5GM5A

Crystal structure of fi-cmcase from aspergillus aculeatus f-50 in complex with cellobiose
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
218
structure length
218
Chain Sequence
QLCDQYATYTGGVYTINNNLWGKDAGSGSQCTTVNSASSAGTSWSTKWNWSGGENSVKSYANSGLTFNKKLVSQISQIPTTARWSYDNTGIRADVAYDLFTAADINHVTWSGDYELMIWLARYGGVQPIGSQIATATVDGQTWELWYGANGSQKTYSFVAPTPITSFQGDVNDFFKYLTQNHGFPASSQYLITLQFGTAPFTGGPATLSVSNWSASVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and genetic modifications of FI-CMCase from Aspergillus aculeatus F-50
pubmed doi rcsb
molecule keywords Endoglucanase-1
molecule tags Hydrolase/inhibitor
source organism Aspergillus aculeatus
total genus 57
structure length 218
sequence length 218
chains with identical sequence B, C, D, E, F, G
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...