5GX2A

Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 3.4 mgy (3rd measurement)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
307
structure length
307
Chain Sequence
GPVVEKIAELGKYTVGEGPHWDHETQTLYFVDTVEKTFHKYVPSQKKYTFCKVDKLVSFIIPLAGSPGRFVVSLEREIAILTWDGVSAAPTSIEAIVNVEPHIKNNRLNDGKADPLGNLWTGTMAIDAGLPIGPVTGSLYHLGADKKVKMHESNIAIANGLAWSNDLKKMYYIDSGKRRVDEYDYDASTLSISNQRPLFTFEKHEVPGYPDGQTIDEEGNLWVAVFQGQRIIKISTQQPEVLLDTVKIPDPQVTSVAFGGPNLDELYVTSAGLQLDDSSFDKSLVNGHVYRVTGLGVKGFAGVKVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a dose-limiting data collection strategy for serial synchrotron rotation crystallography
pubmed doi rcsb
molecule keywords Luciferin regenerating enzyme
molecule tags Hydrolase
source organism Photinus pyralis
total genus 76
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2016-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08450 SGL SMP-30/Gluconolactonase/LRE-like region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 5gx2A00
4IMBA 4GNCA 2DG0A 5EX7A 5FWWA 4GNBA 2GVVA 2OJHA 2IAWA 3SOVA 4DG6A 1QLGA 4GN7A 3G4EA 4HHOA 1NPEA 3IAXA 2POOA 2IVZA 4O5SA 4Q1UA 3DR2A 1PJXA 2IAXA 4A0PA 1QBIA 1V04A 3SRGA 4ZLRA 3Q6KA 3A9HA 3O4PA 2QE8A 4R40A 3SOQA 3V64C 5GX3A 4PWZA 3G4HA 1RWIA 2HQSA 3TC9A 2P4OA 2DSOA 2VAQA 3HLHA 2V91A 4GNAA 3S94A 3WWAA 4HW6A 3SOBB 2IAVA 2IAPA 1POOA 1H6LA 1IJQA 4GN8A 2GVWA 5D9CA 2FP9A 5GX5A 1E1AA 3Q6TA 2G8SA 3DASA 3WW9A 3LI5A 3I1CA 3HRPA 2FPCA 3S8VA 2W8BA 1N7DA 3SREA 2IATA 2GVUA 5GTQA 2ISMA 2W8BB 3E5ZA 3KYAA 4IYGA 5GX1A 5D9DA 3P5BL 4JMLA 3LI4A 2FPBA 3A9GA 3V65B 1CRZA 2IARA 3HLIA 2IASA 3FW0A 3U0SA 2FP8A 3AMSA 1CRUA 3FVZA 3LI3A 4GN9A 3S8ZA 3Q6PA 1C5KA 2IAQA 3KGGA 1Q7FA 2IAOA 2DG1A 2GHSA 2GVXA 3S2KA 1CQ1A 1RWLA 5D9BA 5GX4A 4HHQA 5GX2A 1CVMA 3BYCA 2IAUA 3AMRA 4O5TA 1C9UA 3V1SA
chains in the Genus database with same CATH superfamily
3L6VA 1Z4WA 1IVDA 1VCUA 4FPKA 4B7NA 2F13A 4CPLA 4B7QA 3O9JA 2F24A 2F26A 4GNBA 2AH2A 4AH4A 4QN3A 3OPZA 2ZW9A 1INHA 3SOVA 2F11A 1IUCA 4MWQA 1NPEA 4HZZA 1S18A 4KS4A 5CGJA 1EURA 2XZKA 3IAXA 1IUBA 4MX0A 3H6JA 4D4UA 3DR2A 1F8BA 3H71A 1IVBA 4FVKA 1PJXA 4GEZA 4XJ8A 4B7RA 2W5NA 4G3NA 4QN5A 5NN9A 1V04A 3SLIA 3A9HA 1V2IA 1MS0A 1U6DX 2W20A 3D12A 4XIOA 3VNGA 4BBWA 3NN9A 3K37A 1W20A 2XN4A 2Z32A 2P4OA 5F9TA 1NNAA 4CH9A 2VK6A 1NSBA 3NO0A 1A14N 2AGSA 2IAPA 1IJQA 1V3DA 3D11A 4GN8A 4QN4A 1V0EA 5D9CA 5EO8A 4NN9A 2HT8A 4WA3A 5GX5A 3SILA 2SLIA 3WW9A 4L7BA 4GZPA 2BERA 2HU0A 4XE9A 4FPLA 4MJVA 1EUSA 1WCQA 1USXA 3SREA 1N7DA 1NCBN 4N1BA 1L7FA 4YW3A 1Z4ZA 1MWEA 3KYAA 4K1JA 5GX1A 2VPJA 4JMLA 2SILA 1B9VA 4CPOA 4B7MA 3HLIA 1Z4YA 2VW1A 2FP8A 3TIBA 4YZ1A 1NMBN 1NCCN 4GZWA 4M4VA 4D52A 1C5KA 4NCSA 4UOUA 1F8EA 3GVJA 1MR5A 1SO7A 4XHBA 4XMBA 1XOGA 3SANA 1W21A 2IAQA 1W8OA 2FLUX 5B2DA 1A4QA 3UC1A 2GVXA 4XMAA 2QWEA 4MWJA 2ZB5A 4FPYA 4HHQA 1CVMA 2BZDA 2IAUA 3AMRA 5GX2A 1BJIA 5HUNA 1INFA 4IMBA 5EX7A 4Q6KA 5B2CA 1OFZA 4FPFA 4KS2A 2QWDA 2VSKA 4FPJA 2HTQA 2OJHA 5F72C 3SALA 2QWJA 2XZJA 4IQKA 3T1EA 4HHOA 4YW2A 3TI6A 1SUUA 4A0PA 4MWRA 4ZLRA 2W38A 4MZAA 1MZ6A 3O4PA 2QE8A 3TI5A 3CKZA 4K1HA 1N6EA 4PWZA 2C4LA 1RWIA 2CMLA 4QN7A 1NN2A 4M4NA 2DYHA 2VAQA 4KS3A 2V91A 2FHRA 3O9KA 4YW5A 3B69A 5FZJA 2A75A 1DIMA 1L7GA 4UF7A 4XYXA 1DILA 2X9MA 4XMIA 1INGA 3K38A 2FP9A 4K1IA 4C1YA 3H73A 6NN9A 2G8SA 4FPOB 4CHBA 4FOYA 3LI5A 1MS3A 2F0ZA 3ALXA 2W5OA 3CYEA 3I1CA 4C1YB 3W09A 3K3AA 3HRPA 1INWA 4YZ4A 4MWLA 4CPYA 3S8VA 4FJ6A 4FZHA 4WA5A 4GJTA 3WDZA 2GVUA 1INYA 1V3EA 2ZB6A 4KS5A 4HZWA 1IVCA 3ALWA 4YZ5A 2YA7A 5D9DA 4MZEA 1S0IA 4XJAA 4IFLX 4H53A 2VW2A 3TI8A 2IASA 2RKCA 4WEFA 4XHXA 4XJZA 3FVZA 3LI3A 4YZ3A 5EO7A 4J9TA 4MWXA 1X2JA 4HIZA 2DG1A 4IN4A 4HZVA 2BF6A 4XJWA 5HUKA 4FP3A 1RWLA 5HUGA 5JYYA 2HT5A 1MS1A 4YW4A 1INVA 1E8UA 3V1SA 5FWWA 4X47A 2SIMA 4GNCA 3GVKA 4FP2A 4YW1A 4X49A 2GVVA 3TIAA 2VW0A 4M3MA 2IAWA 1USRA 2XCYA 4I00A 1QLGA 4HZYA 5FNTA 4D52B 4GN7A 3G4EA 4XJRA 2F28A 1B9TA 4MWWA 3INBA 4XILA 4XOGA 5HX0A 4GZTA 1EUUA 1N1TA 1NNBA 2POOA 4YZ2A 1B9SA 2IVZA 1INXA 2HTRA 3TICA 1QBIA 1S0JA 3SRGA 1Z50A 1IVGA 2QWBA 3Q6KA 1IVEA 1V3BA 4GZSA 4R40A 3SOQA 5M1ZA 3V64C 2YA4A 1F8CA 4XJQA 4AHAA 3A72A 4MWUA 3HLHA 2F12A 1L7HA 4QNPA 1NMAN 2YA6A 3SOBB 2YDTA 4L7CA 1H6LA 2QWHA 2VWDA 5FNSA 3Q6TA 1NNCA 3A71A 4FPCA 1WCSA 4MC7A 1NCAN 2BATA 2YDPA 4JF7A 4L7DA 4FOQA 2C4AA 4NC5A 2QWKA 4K3YA 4ASCA 2VK5A 4IFNX 5GTQA 3ADEA 4WEGA 3LI4A 1N6FA 3A9GA 3TI3A 1E8TA 1W1XA 4QN6A 4M4UA 2IARA 4FOVA 3FW0A 3AMSA 4FOWA 1ZGKA 1V3CA 3NSSA 4GN9A 7NN9A 3VNHA 3S8ZA 4B7JA 4MJUA 2QWCA 4FPGA 4CPMA 3ZGDA 1Q7FA 4X4AA 2IAOA 2QWIA 1MS9A 3S2KA 1CQ1A 3JU4A 4ZY3A 5GX4A 3BYCA 1KITA 1NSCA 4O5TA 2YA8A 4IFJA 1C9UA 4CSDA 4ZGCA 1EUTA 2HTVA 3CL2A 4GDIA 2H2UA 2DG0A 1NMCA 1SLIA 4CPNA 1MS4A 4HZXA 2VSMA 4YY8A 3PJQA 5FNUA 4DG6A 1X2RA 4GZOA 2JKBA 1NSDA 5H47A 2H2NA 1N6DA 1S1DA 2HTUA 1Z4XA 2QWAA 4O5SA 4Q1UA 2VK7A 4DGRA 2IAXA 2HTYA 2QWGA 2YA5A 2HTWA 1Z4VA 1WP5A 3ZGCA 4D8SA 5GX3A 1ZI0A 3G4HA 2HQSA 3CL0A 5FZNA 3TC9A 2DSOA 2F25A 4GNAA 3S94A 1NCDN 3WWAA 4HW6A 4FPHA 2HU4A 2IAVA 4MWVA 1POOA 4XJ9A 2GVWA 1MZ5A 4X6KA 1E1AA 4WA4A 3DASA 4FQ4A 4D52C 3K39A 4FPEA 2B8HA 2FPCA 2WOZA 3TI4A 4GB1A 3GVLA 4CPZA 4AGIA 4GDJA 1SNTA 1N1VA 2W8BA 2HT7A 2ZZKA 2IATA 2F10A 4SLIA 5HUMA 2ISMA 2VVZA 2W8BB 4MWYA 3E5ZA 1MS5A 4H52A 4IYGA 5FNQA 4KS1A 2QWFA 1V0ZA 1N1YA 1F8DA 1K32A 2FPBA 3P5BL 3V65B 1CRZA 1VCJA 1XOEA 2AEQA 1IVFA 4GZQA 4AGTA 2ZWAA 3U0SA 2AEPA 1SLLA 1CRUA 4K1KA 4XIKA 3BEQA 3Q6PA 3K36A 1W8NA 1E8VA 1V0FA 1W0OA 3H72A 3KGGA 3B7EA 3WN7A 4XJUA 4GZXA 2GHSA 2XZIA 1N1SA 1W0PA 5D9BA 1A4GA 5FNRA 1MS8A 2F29A 2F27A 3II7A
chains in the Genus database with same CATH topology
4IMBA 4GNCA 2DG0A 5EX7A 5FWWA 4GNBA 2GVVA 2OJHA 2IAWA 3SOVA 4DG6A 1QLGA 4GN7A 3G4EA 4HHOA 1NPEA 3IAXA 2POOA 2IVZA 4O5SA 4Q1UA 3DR2A 1PJXA 2IAXA 4A0PA 1QBIA 1V04A 3SRGA 4ZLRA 3Q6KA 3A9HA 3O4PA 2QE8A 4R40A 3SOQA 3V64C 5GX3A 4PWZA 3G4HA 1RWIA 2HQSA 3TC9A 2P4OA 2DSOA 2VAQA 3HLHA 2V91A 4GNAA 3S94A 3WWAA 4HW6A 3SOBB 2IAVA 2IAPA 1POOA 1H6LA 1IJQA 4GN8A 2GVWA 5D9CA 2FP9A 5GX5A 1E1AA 3Q6TA 2G8SA 3DASA 3WW9A 3LI5A 3I1CA 3HRPA 2FPCA 3S8VA 2W8BA 1N7DA 3SREA 2IATA 2GVUA 5GTQA 2ISMA 2W8BB 3E5ZA 3KYAA 4IYGA 5GX1A 5D9DA 3P5BL 4JMLA 3LI4A 2FPBA 3A9GA 3V65B 1CRZA 2IARA 3HLIA 2IASA 3FW0A 3U0SA 2FP8A 3AMSA 1CRUA 3FVZA 3LI3A 4GN9A 3S8ZA 3Q6PA 1C5KA 2IAQA 3KGGA 1Q7FA 2IAOA 2DG1A 2GHSA 2GVXA 3S2KA 1CQ1A 1RWLA 5D9BA 5GX4A 4HHQA 5GX2A 1CVMA 3BYCA 2IAUA 3AMRA 4O5TA 1C9UA 3V1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IMB A;  4GNC A;  2DG0 A;  5EX7 A;  5FWW A;  4GNB A;  2GVV A;  2OJH A;  2IAW A;  3SOV A;  4DG6 A;  1QLG A;  4GN7 A;  3G4E A;  4HHO A;  1NPE A;  3IAX A;  2POO A;  2IVZ A;  4O5S A;  4Q1U A;  3DR2 A;  1PJX A;  2IAX A;  4A0P A;  1QBI A;  1V04 A;  3SRG A;  4ZLR A;  3Q6K A;  3A9H A;  3O4P A;  2QE8 A;  4R40 A;  3SOQ A;  3V64 C;  5GX3 A;  4PWZ A;  3G4H A;  1RWI A;  2HQS A;  3TC9 A;  2P4O A;  2DSO A;  2VAQ A;  3HLH A;  2V91 A;  4GNA A;  3S94 A;  3WWA A;  4HW6 A;  3SOB B;  2IAV A;  2IAP A;  1POO A;  1H6L A;  1IJQ A;  4GN8 A;  2GVW A;  5D9C A;  2FP9 A;  5GX5 A;  1E1A A;  3Q6T A;  2G8S A;  3DAS A;  3WW9 A;  3LI5 A;  3I1C A;  3HRP A;  2FPC A;  3S8V A;  2W8B A;  1N7D A;  3SRE A;  2IAT A;  2GVU A;  5GTQ A;  2ISM A;  2W8B B;  3E5Z A;  3KYA A;  4IYG A;  5GX1 A;  5D9D A;  3P5B L;  4JML A;  3LI4 A;  2FPB A;  3A9G A;  3V65 B;  1CRZ A;  2IAR A;  3HLI A;  2IAS A;  3FW0 A;  3U0S A;  2FP8 A;  3AMS A;  1CRU A;  3FVZ A;  3LI3 A;  4GN9 A;  3S8Z A;  3Q6P A;  1C5K A;  2IAQ A;  3KGG A;  1Q7F A;  2IAO A;  2DG1 A;  2GHS A;  2GVX A;  3S2K A;  1CQ1 A;  1RWL A;  5D9B A;  5GX4 A;  4HHQ A;  5GX2 A;  1CVM A;  3BYC A;  2IAU A;  3AMR A;  4O5T A;  1C9U A;  3V1S A; 
#chains in the Genus database with same CATH topology
 3L6V A;  1Z4W A;  1IVD A;  1VCU A;  4FPK A;  4B7N A;  2F13 A;  4CPL A;  4B7Q A;  3O9J A;  2F24 A;  2F26 A;  4GNB A;  2AH2 A;  4AH4 A;  4QN3 A;  3OPZ A;  2ZW9 A;  1INH A;  3SOV A;  2F11 A;  1IUC A;  4MWQ A;  1NPE A;  4HZZ A;  1S18 A;  4KS4 A;  5CGJ A;  1EUR A;  2XZK A;  3IAX A;  1IUB A;  4MX0 A;  3H6J A;  4D4U A;  3DR2 A;  1F8B A;  3H71 A;  1IVB A;  4FVK A;  1PJX A;  4GEZ A;  4XJ8 A;  4B7R A;  2W5N A;  4G3N A;  4QN5 A;  5NN9 A;  1V04 A;  3SLI A;  3A9H A;  1V2I A;  1MS0 A;  1U6D X;  2W20 A;  3D12 A;  4XIO A;  3VNG A;  4BBW A;  3NN9 A;  3K37 A;  1W20 A;  2XN4 A;  2Z32 A;  2P4O A;  5F9T A;  1NNA A;  4CH9 A;  2VK6 A;  1NSB A;  3NO0 A;  1A14 N;  2AGS A;  2IAP A;  1IJQ A;  1V3D A;  3D11 A;  4GN8 A;  4QN4 A;  1V0E A;  5D9C A;  5EO8 A;  4NN9 A;  2HT8 A;  4WA3 A;  5GX5 A;  3SIL A;  2SLI A;  3WW9 A;  4L7B A;  4GZP A;  2BER A;  2HU0 A;  4XE9 A;  4FPL A;  4MJV A;  1EUS A;  1WCQ A;  1USX A;  3SRE A;  1N7D A;  1NCB N;  4N1B A;  1L7F A;  4YW3 A;  1Z4Z A;  1MWE A;  3KYA A;  4K1J A;  5GX1 A;  2VPJ A;  4JML A;  2SIL A;  1B9V A;  4CPO A;  4B7M A;  3HLI A;  1Z4Y A;  2VW1 A;  2FP8 A;  3TIB A;  4YZ1 A;  1NMB N;  1NCC N;  4GZW A;  4M4V A;  4D52 A;  1C5K A;  4NCS A;  4UOU A;  1F8E A;  3GVJ A;  1MR5 A;  1SO7 A;  4XHB A;  4XMB A;  1XOG A;  3SAN A;  1W21 A;  2IAQ A;  1W8O A;  2FLU X;  5B2D A;  1A4Q A;  3UC1 A;  2GVX A;  4XMA A;  2QWE A;  4MWJ A;  2ZB5 A;  4FPY A;  4HHQ A;  1CVM A;  2BZD A;  2IAU A;  3AMR A;  5GX2 A;  1BJI A;  5HUN A;  1INF A;  4IMB A;  5EX7 A;  4Q6K A;  5B2C A;  1OFZ A;  4FPF A;  4KS2 A;  2QWD A;  2VSK A;  4FPJ A;  2HTQ A;  2OJH A;  5F72 C;  3SAL A;  2QWJ A;  2XZJ A;  4IQK A;  3T1E A;  4HHO A;  4YW2 A;  3TI6 A;  1SUU A;  4A0P A;  4MWR A;  4ZLR A;  2W38 A;  4MZA A;  1MZ6 A;  3O4P A;  2QE8 A;  3TI5 A;  3CKZ A;  4K1H A;  1N6E A;  4PWZ A;  2C4L A;  1RWI A;  2CML A;  4QN7 A;  1NN2 A;  4M4N A;  2DYH A;  2VAQ A;  4KS3 A;  2V91 A;  2FHR A;  3O9K A;  4YW5 A;  3B69 A;  5FZJ A;  2A75 A;  1DIM A;  1L7G A;  4UF7 A;  4XYX A;  1DIL A;  2X9M A;  4XMI A;  1ING A;  3K38 A;  2FP9 A;  4K1I A;  4C1Y A;  3H73 A;  6NN9 A;  2G8S A;  4FPO B;  4CHB A;  4FOY A;  3LI5 A;  1MS3 A;  2F0Z A;  3ALX A;  2W5O A;  3CYE A;  3I1C A;  4C1Y B;  3W09 A;  3K3A A;  3HRP A;  1INW A;  4YZ4 A;  4MWL A;  4CPY A;  3S8V A;  4FJ6 A;  4FZH A;  4WA5 A;  4GJT A;  3WDZ A;  2GVU A;  1INY A;  1V3E A;  2ZB6 A;  4KS5 A;  4HZW A;  1IVC A;  3ALW A;  4YZ5 A;  2YA7 A;  5D9D A;  4MZE A;  1S0I A;  4XJA A;  4IFL X;  4H53 A;  2VW2 A;  3TI8 A;  2IAS A;  2RKC A;  4WEF A;  4XHX A;  4XJZ A;  3FVZ A;  3LI3 A;  4YZ3 A;  5EO7 A;  4J9T A;  4MWX A;  1X2J A;  4HIZ A;  2DG1 A;  4IN4 A;  4HZV A;  2BF6 A;  4XJW A;  5HUK A;  4FP3 A;  1RWL A;  5HUG A;  5JYY A;  2HT5 A;  1MS1 A;  4YW4 A;  1INV A;  1E8U A;  3V1S A;  5FWW A;  4X47 A;  2SIM A;  4GNC A;  3GVK A;  4FP2 A;  4YW1 A;  4X49 A;  2GVV A;  3TIA A;  2VW0 A;  4M3M A;  2IAW A;  1USR A;  2XCY A;  4I00 A;  1QLG A;  4HZY A;  5FNT A;  4D52 B;  4GN7 A;  3G4E A;  4XJR A;  2F28 A;  1B9T A;  4MWW A;  3INB A;  4XIL A;  4XOG A;  5HX0 A;  4GZT A;  1EUU A;  1N1T A;  1NNB A;  2POO A;  4YZ2 A;  1B9S A;  2IVZ A;  1INX A;  2HTR A;  3TIC A;  1QBI A;  1S0J A;  3SRG A;  1Z50 A;  1IVG A;  2QWB A;  3Q6K A;  1IVE A;  1V3B A;  4GZS A;  4R40 A;  3SOQ A;  5M1Z A;  3V64 C;  2YA4 A;  1F8C A;  4XJQ A;  4AHA A;  3A72 A;  4MWU A;  3HLH A;  2F12 A;  1L7H A;  4QNP A;  1NMA N;  2YA6 A;  3SOB B;  2YDT A;  4L7C A;  1H6L A;  2QWH A;  2VWD A;  5FNS A;  3Q6T A;  1NNC A;  3A71 A;  4FPC A;  1WCS A;  4MC7 A;  1NCA N;  2BAT A;  2YDP A;  4JF7 A;  4L7D A;  4FOQ A;  2C4A A;  4NC5 A;  2QWK A;  4K3Y A;  4ASC A;  2VK5 A;  4IFN X;  5GTQ A;  3ADE A;  4WEG A;  3LI4 A;  1N6F A;  3A9G A;  3TI3 A;  1E8T A;  1W1X A;  4QN6 A;  4M4U A;  2IAR A;  4FOV A;  3FW0 A;  3AMS A;  4FOW A;  1ZGK A;  1V3C A;  3NSS A;  4GN9 A;  7NN9 A;  3VNH A;  3S8Z A;  4B7J A;  4MJU A;  2QWC A;  4FPG A;  4CPM A;  3ZGD A;  1Q7F A;  4X4A A;  2IAO A;  2QWI A;  1MS9 A;  3S2K A;  1CQ1 A;  3JU4 A;  4ZY3 A;  5GX4 A;  3BYC A;  1KIT A;  1NSC A;  4O5T A;  2YA8 A;  4IFJ A;  1C9U A;  4CSD A;  4ZGC A;  1EUT A;  2HTV A;  3CL2 A;  4GDI A;  2H2U A;  2DG0 A;  1NMC A;  1SLI A;  4CPN A;  1MS4 A;  4HZX A;  2VSM A;  4YY8 A;  3PJQ A;  5FNU A;  4DG6 A;  1X2R A;  4GZO A;  2JKB A;  1NSD A;  5H47 A;  2H2N A;  1N6D A;  1S1D A;  2HTU A;  1Z4X A;  2QWA A;  4O5S A;  4Q1U A;  2VK7 A;  4DGR A;  2IAX A;  2HTY A;  2QWG A;  2YA5 A;  2HTW A;  1Z4V A;  1WP5 A;  3ZGC A;  4D8S A;  5GX3 A;  1ZI0 A;  3G4H A;  2HQS A;  3CL0 A;  5FZN A;  3TC9 A;  2DSO A;  2F25 A;  4GNA A;  3S94 A;  1NCD N;  3WWA A;  4HW6 A;  4FPH A;  2HU4 A;  2IAV A;  4MWV A;  1POO A;  4XJ9 A;  2GVW A;  1MZ5 A;  4X6K A;  1E1A A;  4WA4 A;  3DAS A;  4FQ4 A;  4D52 C;  3K39 A;  4FPE A;  2B8H A;  2FPC A;  2WOZ A;  3TI4 A;  4GB1 A;  3GVL A;  4CPZ A;  4AGI A;  4GDJ A;  1SNT A;  1N1V A;  2W8B A;  2HT7 A;  2ZZK A;  2IAT A;  2F10 A;  4SLI A;  5HUM A;  2ISM A;  2VVZ A;  2W8B B;  4MWY A;  3E5Z A;  1MS5 A;  4H52 A;  4IYG A;  5FNQ A;  4KS1 A;  2QWF A;  1V0Z A;  1N1Y A;  1F8D A;  1K32 A;  2FPB A;  3P5B L;  3V65 B;  1CRZ A;  1VCJ A;  1XOE A;  2AEQ A;  1IVF A;  4GZQ A;  4AGT A;  2ZWA A;  3U0S A;  2AEP A;  1SLL A;  1CRU A;  4K1K A;  4XIK A;  3BEQ A;  3Q6P A;  3K36 A;  1W8N A;  1E8V A;  1V0F A;  1W0O A;  3H72 A;  3KGG A;  3B7E A;  3WN7 A;  4XJU A;  4GZX A;  2GHS A;  2XZI A;  1N1S A;  1W0P A;  5D9B A;  1A4G A;  5FNR A;  1MS8 A;  2F29 A;  2F27 A;  3II7 A; 
#chains in the Genus database with same CATH homology
 4IMB A;  4GNC A;  2DG0 A;  5EX7 A;  5FWW A;  4GNB A;  2GVV A;  2OJH A;  2IAW A;  3SOV A;  4DG6 A;  1QLG A;  4GN7 A;  3G4E A;  4HHO A;  1NPE A;  3IAX A;  2POO A;  2IVZ A;  4O5S A;  4Q1U A;  3DR2 A;  1PJX A;  2IAX A;  4A0P A;  1QBI A;  1V04 A;  3SRG A;  4ZLR A;  3Q6K A;  3A9H A;  3O4P A;  2QE8 A;  4R40 A;  3SOQ A;  3V64 C;  5GX3 A;  4PWZ A;  3G4H A;  1RWI A;  2HQS A;  3TC9 A;  2P4O A;  2DSO A;  2VAQ A;  3HLH A;  2V91 A;  4GNA A;  3S94 A;  3WWA A;  4HW6 A;  3SOB B;  2IAV A;  2IAP A;  1POO A;  1H6L A;  1IJQ A;  4GN8 A;  2GVW A;  5D9C A;  2FP9 A;  5GX5 A;  1E1A A;  3Q6T A;  2G8S A;  3DAS A;  3WW9 A;  3LI5 A;  3I1C A;  3HRP A;  2FPC A;  3S8V A;  2W8B A;  1N7D A;  3SRE A;  2IAT A;  2GVU A;  5GTQ A;  2ISM A;  2W8B B;  3E5Z A;  3KYA A;  4IYG A;  5GX1 A;  5D9D A;  3P5B L;  4JML A;  3LI4 A;  2FPB A;  3A9G A;  3V65 B;  1CRZ A;  2IAR A;  3HLI A;  2IAS A;  3FW0 A;  3U0S A;  2FP8 A;  3AMS A;  1CRU A;  3FVZ A;  3LI3 A;  4GN9 A;  3S8Z A;  3Q6P A;  1C5K A;  2IAQ A;  3KGG A;  1Q7F A;  2IAO A;  2DG1 A;  2GHS A;  2GVX A;  3S2K A;  1CQ1 A;  1RWL A;  5D9B A;  5GX4 A;  4HHQ A;  5GX2 A;  1CVM A;  3BYC A;  2IAU A;  3AMR A;  4O5T A;  1C9U A;  3V1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...