5GVHA

Structure of fabk from thermotoga maritima
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
311
structure length
311
Chain Sequence
TVRTRVTDLLEIEHPILMGGMAWAGTPTLAAAVSEAGGLGIIGSGAMKPDDLRKAISELRQKTDKPFGVNIILVSPWADDLVKVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARMVERAGADAVIAEGMESGGHIGEVTTFVLVNKVSRSVNIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAKLGHPARVLRTPFARKIQEMEFENPMQAEEMLVGSLRRAVVEGDLERGSFMVGQSAGLIDEIKPVKQIIEDILKEFKETVEKLRGYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [FMN]
publication title Structural and biochemical characterization of FabK from Thermotoga maritima.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 101
structure length 311
sequence length 311
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03060 NMO Nitronate monooxygenase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...