 3RMXA 1Z7S2 1F8VA 3AX4A 3WDTA 2XJUA 2R32A 1H2MA 2WN2A 1L7QA 1CONA 5FBJA 2D97A 2HWD3 5A7QA 3GDBA 4W4ZA 4HETA 1YJKA 1Q8OA 1VBD3 4HPKB 1IKQA 1V6LA 1AYN2 1ULCA 4G9SB 4AAXA 4QDQA 4H7MA 2W46A 2XJQA 3ZN4A 1W8HA 4AI1A 4MXWB 1UMZA 1POV1 4BJ0A 1IQDC 5L9BA 2KXLA 1CAUB 3P1IA 4Q4V2 2GP5A 4JTNA 4LBQA 1VMHA 3DKWA 4DXRA 1UOBA 3N9NA 1H8TA 2WRAA 3IDCB 4MGYE 4OZOA 1BLZA 4GIQA 3K51A 3PVNA 3IIIA 2X09A 5BYNA 3OY8A 2DVBA 2D43A 3KT7A 2A3YA 3LZZA 1UNBA 2YHJA 5FLHA 5JMOA 4TXWA 5A70A 1G9CA 3V0BA 1OLMA 4CCEA 3WF0A 4YGDA 2DUOA 1EAH3 1HB4A 4URAA 3ZKYA 3WXPA 2BPA2 1JODA 4CCCA 5LA0A 5ACA2 1ZBE2 5LEKA 3SKJE 4EJRA 4OQ8A 3GALA 3OYWA 4WBBA 5DAQA 4Q26A 3MFAA 4AEDC 2WLPA 2ZPXA 2VZRA 3HPNA 1HRV1 3ILFA 4L9BA 1C8M3 1O59A 1ODNA 5E88A 4GXLA 5FZAA 2HYXA 2EIGA 2R043 1S2KA 1RL3A 4ES8A 3WT3A 3AMNA 1JS9A 1RITA 1AHSA 3B9CA 5KC5A 2RMU3 3SQOA 4IV1B 4ZS2A 3ES1A 4TLGA 1JZ6A 3WF3A 1UZ0A 3WG1A 4CDUB 4NWWA 1UWWA 2WZR3 4EN7B 2UWAA 3E97A 4BIFA 3RYPA 4EN8B 3MIFA 4Z82A 3HIFA 4IGQA 4IV1C 3X29B 3ZR6A 3WW3A 4CDUC 1NA1B 3MIEA 2GMPA 5FWJA 4Y1YA 2Y6KA 4BDVB 2MHFA 5CFDA 4QXCA 3B00A 5KWRA 4GAZA 3VZJA 5DZFA 4Q4X2 4KWJA 1QDCA 2AEYA 2PQQA 4ES9A 4D8MA 1EV12 1AL23 1OSGA 3ACLA 2D5HA 2CDPA 2OKXA 1WLWA 2ZHLA 1M4WA 4FP3A 3ACIA 1Q8QA 4FPYA 5SV5A 1PO13 1REEA 1QQP1 3WNNA 1PO21 1GP6A 1J59A 2JWPA 3N9MA 5KXEA 3MYXA 3N7MA 1RUOA 4AVSA 4Q1RA 1GICA 4ZHNA 1OFNA 3HBKA 3LIGA 4N9IA 5FXWA 4L0PA 4W8JA 3FFZA 4LXLA 3VKFC 1MZ5A 3VZLA 2BEOA 4AQ6A 4DRRA 4DXZA 1DGRA 2CU5A 2QQPA 3KCCA 1F9KA 2Q8DA 3C3VA 4QXHA 4YFZA 5T5OA 1AYM2 4XQDA 3HQUA 2K0GA 1RUI1 1W39A 2RE9A 3DF0A 4HMZA 2MEV3 2WO7A 4YWAA 4LO6B 4LJHA 4K8FA 3PL0A 3UETA 4C0BA 4PIZA 3WDXA 2JDZA 4C8DA 4NIIA 5FAXA 3WQ1A 1Z7S3 1VB2A 1KGYA 1R081 5A3OA 1W9WA 4BQ1A 4ZU5A 5K9YA 5A6ZA 1BK0A 1ZA4A 5EQUA 2WFPA 4XFHA 5FYYA 2BOIA 2CWMA 4RD7A 3WG4A 3R4UA 1N3QA 4NPRA 1AYN3 1PMIA 2QZ2A 2X5IB 1VBB1 3R4SA 5EJ1B 5FZFA 2OS2A 3I59B 3PIJA 1RGSA 4Q8LA 5BNPB 3KLSA 3JD71 4A41A 3RZZA 4Q4V3 2X5IC 2DCYA 4CU8A 3CIHA 3GZTB 4XF0A 5BNPC 5T3NA 3NRUA 2LTNA 4R4XA 3R6SA 1SMVA 5FZHA 1MEC2 1EP0A 3H8UA 3CBNA 1IPSA 3I4IA 5C8CC 2JD4A 4RQPA 5A6YA 3VBHB 5J96B 1SLAA 4HKOA 1OF4A 4JVAA 2BYVE 1NXD1 3RZMA 1GOHA 3O7OA 5ACA3 1ZBE3 3CU7A 2RS31 1CN1A 1W04A 4AF9A 4FBFA 1A3KA 5B4NA 2MPFA 5FZIA 3VBHC 4KBZA 5LA1A 2BFUL 3RFRA 2DUPA 2P4EA 3VLBB 1CVNA 2ZBJA 2JB8A 2WZEA 2Y0OA 4HN1A 3TRSB 4YW5A 1CESA 1UY3A 4P9IA 4ARXA 3OPTA 4COWA 4YARA 5AFEA 2FDIA 3HOBA 3OGRA 2XUMA 3ZFFA 3O1OA 1UPIA 2NLRA 2IWGB 2WA3A 4AEMA 3NKTA 4RN5A 2C0ZA 4YW1A 2DU1A 5J98B 2D98A 2VW0A 3FJSA 5LCWL 2GH2A 4IEQA 2EXJA 1W8ZA 3BGAA 3HVDA 1VBD1 4LMFA 4CDQB 4KWKA 4GD4A 4FOQA 3BCWA 1VE0A 3BODA 4OYUA 3TBDA 2JKBA 3RYKA 3K77A 1LR5A 4XURA 2NPIA 4DB5A 1OD5A 2YBSA 4XABA 4DIQA 3H50A 3WUCA 1B35B 4CDQC 1OA2A 4Q4X3 3GHMA 4MGSA 2VJXA 1EV13 4YG6A 2ZMKA 1XNBA 3WNOA 2YFUA 5EFUA 2VC9A 4UXAA 4FFGA 4AGVA 3TOJA 1B35C 3GZEA 4LLOA 3KHCA 4DINB 2P3JA 1PGW2 2DCKA 3VZOA 1EAH1 2SBAA 3OPWA 2ZZJA 2WL1A 1HN0A 1W9YA 3C2UA 3TN92 2B8MA 3W59A 2VULA 4LIVA 3K46A 2RDRA 1RUF2 3OEBA 4MO3M 3RI9A 1WCUA 4NAOA 3WSOA 1O91A 5IAXA 4NIGA 4WVVA 1OPMA 2WWJA 5KHGA 1LOEA 1AYM3 1C8M1 1RUD2 2R041 4PDWB 3VV1A 2Y33A 2OXBA 4YW7A 4KU7A 3GCXA 3I97A 5FPLA 2ARXA 3RZKA 2DV9A 3NNGA 4NIDA 1VLNA 3F95A 1BQPA 2QQMA 1G9BA 1EPWA 3T1LA 4PDWC 2P3IA 1ZVFA 2WT1A 3IDBB 4E4SA 4QQOA 4B1MA 5CADA 3CO2A 2E33A 2VR4A 3PIGA 2DDUA 2WZR1 5FLIA 1DZTA 3C7FA 2PAEA 5LBFA 1HIXA 1GQGA 3LCPA 4AHXA 1LOBA 3MW4A 3FLRA 2WAOA 3KGZA 1TNFA 5IK5A 2ATFA 4FPGA 3OGJA 3AMHA 1UOJA 4YW4A 3SH5A 5J48A 1JU4A 1LHNA 2D5FA 4HPKA 4XDPA 3LSEA 2CV6A 1DBNA 1MZEA 3BN6A 2OW4A
chains in the Genus database with same CATH topology
4C0HA 1RC6A 2Q0AA 2XWJB 1HQNA 3Q9OA 1E57A 1W6OA 1MS1A 1C5HA 1XNDA 1V6OA 4YM1A 4ITCA 1MEC3 2G4IA 5DDJ2 1DG6A 2DFBA 4QHBA 4IXLA 3WINE 1NQDA 1PO11 2WLQA 4E2QA 1VIWB 4QGNA 1U12A 1AJKA 4OUMA 4Q4Y2 5SV8A 3IWZA 2DF7A 2QZ3A 3WDVA 1WLDA 4QM8A 2ET1A 1XQNA 5I0UA 2CGPA 1AR72 4XZPA 2B9UA 2ZX2A 2MEV1 2GAUA 5C9AA 1DU3D 1H2NA 1NCQC 1Z7S1 5BPXA 4XJZA 1N1YA 4MV2A 5ABJA 2NP0A 3AP7A 3AKTA 4LBOA 4I0WB 4PCRA 4EWAA 2HEWF 1O3SA 1AYN1 2D6KA 3MZHA 3A0NA 2ZKNA 1YIPA 1IPJA 4WM7B 1S55A 1LULA 4D7TA 4GQ7A 4ZKTB 3AYDA 1TNRA 2YROA 4Q4V1 1QHDA 2IFRA 4WM7C 2R072 4URTA 4AHYA 1BKZA 4A7KA 3KB5A 1UKRA 3WW4A 2Q30A 4LNVA 3JU9A 5FLJA 4M3CB 4SLIA 4COZA 2A71A 4RA0A 3ZSEA 4ASMB 3N7JA 2ILMA 4Z1VA 5ACA1 2YV8A 1ZBE1 3TN93 1ZRDA 3ST7A 4ISRA 1DLLA 1RUF3 4I3PA 2B39A 3LOBA 4AW7A 5A3LA 1RUD3 1SBFA 4FPEA 2ZAAA 3EQEA 3PTYA 4IQPA 5JVVA 5J09A 3AKSA 3ZXLA 3OBRA 4A7ZA 2ZGQA 1RUC2 1V6MA 4INDA 2XPJA 2GMMA 3GHNA 2VXRA 3FUQA 3MLLA 4YVWA 4KBBA 1S0DA 1MS8A 1LU2A 1UN1A 1JN2P 2Z5WA 4N7UA 2DVFA 1YUDA 3ZO0B 4LBQB 4QU2A 3PLQA 1H8TB 1UAIA 2B46X 4C90A 5T5LA 3NKGA 3OY8B 4Q4X1 3V0BB 3MLJA 4FSJA 4DOUA 1FNZA 3E6CC 1EV11 3POSA 1Q3EA 1H8TC 3ECQA 1MACA 4CP0A 2WINB 3V56A 4TZDA 2GNDA 5DDJ3 2C9AA 2VUAA 3N3HA 1V6JA 2V09A 5FDBA 3PHMA 3AZXA 2ZGMA 2WT2A 1YFUA 5CFCA 3OYWB 2Q1MA 5LRSA 4Q4Y3 1GKBA 1WMEA 1SFYA 3KSCA 4X6QB 1Z0HA 2DVDA 4PJYA 3IDEA 1GLHA 3WP5A 3PMEA 2ZTNA 1QOOA 5KXDA 1QGLA 3IN9A 4LHKA 4V1PA 1AYM1 3BB6A 1AR73 4MX3A 1UZYA 4E9KA 4YNIA 2QCSB 1ZREA 3THTA 4QQPA 2D6OX 5K0UA 3ES4A 4JQRA 4NWVA 1PZ9A 2O1QA 4DQAA 4N53C 3EXUA 1YXWA 5CFDB 1MZ6A 1QJU2 4MXVA 1OI6A 3NWKA 2ZCWA 2BNNA 4S2FA 3LKJA 2Z2SB 2P34A 5CFDC 4KG8A 4Q4W2 4FQZA 3T2TA 1GQHA 2XJRA 3WG3A 1LGBA 4AI2A 3FMGA 2QE3A 3U10A 4YM3A 2R073 2PAMA 1QNYA 3LSDA 5GZFA 1MEC1 4F3JA 3P3NA 1LOAA 2G9GA 4AG4A 3VZKA 2A73B 4COVA 4CEYB 2DUQA 1AVBA 2VU9A 1LHWA 3P3PA 1CD3G 5EYXA 1C1LA 1WCKA 1MQTA 5GLVA 2HEYF 4LO4B 1I3HA 5FBZA 3VKNA 4IEOA 3I8TA 3VBRA 2O8QA 4TYSA 1Y3TA 2ZGPA 3ZSJA 3CJIC 1QH7A 4KWLA 3G7DA 1LHVA 4Y26A 2WQZC 4YSFA 1UPSA 3ZMNA 2EXHA 1JHNA 2Q1ZB 2D6NA 1IZ3A 5DUXA 1RUC3 4P9JA 1QU0A 3A4UA 3LOIA 4S2GA 1YLLA 4DS0A 4K21A 3H1MA 4QQ2A 2VW1A 1H1IA 2NYYA 2I45A 5K7PA 4YVSA 4CEWC 4RQPB 3ZFGA 3ZPYA 2F4PA 1BVP1 1CPMA 2ZZQA 4XTMA 2PLV2 3IKWA 5T54A 2DVAA 4RQPC 1PGW1 2HWC2 1PNFA 5F6KA 5BV6A 1ULFA 3OD4A 1VAMA 4HK8A 1X82A 3TN91 3O14A 3AFGA 1CAXA 1RUF1 1FV2A 1COV2 1NXMA 3H7YA 3T1MA 3UL2A 4BE3A 4AHZA 4KQ7A 4WM8A 2A6YA 3SLIA 4W6XA 2A5ZA 3GYDA 4Z2WA 1RUD1 3ILRA 1SBEA 2MNGA 4C1WA 3NV4A 5KC6A 4OHXA 1NCRA 2DU0A 4OZXA 4BCUA 1L3JA 4GH4A 1GFF2 5J3UA 4NR1A 1UKGA 3ZFFC 4Y22A 2C1FA 2ENRA 1ZRRA 2YYOA 1YFWA 1OOPA 1VRH2 2D44A 2PHDA 1UU4A 2IXHA 3J4UH 4JRAA 1Q8VA 1AR61 1I1EA 1QJU3 5DUVA 3KZ4C 2C5DA 2O8OA 1QDOA 3MF6A 3SCFA 4U36A 5IK7A 1VB4A 4Q4W3 4AWDA 1RTVA 1AX2A 3ASIA 1Y43B 4D94A 4AXOA 1JYCA 3S30A 3BIWE 2VNOA 5DDJ1 2P3KA 2DFCA 4XHBA 2Q5TA 3SCGA 4NOTA 5B2GB 5JI9A 2BTVC 2W39A 4BYYA 2GMEA 4Q4Y1 5CAZA 1VBA2 2I2SA 1DQ0A 2JECA 3OJBA 4K1YA 2AR6A 3KT1A 1FPN2 3WQ0A 4I01A 1QJX2 2OVUA 1AR71 3GNEA 4K6BA 3QACA 5JMCA 1KJLA 5DG2A 5FOJB 2CNAA 5BNOA 2WA4A 5AFBA 5TSWA 5H9PA 4XJUA 3JQWA 3LGRA 2TBVA 4LUKA 3LA3A 1SACA 3OCPA 3B7MA 4Q27A 1ZZ7A 3FZ3A 1GYKA 3RQ0A 2PA7A 3SXWA 1WW5A 4M0HA 4BOWA 1C5IA 1DQ6A 1RJ8A 1AR91 2GNMA 1F2NA 1GANA 5FRAA 4XDQA 1W6OB 3BOPA 2Q8OA 4EWDA 1H8VA 1FT9A 4Q29A 4LULA 1QMJA 1SDWA 5HXVA 3VHRA 2R071 1SCRA 1DGLA 1O7FA 2AZ5A 2PLV3 2Z79A 5D8AA 5LK5A 1F5JA 4XF3A 4OHZA 3AMMA 1JUIA 1QY4A 4XXAA 2HWC3 2VMGA 5E1RA 4Y1VA 4LHNA 1JTZX 2PHXA 4GMP0 4X8NA 2PHRA 2XLFA 4B7KA 3M4FA 1COV3 3MEPA 1UIJA 3INAA 2JG9A 4HK9A 5C9AB 4EROA 4JGYB 1EYBA 1V6NA 5C9AC 5A32A 5ABJB 4A2UA 2QVSB 3AJZA 1RUC1 5KXBA 1AXYA 1O3QA 2W08A 2EXIA 3MGUA 4XJ9A 4DPNA 3CNAA 2YGLA 3RNSA 5ABJC 1VRH3 1J58A 2R1BA 2VNGA 4Y24A 3UJQA 1SLIA 1FNYA 3DPRA 2GNTA 3FFQA 1LHUA 4GA9A 2AH2A 1YYNA 2F6BA 3WX5A 1ZNPA 1V6KA 3B01A 1QWRA 1NA1C 2Z69A 4YLZA 1NLRA 1S0GA 4AFDA 4MGKE 5J37A 2HKXA 4BPZA 1N1VA 1Q8SA 3M3CA 2BUKA 2IXKA 4UBHA 3FLTA 5KHHA 4ASLA 4KGGA 1X33A 3ZXDA 5T52A 4FOYA 1XU1A 4GWMA 3WP6A 1HV0A 4XYXA 4CEYA 1VBA3 3WLUA 4XFBA 5JSRA 2NZ9A 1FPN3 5CBLA 4DFSA 4F8AA 4XJWA 2XL7A 1QJX3 2XB6C 3MDPA 4K1ZA 2RHPA 1V00A 4GKYA 5JOYA 1GZWA 4L99A 3E5UA 4F83A 3POWA 4YVWB 4RGAA 3MIBA 5C4WA 1N47A 4HSLA 1GR3A 2R30A 5JPMB 1XYOA 5JAXA 3HAGA 4LBKA 5H9QA 4YVWC 3SNMA 3ZYRA 3PJQA 2ETEA 5I93A 1QJU1 2NM1A 1AXKA 1YJLA 3CF6E 4JTOA 4YGCA 5DUWA 1EY2A 4LTAA 1IS4A 4Q4W1 4BM8A 4YZ2A 1Q56A 5AVPA 2E7QA 1OLQA 3HWJA 4MVTA 2FZ1A 1O4TA 2GZWA 1OMIA 1RHI2 5CFCB 1OPOA 3BU7A 2ZHKA 1Q5OA 3OTFA 1X8EA 1JOJA 5FPZA 4AQTA 2H0VA 5CFCC 3FBYA 3VBFA 1UX6A 3OF1A 1AX1A 1KRIA 1Z78A 2ES3A 5A33A 2XBO2 5GM0A 1JYIA 4D3WA 4D7YA 2XJSA 1IQAA 3KM5A 3ETQA 5BNNA 5K0UB 1IS5A 2WZPP 4GMP3 5KHKA 1YO8A 2TNFA 2WSUA 4N43A 3NAPA 4XBNA 5BUVA 3AYCA 1OQDA 3W9AA 1SQ4A 3VZNA 3FLPA 2HWD1 1H1AA 1J3PA 3ZN6A 2IXIA 4B3NA 2VG9A 4AQ2A 3JB4C 3WD5A 2YDEA 4J1XA 5HCAA 5D1IA 4FAHA 1MS3A 2W52A 2FMYA 4Q1PA 3NSTA 1APNA 3ZXJA 1M06G 2X29A 3UKNA 4BA6A 2ZX0A 4UW5A 4FXGB 1D0HA 2RS52 2JJ6A 4R9AA 2ZGRA 1WW6A 4AI3A 2VW2A 2PLV1 1MQTB 3VBOA 2PHUA 5C6CA 2HWC1 1WD3A 3UKTA 5CA6A 4P9LA 3VBRB 5GLUA 1C4RA 3ZIWA 3M3IA 2XKPA 2XVGA 3AZZA 1DFQA 2DWRA 3TB0A 1COV1 2Z42A 1O4ZA 3KQRA 4XQ4A 1ULGA 3VBRC 4YRDA 2A75A 4YM2A 1TQ5A 4NHLA 5DZEA 3AMPA 2VPVA 4HZFA 3S7EA 2P37A 1R1A2 4A7YA 1QKQA 4AYUA 4Q0VA 1CGPA 4EN0A 3GBWA 4QQLA 2RMU1 1J3QA 2FHRA 3PVEA 5EV7A 1HXS2 2D6PA 4MZUA 5I8YA 1VRH1 2ZHMA 2PFWA 1LESA 4P5HA 4YVSB 1QXJA 5KXCA 1WD4A 4XOGA 5GZDA 4AFMA 3ZN5A 1N3PA 1MS5A 3D0SA 3ZFGB 4M3CE 4YVSC 3AP4A 5H9RA 4TWTA 4SBVA 1Y7BA 1MS4A 1AL21 2YC0A 2WNEA 3N35A 4YW2A 1GNZA 1H2KA 3RG0A 3RMYA 3ZFGC 2XG3A 5AVAA 1RHI3 4NHMA 1GZ9A 1A6CA 2FZ2A 1DF0A 1RIRA 1CAXB 1D4M2 4HSJA 5CIRA 1VBA1 1LGCA 1KDKA 4WM8B 1CAVA 3H3ZA 1VBC2 1ZRCA 2XBO3 1KFUL 2ZOEB 2YGMA 3EO6A 1NQJA 3ZSLA 1FPN1 2BNOA 4FAGA 1NCRB 4M3CF 5FFOC 4I02A 4GH4B 4WM8C 1QJX1 1FXZA 4K9SA 5LRRA 2HWF2 2W68A 4Y22B 5BY5A 2Y26A 3ZYGA 3S0MA 1S0CA 2WFF2 2GN3A 1NCRC 4JGYA 1AZDA 1LOCA 1OOPB 4Y1XA 4GH4C 3FC0A 4PIYA 2A3WA 4FT8A 2P17A 4ATFA 2VUJA 1I5ZA 4BHPA 4JC1A 4AEDA 3LAGA 3AB0A 5GJ6A 4LR4A 1VALA 1OOPC 2B45X 4Q0SA 3I54A 3VN4A 2RM22 2TUNA 2ZX4A 1S2BA 1DIWA 3DGTA 3W58A 2GC2A 5JOWA 3RJRA 4ATEA 1POV0 5JWPA 3O12A 2R6QA 1VJ2A 3HMYA 2WJSA 2RS53 1PHMA 4WVMA 3E5QA 3JQXA 4IEWA 1AJOA 1YNAA 1D2SA 1FAYA 1DHKB 2IC1A 4FXKB 3NJZA 4S2DA 3M2MA 2GALA 1RVF2 1ND3A 1LEMA 1V9U2 1KJRA 4JRLA 2VGDA 3L2YA 3SISA 3ZYPA 3AZYA 3RSJA 5IUQA 1XE7A 4P9XA 1NYWA 3G6JB 5BNOB 1DGWX 4QMAA 1R1A3 2DCJA 2QJVA 4PF5A 3RRDA 2X53S 1PIV2 2ZX3A 1LEDA 3ALQA 4QX5A 4OI0A 4B8EA 5JZGA 3M3EA 3DV8A 1BZWA 4U2AA 2ZJCA 3EJKA 4GB32 1HXS3 2WWSA 5JR7B 4M0NA 2WS92 4Q0PA 1UF2C 4AVCA 3KS7A 3ZXKA 4XJAA 1DZQA 2XLGA 2D93A 3IPVA 5GLZA 3S7IA 3O5SA 5FPXA 2A6WA 5A3MA 1HV1A 4JGZA 4YM0A 5D8AB 4JDOA 4CZSA 3ZYJB 1QJZA 5JLVA 1UCXA 1EPZA 3M3QA 1HX6A 2JENA 1OQ1A 1NLSA 4QGMA 5DG1A 1WW4A 4KG0A 3RI8A 5F9TA 4QPGA 5D8AC 2GC3A 1NE6A 1OKQA 1D4M3 1OA3A 3VKMA 2JG9B 3U07A 4XMIA 1MVQA 3MIHA 2W0XA 3I2DA 1QXPA 1OHFA 1LOGA 1H0BA 1VBC3 3DUIA 3VHNA 2EAKA 2CAVA 4QM9A 2Y38A 2JG9C 3WDUA 4AVVA 3WOGA 2D3PA 5A32B 5C8CA 3AP6A 1BEV2 1LKNA 3AYEA 3FWEA 2HWF3 1QOSA 2WFF3 2CAUA 4YYOA 2RR12 4IEZA 3DPRB 4J1WA 1NY72 5I0SA 2ZGUA 5HCBA 4Z07A 3QH6A 3ROUA 3DPRC 4LE3A 4XXPA 2RM23 4DY3A 2XLAA 3GZAA 4G3YC 3B3QE 1LECA 1LCLA 2PHTA 4Y20A 1KQRA 1I6XA 2NMOA 3AM2A 5LEJA 1DQ1A 3B9IA 1RHI1 1U0AA 1URXA 1PVC2 4PBOA 4HT1T 3J26N 3IMNA 4Y5Z0 1QNWA 3WV6A 2OA2A 4KNCA 4LBLA 3FUOA 1RVF3 2BGCA 1V9U3 4YGBA 1O3TA 1AX0A 3HR9A 3RJ2X 5I8TA 4FVVA 3FE5A 2ZMLA 4CEYC 2A6ZA 4ZU7A 3MW3A 1W6PA 1YI9A 1Y9QA 2ZGSA 5HCFA 2XBO1 1G9AA 3J9SA 1GZWB 2E63A 2BWCA 1WBLA 5C4WB 3U0ZA 2WNUA 3WP3A 2B5HA 2A6VA 2XJTA 1S0EA 2JE9A 2R062 1RUG2 1PIV3 5LK7B 2ZGNA 1ND2A 3ELNA 5C4WC <